F463466
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 558 | 256 | 1116 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300039453|Ga0436362_0858937|Ga0436362_0858937_375_758 |
| Length | 127 |
| Sequence | MTMQEQLPRPFTNNEDVKYGMLRLVDIPAEAAANQPWFNQTLTTVDQAVVRVGIFQGEFPWHKHIEQDEFFLVLEGEIALDVEGQEPVLLSQHQGFTVPKSTMHRPRASQRSVVLMVESLGIVPTGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 203 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 204 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 205 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.91 |
| Rhizosphere | 93.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 45.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436362_0858937 | 3300039453 | Unclassified | 781 |
| 2 | SwRhRL2b_contig_455266 | 2162886007 | Unclassified | 1353 |
| 3 | JGI24750J21931_1081098 | 3300002070 | Bacteria | 540 |
| 4 | JGI24035J26624_1000950 | 3300002126 | Bacteria | 2733 |
| 5 | JGI24035J26624_1002123 | 3300002126 | Unclassified | 1850 |
| 6 | JGI25406J46586_10000067 | 3300003203 | Bacteria | 47883 |
| 7 | JGI25405J52794_10047487 | 3300003911 | Unclassified | 916 |
| 8 | Ga0065714_10306699 | 3300005288 | Bacteria | 673 |
| 9 | Ga0065714_10445391 | 3300005288 | Unclassified | 557 |
| 10 | Ga0065704_10087106 | 3300005289 | Unclassified | 3054 |
| 11 | Ga0065704_10536454 | 3300005289 | Bacteria | 644 |
| 12 | Ga0065704_10568642 | 3300005289 | Unclassified | 625 |
| 13 | Ga0065704_10730457 | 3300005289 | Unclassified | 546 |
| 14 | Ga0065712_10033944 | 3300005290 | Bacteria | 1338 |
| 15 | Ga0065712_10131832 | 3300005290 | Bacteria | 1540 |
| 16 | Ga0065712_10204465 | 3300005290 | Unclassified | 1096 |
| 17 | Ga0065712_10267956 | 3300005290 | Unclassified | 907 |
| 18 | Ga0065715_10002584 | 3300005293 | Bacteria | 8292 |
| 19 | Ga0065715_10026469 | 3300005293 | Bacteria | 1266 |
| 20 | Ga0065715_10311466 | 3300005293 | Bacteria | 1019 |
| 21 | Ga0065715_10447634 | 3300005293 | Unclassified | 818 |
| 22 | Ga0065715_10739763 | 3300005293 | Unclassified | 635 |
| 23 | Ga0065715_10900609 | 3300005293 | Bacteria | 575 |
| 24 | Ga0065707_10095695 | 3300005295 | Bacteria | 3345 |
| 25 | Ga0070658_10782516 | 3300005327 | Unclassified | 829 |
| 26 | Ga0070676_10024671 | 3300005328 | Bacteria | 3390 |
| 27 | Ga0070676_10170926 | 3300005328 | Bacteria | 1406 |
| 28 | Ga0070683_100017017 | 3300005329 | Bacteria | 6416 |
| 29 | Ga0070683_100415267 | 3300005329 | Unclassified | 1283 |
| 30 | Ga0070683_100592529 | 3300005329 | Bacteria | 1061 |
| 31 | Ga0070690_100044368 | 3300005330 | Unclassified | 2821 |
| 32 | Ga0070690_100065238 | 3300005330 | Bacteria | 2354 |
| 33 | Ga0070690_100093894 | 3300005330 | Unclassified | 1979 |
| 34 | Ga0070666_10092640 | 3300005335 | Unclassified | 2078 |
| 35 | Ga0070680_100036707 | 3300005336 | Bacteria | 3960 |
| 36 | Ga0070680_100395246 | 3300005336 | Bacteria | 1178 |
| 37 | Ga0068868_100006655 | 3300005338 | Bacteria | 8198 |
| 38 | Ga0068868_100077055 | 3300005338 | Unclassified | 2667 |
| 39 | Ga0068868_100128766 | 3300005338 | Bacteria | 2070 |
| 40 | Ga0070660_100198782 | 3300005339 | Unclassified | 1626 |
| 41 | Ga0070689_100016735 | 3300005340 | Bacteria | 5371 |
| 42 | Ga0070689_100031310 | 3300005340 | Bacteria | 4042 |
| 43 | Ga0070689_100064185 | 3300005340 | Unclassified | 2858 |
| 44 | Ga0070687_100028866 | 3300005343 | Bacteria | 2695 |
| 45 | Ga0070687_100050317 | 3300005343 | Bacteria | 2151 |
| 46 | Ga0070661_100029219 | 3300005344 | Bacteria | 3977 |
| 47 | Ga0070668_100065768 | 3300005347 | Unclassified | 2812 |
| 48 | Ga0070668_100140709 | 3300005347 | Bacteria | 1944 |
| 49 | Ga0070668_101483150 | 3300005347 | Unclassified | 620 |
| 50 | Ga0070669_100004177 | 3300005353 | Bacteria | 10462 |
| 51 | Ga0070675_100022574 | 3300005354 | Bacteria | 5029 |
| 52 | Ga0070675_100080971 | 3300005354 | Bacteria | 2707 |
| 53 | Ga0070675_100103216 | 3300005354 | Unclassified | 2404 |
| 54 | Ga0070675_100117795 | 3300005354 | Unclassified | 2254 |
| 55 | Ga0070675_100500748 | 3300005354 | Bacteria | 1095 |
| 56 | Ga0070675_100537364 | 3300005354 | Unclassified | 1056 |
| 57 | Ga0070675_100589085 | 3300005354 | Bacteria | 1008 |
| 58 | Ga0070671_100011335 | 3300005355 | Bacteria | 7166 |
| 59 | Ga0070671_100059775 | 3300005355 | Bacteria | 3172 |
| 60 | Ga0070671_100195959 | 3300005355 | Unclassified | 1713 |
| 61 | Ga0070674_101781517 | 3300005356 | Unclassified | 558 |
| 62 | Ga0070673_100067963 | 3300005364 | Unclassified | 2852 |
| 63 | Ga0070673_100268343 | 3300005364 | Bacteria | 1493 |
| 64 | Ga0070673_101522931 | 3300005364 | Unclassified | 631 |
| 65 | Ga0070688_100038306 | 3300005365 | Unclassified | 2927 |
| 66 | Ga0070688_100049783 | 3300005365 | Bacteria | 2608 |
| 67 | Ga0070688_100219711 | 3300005365 | Bacteria | 1338 |
| 68 | Ga0070659_100007119 | 3300005366 | Bacteria | 8112 |
| 69 | Ga0070659_100021775 | 3300005366 | Bacteria | 4887 |
| 70 | Ga0070659_100268849 | 3300005366 | Unclassified | 1416 |
| 71 | Ga0070659_100358849 | 3300005366 | Unclassified | 1224 |
| 72 | Ga0070659_100684621 | 3300005366 | Bacteria | 886 |
| 73 | Ga0070659_101019066 | 3300005366 | Unclassified | 727 |
| 74 | Ga0070667_100004390 | 3300005367 | Bacteria | 11898 |
| 75 | Ga0070667_100267247 | 3300005367 | Unclassified | 1533 |
| 76 | Ga0070667_100570742 | 3300005367 | Unclassified | 1041 |
| 77 | Ga0070667_100767217 | 3300005367 | Bacteria | 894 |
| 78 | Ga0070709_10264958 | 3300005434 | Bacteria | 1243 |
| 79 | Ga0070714_100153087 | 3300005435 | Bacteria | 2080 |
| 80 | Ga0070714_100184306 | 3300005435 | Bacteria | 1901 |
| 81 | Ga0070714_100544475 | 3300005435 | Unclassified | 1110 |
| 82 | Ga0070714_101944773 | 3300005435 | Unclassified | 574 |
| 83 | Ga0070713_100039977 | 3300005436 | Bacteria | 3811 |
| 84 | Ga0070713_100159659 | 3300005436 | Bacteria | 2011 |
| 85 | Ga0070710_10059206 | 3300005437 | Bacteria | 2175 |
| 86 | Ga0070701_10729678 | 3300005438 | Unclassified | 669 |
| 87 | Ga0070711_100324058 | 3300005439 | Unclassified | 1232 |
| 88 | Ga0070705_100278192 | 3300005440 | Bacteria | 1189 |
| 89 | Ga0070705_100495222 | 3300005440 | Bacteria | 927 |
| 90 | Ga0070700_100017924 | 3300005441 | Bacteria | 4060 |
| 91 | Ga0070708_100027791 | 3300005445 | Bacteria | 4859 |
| 92 | Ga0070708_100039802 | 3300005445 | Unclassified | 4115 |
| 93 | Ga0070708_100110864 | 3300005445 | Bacteria | 2522 |
| 94 | Ga0070708_100227142 | 3300005445 | Bacteria | 1751 |
| 95 | Ga0070708_100349873 | 3300005445 | Bacteria | 1393 |
| 96 | Ga0070708_100413847 | 3300005445 | Unclassified | 1271 |
| 97 | Ga0070708_100502561 | 3300005445 | Bacteria | 1144 |
| 98 | Ga0070708_101284629 | 3300005445 | Unclassified | 684 |
| 99 | Ga0070708_101745578 | 3300005445 | Unclassified | 578 |
| 100 | Ga0070678_100170576 | 3300005456 | Unclassified | 1772 |
| 101 | Ga0070678_100425393 | 3300005456 | Bacteria | 1158 |
| 102 | Ga0070662_100001546 | 3300005457 | Bacteria | 14200 |
| 103 | Ga0070662_100052211 | 3300005457 | Unclassified | 2954 |
| 104 | Ga0070662_100955737 | 3300005457 | Unclassified | 732 |
| 105 | Ga0070681_10011031 | 3300005458 | Bacteria | 8933 |
| 106 | Ga0070681_10574130 | 3300005458 | Bacteria | 1041 |
| 107 | Ga0070681_10896606 | 3300005458 | Unclassified | 805 |
| 108 | Ga0068867_100676580 | 3300005459 | Bacteria | 908 |
| 109 | Ga0070685_10053155 | 3300005466 | Bacteria | 2346 |
| 110 | Ga0070706_100000035 | 3300005467 | Bacteria | 152107 |
| 111 | Ga0070706_100007350 | 3300005467 | Bacteria | 10334 |
| 112 | Ga0070706_100156020 | 3300005467 | Bacteria | 2131 |
| 113 | Ga0070706_100331121 | 3300005467 | Bacteria | 1420 |
| 114 | Ga0070706_100624340 | 3300005467 | Bacteria | 1001 |
| 115 | Ga0070706_100644314 | 3300005467 | Unclassified | 984 |
| 116 | Ga0070706_100960697 | 3300005467 | Unclassified | 788 |
| 117 | Ga0070706_101059555 | 3300005467 | Unclassified | 747 |
| 118 | Ga0070706_101165037 | 3300005467 | Unclassified | 709 |
| 119 | Ga0070707_100002759 | 3300005468 | Bacteria | 16720 |
| 120 | Ga0070707_100019676 | 3300005468 | Bacteria | 6363 |
| 121 | Ga0070707_100021772 | 3300005468 | Bacteria | 6059 |
| 122 | Ga0070707_100296901 | 3300005468 | Bacteria | 1570 |
| 123 | Ga0070707_100354975 | 3300005468 | Bacteria | 1424 |
| 124 | Ga0070707_100394739 | 3300005468 | Unclassified | 1343 |
| 125 | Ga0070707_100506721 | 3300005468 | Unclassified | 1169 |
| 126 | Ga0070707_101029710 | 3300005468 | Bacteria | 789 |
| 127 | Ga0070698_100001022 | 3300005471 | Bacteria | 30790 |
| 128 | Ga0070698_100026006 | 3300005471 | Bacteria | 6097 |
| 129 | Ga0070698_100103586 | 3300005471 | Bacteria | 2816 |
| 130 | Ga0070698_100164416 | 3300005471 | Bacteria | 2162 |
| 131 | Ga0070698_100380559 | 3300005471 | Bacteria | 1344 |
| 132 | Ga0070698_100791225 | 3300005471 | Bacteria | 892 |
| 133 | Ga0070699_100147831 | 3300005518 | Unclassified | 2077 |
| 134 | Ga0070699_100174426 | 3300005518 | Unclassified | 1906 |
| 135 | Ga0070699_100326928 | 3300005518 | Bacteria | 1379 |
| 136 | Ga0070699_100550622 | 3300005518 | Unclassified | 1050 |
| 137 | Ga0070699_100907310 | 3300005518 | Unclassified | 807 |
| 138 | Ga0070699_101841444 | 3300005518 | Unclassified | 554 |
| 139 | Ga0070699_102139626 | 3300005518 | Unclassified | 511 |
| 140 | Ga0070679_100009498 | 3300005530 | Bacteria | 9200 |
| 141 | Ga0070684_100002121 | 3300005535 | Bacteria | 14623 |
| 142 | Ga0070684_100442029 | 3300005535 | Unclassified | 1201 |
| 143 | Ga0070684_100470402 | 3300005535 | Unclassified | 1163 |
| 144 | Ga0070697_100006797 | 3300005536 | Bacteria | 8876 |
| 145 | Ga0070697_100046174 | 3300005536 | Unclassified | 3530 |
| 146 | Ga0070697_100102497 | 3300005536 | Unclassified | 2378 |
| 147 | Ga0070697_100249175 | 3300005536 | Unclassified | 1518 |
| 148 | Ga0070697_100251470 | 3300005536 | Unclassified | 1511 |
| 149 | Ga0070697_100354199 | 3300005536 | Unclassified | 1268 |
| 150 | Ga0070697_100389692 | 3300005536 | Bacteria | 1208 |
| 151 | Ga0068853_100595947 | 3300005539 | Bacteria | 1049 |
| 152 | Ga0070672_100102883 | 3300005543 | Unclassified | 2319 |
| 153 | Ga0070672_100217726 | 3300005543 | Unclassified | 1601 |
| 154 | Ga0070686_100304619 | 3300005544 | Bacteria | 1183 |
| 155 | Ga0070695_100239720 | 3300005545 | Unclassified | 1315 |
| 156 | Ga0070695_101422670 | 3300005545 | Bacteria | 575 |
| 157 | Ga0070693_100329417 | 3300005547 | Unclassified | 1039 |
| 158 | Ga0070665_100013634 | 3300005548 | Bacteria | 8175 |
| 159 | Ga0070665_100052248 | 3300005548 | Bacteria | 4100 |
| 160 | Ga0070665_100362550 | 3300005548 | Bacteria | 1455 |
| 161 | Ga0070665_100459082 | 3300005548 | Unclassified | 1284 |
| 162 | Ga0070704_100018482 | 3300005549 | Bacteria | 4459 |
| 163 | Ga0068855_101466973 | 3300005563 | Bacteria | 701 |
| 164 | Ga0070664_100034554 | 3300005564 | Bacteria | 4241 |
| 165 | Ga0070664_101855786 | 3300005564 | Unclassified | 572 |
| 166 | Ga0068854_100745720 | 3300005578 | Unclassified | 849 |
| 167 | Ga0068856_100082372 | 3300005614 | Bacteria | 3193 |
| 168 | Ga0070702_100081033 | 3300005615 | Unclassified | 1944 |
| 169 | Ga0070702_100102189 | 3300005615 | Bacteria | 1760 |
| 170 | Ga0070702_100694259 | 3300005615 | Bacteria | 775 |
| 171 | Ga0070702_101486215 | 3300005615 | Unclassified | 557 |
| 172 | Ga0068852_100517618 | 3300005616 | Unclassified | 1190 |
| 173 | Ga0068861_100057171 | 3300005719 | Bacteria | 2979 |
| 174 | Ga0068861_100127311 | 3300005719 | Bacteria | 2063 |
| 175 | Ga0068863_100498627 | 3300005841 | Bacteria | 1199 |
| 176 | Ga0068863_101132545 | 3300005841 | Unclassified | 787 |
| 177 | Ga0068858_100341611 | 3300005842 | Bacteria | 1433 |
| 178 | Ga0068858_102334958 | 3300005842 | Unclassified | 529 |
| 179 | Ga0068860_100002246 | 3300005843 | Bacteria | 20333 |
| 180 | Ga0068860_100059423 | 3300005843 | Bacteria | 3635 |
| 181 | Ga0068862_100010280 | 3300005844 | Bacteria | 7720 |
| 182 | Ga0068862_101028500 | 3300005844 | Unclassified | 816 |
| 183 | Ga0081455_10000281 | 3300005937 | Bacteria | 67337 |
| 184 | Ga0081455_10003189 | 3300005937 | Bacteria | 19030 |
| 185 | Ga0081455_10003558 | 3300005937 | Bacteria | 17872 |
| 186 | Ga0081455_10008185 | 3300005937 | Bacteria | 10907 |
| 187 | Ga0081540_1015564 | 3300005983 | Bacteria | 4810 |
| 188 | Ga0081540_1121914 | 3300005983 | Bacteria | 1080 |
| 189 | Ga0081540_1202675 | 3300005983 | Unclassified | 720 |
| 190 | Ga0081539_10000287 | 3300005985 | Bacteria | 113988 |
| 191 | Ga0081539_10024836 | 3300005985 | Bacteria | 3875 |
| 192 | Ga0081539_10130481 | 3300005985 | Unclassified | 1235 |
| 193 | Ga0081539_10137078 | 3300005985 | Bacteria | 1193 |
| 194 | Ga0070717_10121884 | 3300006028 | Bacteria | 2234 |
| 195 | Ga0070717_10155224 | 3300006028 | Unclassified | 1982 |
| 196 | Ga0070717_10223823 | 3300006028 | Bacteria | 1654 |
| 197 | Ga0070717_12095427 | 3300006028 | Unclassified | 509 |
| 198 | Ga0070715_10016363 | 3300006163 | Unclassified | 2785 |
| 199 | Ga0070716_100020092 | 3300006173 | Unclassified | 3502 |
| 200 | Ga0070716_100515612 | 3300006173 | Unclassified | 885 |
| 201 | Ga0070716_100826948 | 3300006173 | Unclassified | 719 |
| 202 | Ga0070716_100943727 | 3300006173 | Unclassified | 678 |
| 203 | Ga0070712_100028740 | 3300006175 | Unclassified | 3721 |
| 204 | Ga0070712_100198771 | 3300006175 | Bacteria | 1573 |
| 205 | Ga0070712_100208746 | 3300006175 | Bacteria | 1539 |
| 206 | Ga0070712_100619139 | 3300006175 | Unclassified | 917 |
| 207 | Ga0070712_101230455 | 3300006175 | Bacteria | 652 |
| 208 | Ga0097621_100059525 | 3300006237 | Bacteria | 3128 |
| 209 | Ga0097621_100786590 | 3300006237 | Bacteria | 881 |
| 210 | Ga0097621_101048066 | 3300006237 | Unclassified | 764 |
| 211 | Ga0097621_102410625 | 3300006237 | Unclassified | 503 |
| 212 | Ga0068871_100100311 | 3300006358 | Unclassified | 2425 |
| 213 | Ga0068871_100998506 | 3300006358 | Unclassified | 779 |
| 214 | Ga0075431_101100235 | 3300006847 | Unclassified | 759 |
| 215 | Ga0075433_10000013 | 3300006852 | Bacteria | 68708 |
| 216 | Ga0075433_10406751 | 3300006852 | Unclassified | 1201 |
| 217 | Ga0075434_100000707 | 3300006871 | Bacteria | 26071 |
| 218 | Ga0075434_102570089 | 3300006871 | Unclassified | 510 |
| 219 | Ga0075436_100240123 | 3300006914 | Bacteria | 1288 |
| 220 | Ga0075436_100521281 | 3300006914 | Bacteria | 871 |
| 221 | Ga0075435_100000262 | 3300007076 | Bacteria | 32699 |
| 222 | Ga0075435_100196290 | 3300007076 | Bacteria | 1709 |
| 223 | Ga0075435_100765579 | 3300007076 | Unclassified | 840 |
| 224 | Ga0075435_100789960 | 3300007076 | Unclassified | 826 |
| 225 | Ga0075435_101844832 | 3300007076 | Bacteria | 531 |
| 226 | Ga0099795_10216084 | 3300007788 | Unclassified | 814 |
| 227 | Ga0105240_10674566 | 3300009093 | Bacteria | 1131 |
| 228 | Ga0105240_11812996 | 3300009093 | Unclassified | 636 |
| 229 | Ga0111539_10546083 | 3300009094 | Bacteria | 1350 |
| 230 | Ga0105245_10017104 | 3300009098 | Bacteria | 6328 |
| 231 | Ga0105245_10246659 | 3300009098 | Unclassified | 1733 |
| 232 | Ga0105245_10998095 | 3300009098 | Unclassified | 881 |
| 233 | Ga0105245_11527435 | 3300009098 | Unclassified | 719 |
| 234 | Ga0105247_10229849 | 3300009101 | Bacteria | 1259 |
| 235 | Ga0114129_10014026 | 3300009147 | Bacteria | 11414 |
| 236 | Ga0114129_10178050 | 3300009147 | Unclassified | 2895 |
| 237 | Ga0114129_10216235 | 3300009147 | Unclassified | 2588 |
| 238 | Ga0114129_10312940 | 3300009147 | Unclassified | 2089 |
| 239 | Ga0105243_10012007 | 3300009148 | Bacteria | 6548 |
| 240 | Ga0105243_10118703 | 3300009148 | Bacteria | 2226 |
| 241 | Ga0105241_10232662 | 3300009174 | Unclassified | 1554 |
| 242 | Ga0105242_10384116 | 3300009176 | Bacteria | 1306 |
| 243 | Ga0105242_11152160 | 3300009176 | Unclassified | 792 |
| 244 | Ga0105237_10064070 | 3300009545 | Bacteria | 3673 |
| 245 | Ga0105237_10304409 | 3300009545 | Bacteria | 1597 |
| 246 | Ga0105237_10358385 | 3300009545 | Bacteria | 1463 |
| 247 | Ga0105238_11924046 | 3300009551 | Bacteria | 624 |
| 248 | Ga0105249_10000764 | 3300009553 | Bacteria | 28918 |
| 249 | Ga0105249_10006018 | 3300009553 | Bacteria | 10511 |
| 250 | Ga0105249_13482021 | 3300009553 | Unclassified | 507 |
| 251 | Ga0099796_10196328 | 3300010159 | Unclassified | 817 |
| 252 | Ga0099796_10522643 | 3300010159 | Unclassified | 532 |
| 253 | Ga0105239_10006314 | 3300010375 | Bacteria | 13788 |
| 254 | Ga0105239_10088096 | 3300010375 | Bacteria | 3422 |
| 255 | Ga0105239_10117843 | 3300010375 | Bacteria | 2947 |
| 256 | Ga0105239_10394534 | 3300010375 | Bacteria | 1566 |
| 257 | Ga0105239_11465759 | 3300010375 | Unclassified | 788 |
| 258 | Ga0105246_10063113 | 3300011119 | Unclassified | 2583 |
| 259 | Ga0105246_10484178 | 3300011119 | Bacteria | 1047 |
| 260 | Ga0157371_10497703 | 3300013102 | Unclassified | 900 |
| 261 | Ga0157370_10303491 | 3300013104 | Unclassified | 1473 |
| 262 | Ga0157374_10004212 | 3300013296 | Bacteria | 12088 |
| 263 | Ga0157374_10021742 | 3300013296 | Bacteria | 5713 |
| 264 | Ga0157374_10053022 | 3300013296 | Bacteria | 3780 |
| 265 | Ga0157374_10109229 | 3300013296 | Bacteria | 2659 |
| 266 | Ga0157374_10242718 | 3300013296 | Unclassified | 1772 |
| 267 | Ga0157374_10358468 | 3300013296 | Unclassified | 1450 |
| 268 | Ga0157374_10797652 | 3300013296 | Bacteria | 960 |
| 269 | Ga0157374_10958830 | 3300013296 | Unclassified | 874 |
| 270 | Ga0157374_11003739 | 3300013296 | Unclassified | 854 |
| 271 | Ga0157374_11375966 | 3300013296 | Unclassified | 728 |
| 272 | Ga0157378_10001788 | 3300013297 | Bacteria | 19301 |
| 273 | Ga0157378_10355630 | 3300013297 | Unclassified | 1432 |
| 274 | Ga0157378_10358474 | 3300013297 | Unclassified | 1426 |
| 275 | Ga0157378_10501780 | 3300013297 | Bacteria | 1212 |
| 276 | Ga0157378_10625943 | 3300013297 | Bacteria | 1090 |
| 277 | Ga0157378_10777100 | 3300013297 | Bacteria | 982 |
| 278 | Ga0157378_10801201 | 3300013297 | Bacteria | 968 |
| 279 | Ga0163162_10011970 | 3300013306 | Bacteria | 8460 |
| 280 | Ga0163162_10475906 | 3300013306 | Bacteria | 1380 |
| 281 | Ga0163162_10536902 | 3300013306 | Unclassified | 1298 |
| 282 | Ga0163162_10855968 | 3300013306 | Bacteria | 1024 |
| 283 | Ga0163162_11115953 | 3300013306 | Unclassified | 894 |
| 284 | Ga0163162_12181820 | 3300013306 | Unclassified | 636 |
| 285 | Ga0157372_10009787 | 3300013307 | Bacteria | 10194 |
| 286 | Ga0157372_10022040 | 3300013307 | Bacteria | 6888 |
| 287 | Ga0157372_10325969 | 3300013307 | Unclassified | 1788 |
| 288 | Ga0157375_10014729 | 3300013308 | Bacteria | 6988 |
| 289 | Ga0163163_10180054 | 3300014325 | Bacteria | 2161 |
| 290 | Ga0163163_10182957 | 3300014325 | Bacteria | 2143 |
| 291 | Ga0163163_12698500 | 3300014325 | Unclassified | 554 |
| 292 | Ga0182008_10129152 | 3300014497 | Unclassified | 1259 |
| 293 | Ga0157377_10011990 | 3300014745 | Bacteria | 4346 |
| 294 | Ga0157377_10133644 | 3300014745 | Bacteria | 1518 |
| 295 | Ga0157379_10023094 | 3300014968 | Bacteria | 5514 |
| 296 | Ga0157379_10824413 | 3300014968 | Unclassified | 877 |
| 297 | Ga0157376_10043972 | 3300014969 | Unclassified | 3669 |
| 298 | Ga0157376_10059035 | 3300014969 | Bacteria | 3216 |
| 299 | Ga0157376_10378110 | 3300014969 | Bacteria | 1363 |
| 300 | Ga0157376_10600084 | 3300014969 | Unclassified | 1096 |
| 301 | Ga0157376_12216819 | 3300014969 | Unclassified | 588 |
| 302 | Ga0182006_1031927 | 3300015261 | Bacteria | 2120 |
| 303 | Ga0213873_10000798 | 3300021358 | Bacteria | 5096 |
| 304 | Ga0207666_1001462 | 3300025271 | Bacteria | 2788 |
| 305 | Ga0207673_1003406 | 3300025290 | Unclassified | 1860 |
| 306 | Ga0207673_1005791 | 3300025290 | Bacteria | 1516 |
| 307 | Ga0207697_10000521 | 3300025315 | Bacteria | 21689 |
| 308 | Ga0207697_10001466 | 3300025315 | Bacteria | 12889 |
| 309 | Ga0207697_10005749 | 3300025315 | Bacteria | 5716 |
| 310 | Ga0207697_10007383 | 3300025315 | Bacteria | 4907 |
| 311 | Ga0207697_10027423 | 3300025315 | Bacteria | 2328 |
| 312 | Ga0207697_10456215 | 3300025315 | Bacteria | 566 |
| 313 | Ga0207653_10007362 | 3300025885 | Bacteria | 3430 |
| 314 | Ga0207692_10053297 | 3300025898 | Bacteria | 2060 |
| 315 | Ga0207688_10090698 | 3300025901 | Bacteria | 1755 |
| 316 | Ga0207688_10122727 | 3300025901 | Unclassified | 1517 |
| 317 | Ga0207688_10482227 | 3300025901 | Bacteria | 775 |
| 318 | Ga0207680_10056409 | 3300025903 | Unclassified | 2372 |
| 319 | Ga0207647_10378837 | 3300025904 | Bacteria | 799 |
| 320 | Ga0207699_10577958 | 3300025906 | Unclassified | 817 |
| 321 | Ga0207645_10001439 | 3300025907 | Bacteria | 19481 |
| 322 | Ga0207645_10255602 | 3300025907 | Bacteria | 1160 |
| 323 | Ga0207645_10583743 | 3300025907 | Bacteria | 759 |
| 324 | Ga0207705_10326658 | 3300025909 | Unclassified | 1179 |
| 325 | Ga0207684_10026185 | 3300025910 | Unclassified | 4971 |
| 326 | Ga0207684_10039749 | 3300025910 | Bacteria | 3988 |
| 327 | Ga0207684_10142432 | 3300025910 | Bacteria | 2061 |
| 328 | Ga0207684_10220794 | 3300025910 | Bacteria | 1635 |
| 329 | Ga0207684_10435596 | 3300025910 | Bacteria | 1126 |
| 330 | Ga0207684_10450853 | 3300025910 | Bacteria | 1104 |
| 331 | Ga0207654_10056206 | 3300025911 | Unclassified | 2282 |
| 332 | Ga0207707_10076833 | 3300025912 | Unclassified | 2914 |
| 333 | Ga0207695_10783046 | 3300025913 | Bacteria | 834 |
| 334 | Ga0207671_10043627 | 3300025914 | Bacteria | 3316 |
| 335 | Ga0207671_10347401 | 3300025914 | Bacteria | 1176 |
| 336 | Ga0207693_10007547 | 3300025915 | Bacteria | 8936 |
| 337 | Ga0207693_10018504 | 3300025915 | Bacteria | 5547 |
| 338 | Ga0207693_10207397 | 3300025915 | Unclassified | 1541 |
| 339 | Ga0207693_10386652 | 3300025915 | Unclassified | 1094 |
| 340 | Ga0207693_10794407 | 3300025915 | Bacteria | 730 |
| 341 | Ga0207663_10318453 | 3300025916 | Unclassified | 1168 |
| 342 | Ga0207663_10652762 | 3300025916 | Bacteria | 830 |
| 343 | Ga0207662_10000373 | 3300025918 | Bacteria | 20188 |
| 344 | Ga0207662_10011981 | 3300025918 | Bacteria | 4823 |
| 345 | Ga0207657_10033426 | 3300025919 | Unclassified | 4636 |
| 346 | Ga0207657_10102571 | 3300025919 | Unclassified | 2373 |
| 347 | Ga0207657_10195363 | 3300025919 | Unclassified | 1630 |
| 348 | Ga0207649_10043251 | 3300025920 | Unclassified | 2753 |
| 349 | Ga0207649_10733067 | 3300025920 | Unclassified | 768 |
| 350 | Ga0207652_10062558 | 3300025921 | Bacteria | 3216 |
| 351 | Ga0207652_10679201 | 3300025921 | Bacteria | 920 |
| 352 | Ga0207646_10000925 | 3300025922 | Bacteria | 37781 |
| 353 | Ga0207646_10086437 | 3300025922 | Bacteria | 2806 |
| 354 | Ga0207646_10205579 | 3300025922 | Unclassified | 1778 |
| 355 | Ga0207646_10243298 | 3300025922 | Unclassified | 1625 |
| 356 | Ga0207646_10270946 | 3300025922 | Bacteria | 1534 |
| 357 | Ga0207646_10326653 | 3300025922 | Bacteria | 1386 |
| 358 | Ga0207681_10034723 | 3300025923 | Bacteria | 3317 |
| 359 | Ga0207650_10323938 | 3300025925 | Unclassified | 1263 |
| 360 | Ga0207650_10540595 | 3300025925 | Unclassified | 976 |
| 361 | Ga0207659_10036562 | 3300025926 | Bacteria | 3402 |
| 362 | Ga0207659_10148490 | 3300025926 | Bacteria | 1828 |
| 363 | Ga0207659_10230184 | 3300025926 | Unclassified | 1494 |
| 364 | Ga0207659_10493530 | 3300025926 | Unclassified | 1036 |
| 365 | Ga0207659_11598247 | 3300025926 | Unclassified | 556 |
| 366 | Ga0207687_10530765 | 3300025927 | Bacteria | 985 |
| 367 | Ga0207700_10148655 | 3300025928 | Bacteria | 1934 |
| 368 | Ga0207664_10144879 | 3300025929 | Bacteria | 2013 |
| 369 | Ga0207664_10377300 | 3300025929 | Bacteria | 1258 |
| 370 | Ga0207644_10104388 | 3300025931 | Unclassified | 2134 |
| 371 | Ga0207644_10299206 | 3300025931 | Unclassified | 1296 |
| 372 | Ga0207690_10005958 | 3300025932 | Bacteria | 7220 |
| 373 | Ga0207690_10098058 | 3300025932 | Unclassified | 2087 |
| 374 | Ga0207690_10149041 | 3300025932 | Bacteria | 1733 |
| 375 | Ga0207690_10526448 | 3300025932 | Bacteria | 959 |
| 376 | Ga0207706_10000900 | 3300025933 | Bacteria | 30537 |
| 377 | Ga0207706_10060993 | 3300025933 | Unclassified | 3321 |
| 378 | Ga0207706_10146797 | 3300025933 | Bacteria | 2075 |
| 379 | Ga0207706_11590482 | 3300025933 | Unclassified | 530 |
| 380 | Ga0207686_11269151 | 3300025934 | Unclassified | 604 |
| 381 | Ga0207709_10064785 | 3300025935 | Bacteria | 2296 |
| 382 | Ga0207670_10044671 | 3300025936 | Unclassified | 2932 |
| 383 | Ga0207670_11758286 | 3300025936 | Bacteria | 527 |
| 384 | Ga0207665_10116006 | 3300025939 | Unclassified | 1887 |
| 385 | Ga0207665_10263838 | 3300025939 | Bacteria | 1277 |
| 386 | Ga0207665_10282973 | 3300025939 | Unclassified | 1235 |
| 387 | Ga0207665_10824142 | 3300025939 | Unclassified | 734 |
| 388 | Ga0207691_10047516 | 3300025940 | Bacteria | 3938 |
| 389 | Ga0207711_10153279 | 3300025941 | Unclassified | 2081 |
| 390 | Ga0207661_10030284 | 3300025944 | Bacteria | 4167 |
| 391 | Ga0207661_10401061 | 3300025944 | Unclassified | 1244 |
| 392 | Ga0207661_10477197 | 3300025944 | Bacteria | 1138 |
| 393 | Ga0207679_10454231 | 3300025945 | Bacteria | 1137 |
| 394 | Ga0207667_11516292 | 3300025949 | Bacteria | 641 |
| 395 | Ga0207651_10019170 | 3300025960 | Unclassified | 4092 |
| 396 | Ga0207651_11285024 | 3300025960 | Unclassified | 658 |
| 397 | Ga0207712_11262697 | 3300025961 | Bacteria | 660 |
| 398 | Ga0207712_11804182 | 3300025961 | Unclassified | 548 |
| 399 | Ga0207668_10002460 | 3300025972 | Bacteria | 10815 |
| 400 | Ga0207668_10648399 | 3300025972 | Unclassified | 924 |
| 401 | Ga0207640_11055558 | 3300025981 | Unclassified | 717 |
| 402 | Ga0207658_10002958 | 3300025986 | Bacteria | 12162 |
| 403 | Ga0207658_10643569 | 3300025986 | Unclassified | 955 |
| 404 | Ga0207658_11695792 | 3300025986 | Bacteria | 577 |
| 405 | Ga0207677_10039334 | 3300026023 | Unclassified | 3109 |
| 406 | Ga0207677_10294539 | 3300026023 | Bacteria | 1338 |
| 407 | Ga0207639_10454204 | 3300026041 | Bacteria | 1164 |
| 408 | Ga0207678_10005584 | 3300026067 | Bacteria | 11246 |
| 409 | Ga0207708_10009263 | 3300026075 | Bacteria | 7288 |
| 410 | Ga0207708_10730295 | 3300026075 | Bacteria | 849 |
| 411 | Ga0207702_10472522 | 3300026078 | Unclassified | 1219 |
| 412 | Ga0207702_10475053 | 3300026078 | Bacteria | 1216 |
| 413 | Ga0207641_10021653 | 3300026088 | Bacteria | 5281 |
| 414 | Ga0207648_10537084 | 3300026089 | Bacteria | 1073 |
| 415 | Ga0207676_10021986 | 3300026095 | Bacteria | 4686 |
| 416 | Ga0207675_100168215 | 3300026118 | Bacteria | 2094 |
| 417 | Ga0207675_100343661 | 3300026118 | Unclassified | 1461 |
| 418 | Ga0207683_10022740 | 3300026121 | Bacteria | 5385 |
| 419 | Ga0207683_10098757 | 3300026121 | Unclassified | 2605 |
| 420 | Ga0207698_10281061 | 3300026142 | Bacteria | 1539 |
| 421 | Ga0268266_10142896 | 3300028379 | Bacteria | 2149 |
| 422 | Ga0268266_10404394 | 3300028379 | Bacteria | 1291 |
| 423 | Ga0268265_10158024 | 3300028380 | Bacteria | 1921 |
| 424 | Ga0268265_11560265 | 3300028380 | Unclassified | 665 |
| 425 | Ga0268264_10067484 | 3300028381 | Bacteria | 3019 |
| 426 | Ga0268264_10134501 | 3300028381 | Bacteria | 2196 |
| 427 | Ga0265334_10025432 | 3300028573 | Unclassified | 2396 |
| 428 | Ga0265338_10000238 | 3300028800 | Bacteria | 101800 |
| 429 | Ga0265332_10029939 | 3300031238 | Unclassified | 2378 |
| 430 | Ga0265325_10000113 | 3300031241 | Bacteria | 55789 |
| 431 | Ga0265329_10323150 | 3300031242 | Bacteria | 524 |
| 432 | Ga0265327_10067046 | 3300031251 | Unclassified | 1809 |
| 433 | Ga0265313_10000826 | 3300031595 | Bacteria | 31286 |
| 434 | Ga0265342_10004123 | 3300031712 | Bacteria | 11569 |
| 435 | Ga0307409_100260272 | 3300031995 | Bacteria | 1592 |
| 436 | Ga0373923_0321724 | 3300035111 | Unclassified | 735 |
| 437 | Ga0373945_0099404 | 3300035116 | Unclassified | 1137 |
| 438 | Ga0373953_0111277 | 3300035117 | Bacteria | 1158 |
| 439 | Ga0373953_0401737 | 3300035117 | Unclassified | 603 |
| 440 | Ga0373954_0473503 | 3300035118 | Unclassified | 620 |
| 441 | Ga0373957_0094422 | 3300035120 | Bacteria | 1192 |
| 442 | Ga0373955_0146222 | 3300035172 | Bacteria | 1389 |
| 443 | Ga0373955_0533820 | 3300035172 | Unclassified | 717 |
| 444 | Ga0373955_0958789 | 3300035172 | Unclassified | 527 |
| 445 | Ga0373942_0134456 | 3300035207 | Bacteria | 783 |
| 446 | Ga0373935_0040877 | 3300035692 | Unclassified | 2911 |
| 447 | Ga0373927_0241702 | 3300035695 | Unclassified | 1187 |
| 448 | Ga0373933_0219394 | 3300035724 | Unclassified | 1220 |
| 449 | Ga0373933_0799698 | 3300035724 | Unclassified | 621 |
| 450 | Ga0373947_0253365 | 3300035725 | Unclassified | 1165 |
| 451 | Ga0373937_0091661 | 3300036401 | Unclassified | 2816 |
| 452 | Ga0373937_0204986 | 3300036401 | Unclassified | 1854 |
| 453 | Ga0373937_0389317 | 3300036401 | Unclassified | 1322 |
| 454 | Ga0373937_0807382 | 3300036401 | Bacteria | 886 |
| 455 | Ga0373925_0160246 | 3300037068 | Unclassified | 1772 |
| 456 | Ga0395899_0048702 | 3300037312 | Bacteria | 3152 |
| 457 | Ga0395900_0055082 | 3300037418 | Unclassified | 4094 |
| 458 | Ga0395900_0191555 | 3300037418 | Unclassified | 2074 |
| 459 | Ga0395900_0476604 | 3300037418 | Bacteria | 1201 |
| 460 | Ga0395898_0036474 | 3300037466 | Bacteria | 4882 |
| 461 | Ga0395898_1481634 | 3300037466 | Unclassified | 605 |
| 462 | Ga0395905_0006840 | 3300037471 | Bacteria | 11403 |
| 463 | Ga0395901_0073647 | 3300038443 | Unclassified | 3562 |
| 464 | Ga0395901_0799294 | 3300038443 | Unclassified | 932 |
| 465 | Ga0451853_1916849 | 3300041512 | Unclassified | 836 |
| 466 | Ga0439464_0151704 | 3300042439 | Unclassified | 725 |
| 467 | Ga0439460_0163277 | 3300042461 | Unclassified | 748 |
| 468 | Ga0453683_0414461 | 3300044673 | Bacteria | 869 |
| 469 | Ga0466964_0012552 | 3300044706 | Unclassified | 3207 |
| 470 | Ga0451576_0160448 | 3300045051 | Bacteria | 2346 |
| 471 | Ga0466967_0151511 | 3300045976 | Unclassified | 2168 |
| 472 | Ga0495592_0049484 | 3300046454 | Unclassified | 3124 |
| 473 | Ga0495592_0176660 | 3300046454 | Bacteria | 1458 |
| 474 | Ga0495603_0150204 | 3300046455 | Bacteria | 1354 |
| 475 | Ga0495651_0371538 | 3300046462 | Bacteria | 940 |
| 476 | Ga0495651_0707298 | 3300046462 | Unclassified | 628 |
| 477 | Ga0495653_0647967 | 3300046463 | Unclassified | 645 |
| 478 | Ga0495664_0142938 | 3300046477 | Bacteria | 1451 |
| 479 | Ga0495618_0093453 | 3300046514 | Bacteria | 1923 |
| 480 | Ga0495628_0034749 | 3300046516 | Unclassified | 4053 |
| 481 | Ga0495628_0778503 | 3300046516 | Unclassified | 671 |
| 482 | Ga0495630_0324051 | 3300046517 | Unclassified | 1178 |
| 483 | Ga0495630_1017102 | 3300046517 | Unclassified | 630 |
| 484 | Ga0495652_0127942 | 3300046529 | Bacteria | 2015 |
| 485 | Ga0495665_0352357 | 3300046531 | Unclassified | 750 |
| 486 | Ga0495640_0513737 | 3300046533 | Unclassified | 728 |
| 487 | Ga0495640_0703905 | 3300046533 | Unclassified | 606 |
| 488 | Ga0495587_0376035 | 3300046536 | Unclassified | 790 |
| 489 | Ga0495645_0017166 | 3300046543 | Bacteria | 5184 |
| 490 | Ga0495667_0978328 | 3300046559 | Unclassified | 517 |
| 491 | Ga0495635_0715185 | 3300046663 | Bacteria | 649 |
| 492 | Ga0495599_0007411 | 3300046678 | Bacteria | 6651 |
| 493 | Ga0495623_0076795 | 3300046679 | Unclassified | 2072 |
| 494 | Ga0495646_0013455 | 3300046680 | Bacteria | 5201 |
| 495 | Ga0495613_0722019 | 3300046689 | Unclassified | 655 |
| 496 | Ga0495600_0311822 | 3300046809 | Bacteria | 991 |
| 497 | Ga0495581_0052882 | 3300047315 | Unclassified | 2346 |
| 498 | Ga0495581_0604509 | 3300047315 | Unclassified | 635 |
| 499 | Ga0495604_0113407 | 3300047317 | Unclassified | 1973 |
| 500 | Ga0495674_0075914 | 3300047319 | Unclassified | 2891 |
| 501 | Ga0495675_0528603 | 3300047444 | Bacteria | 675 |
| 502 | Ga0496100_0189312 | 3300048903 | Unclassified | 1493 |
| 503 | Ga0496100_0405645 | 3300048903 | Unclassified | 1039 |
| 504 | Ga0496101_0009105 | 3300048904 | Bacteria | 6514 |
| 505 | Ga0496101_0233828 | 3300048904 | Unclassified | 1429 |
| 506 | Ga0496102_0398451 | 3300048905 | Unclassified | 1294 |
| 507 | Ga0496102_1350233 | 3300048905 | Unclassified | 632 |
| 508 | Ga0496103_0886062 | 3300048906 | Unclassified | 560 |
| 509 | Ga0496104_0033307 | 3300048907 | Bacteria | 4799 |
| 510 | Ga0496104_0283736 | 3300048907 | Unclassified | 1569 |
| 511 | Ga0496105_0323481 | 3300048908 | Unclassified | 1235 |
| 512 | Ga0496105_0509379 | 3300048908 | Bacteria | 944 |
| 513 | Ga0496106_0310687 | 3300048909 | Unclassified | 1265 |
| 514 | Ga0496106_1208735 | 3300048909 | Unclassified | 589 |
| 515 | Ga0496107_0044016 | 3300048910 | Bacteria | 3209 |
| 516 | Ga0496107_0046760 | 3300048910 | Bacteria | 3115 |
| 517 | Ga0496108_0054959 | 3300048911 | Bacteria | 3342 |
| 518 | Ga0496108_0274061 | 3300048911 | Bacteria | 1469 |
| 519 | Ga0496109_0015819 | 3300048912 | Bacteria | 6587 |
| 520 | Ga0496109_0108782 | 3300048912 | Unclassified | 2577 |
| 521 | Ga0496109_0489553 | 3300048912 | Unclassified | 1161 |
| 522 | Ga0496109_1239861 | 3300048912 | Unclassified | 682 |
| 523 | Ga0496109_1731983 | 3300048912 | Unclassified | 558 |
| 524 | Ga0496110_0532680 | 3300048913 | Unclassified | 1068 |
| 525 | Ga0496112_0058368 | 3300048915 | Bacteria | 3800 |
| 526 | Ga0496113_0201046 | 3300048916 | Bacteria | 1584 |
| 527 | Ga0496113_0479857 | 3300048916 | Bacteria | 999 |
| 528 | Ga0496113_0643298 | 3300048916 | Bacteria | 848 |
| 529 | Ga0496114_0073147 | 3300048917 | Bacteria | 2884 |
| 530 | Ga0496114_0096962 | 3300048917 | Unclassified | 2511 |
| 531 | Ga0496115_0001050 | 3300048918 | Bacteria | 20035 |
| 532 | Ga0496115_0143632 | 3300048918 | Unclassified | 1969 |
| 533 | Ga0496115_0192962 | 3300048918 | Bacteria | 1683 |
| 534 | Ga0496115_0231278 | 3300048918 | Bacteria | 1524 |
| 535 | nmdc:mga05p37_289690_c1 | 3300050507 | Unclassified | 1949 |
| 536 | nmdc:mga05p37_363021_c1 | 3300050507 | Unclassified | 1702 |
| 537 | nmdc:mga05p37_9698_c1 | 3300050507 | Bacteria | 11414 |
| 538 | nmdc:mga0qj67_621265_c1 | 3300050509 | Bacteria | 863 |
| 539 | nmdc:mga08y16_189849_c1 | 3300050511 | Bacteria | 2131 |
| 540 | nmdc:mga0n895_111049_c1 | 3300050512 | Bacteria | 2757 |
| 541 | nmdc:mga0n895_124024_c1 | 3300050512 | Unclassified | 2606 |
| 542 | nmdc:mga0n895_2006655_c1 | 3300050512 | Unclassified | 536 |
| 543 | nmdc:mga0rr50_258_c1 | 3300050513 | Bacteria | 28700 |
| 544 | nmdc:mga0rr50_470120_c1 | 3300050513 | Unclassified | 1067 |
| 545 | nmdc:mga0rr50_597700_c1 | 3300050513 | Unclassified | 940 |
| 546 | nmdc:mga0rr50_848325_c1 | 3300050513 | Bacteria | 779 |
| 547 | nmdc:mga08x19_2516_c1 | 3300050514 | Bacteria | 11135 |
| 548 | nmdc:mga08x19_377705_c1 | 3300050514 | Bacteria | 992 |
| 549 | nmdc:mga08x19_543312_c1 | 3300050514 | Unclassified | 822 |
| 550 | nmdc:mga08x19_644403_c1 | 3300050514 | Unclassified | 751 |
| 551 | nmdc:mga08x19_8060_c1 | 3300050514 | Bacteria | 6257 |
| 552 | nmdc:mga0a205_28_c1 | 3300050515 | Bacteria | 82237 |
| 553 | nmdc:mga0a205_444273_c1 | 3300050515 | Unclassified | 1157 |
| 554 | Ga0495601_0021321 | 3300053077 | Bacteria | 3967 |
| 555 | Ga0495601_0438135 | 3300053077 | Bacteria | 846 |
| 556 | Ga0495612_0191039 | 3300053078 | Unclassified | 901 |
| 557 | Ga0495619_0442601 | 3300053085 | Bacteria | 896 |
| 558 | Ga0495619_0452753 | 3300053085 | Unclassified | 885 |
| 559 | Ga0436362_0858937 | |||
| 560 | SwRhRL2b_contig_455266 | |||
| 561 | JGI24750J21931_1081098 | |||
| 562 | JGI24035J26624_1000950 | |||
| 563 | JGI24035J26624_1002123 | |||
| 564 | JGI25406J46586_10000067 | |||
| 565 | JGI25405J52794_10047487 | |||
| 566 | Ga0065714_10306699 | |||
| 567 | Ga0065714_10445391 | |||
| 568 | Ga0065704_10087106 | |||
| 569 | Ga0065704_10536454 | |||
| 570 | Ga0065704_10568642 | |||
| 571 | Ga0065704_10730457 | |||
| 572 | Ga0065712_10033944 | |||
| 573 | Ga0065712_10131832 | |||
| 574 | Ga0065712_10204465 | |||
| 575 | Ga0065712_10267956 | |||
| 576 | Ga0065715_10002584 | |||
| 577 | Ga0065715_10026469 | |||
| 578 | Ga0065715_10311466 | |||
| 579 | Ga0065715_10447634 | |||
| 580 | Ga0065715_10739763 | |||
| 581 | Ga0065715_10900609 | |||
| 582 | Ga0065707_10095695 | |||
| 583 | Ga0070658_10782516 | |||
| 584 | Ga0070676_10024671 | |||
| 585 | Ga0070676_10170926 | |||
| 586 | Ga0070683_100017017 | |||
| 587 | Ga0070683_100415267 | |||
| 588 | Ga0070683_100592529 | |||
| 589 | Ga0070690_100044368 | |||
| 590 | Ga0070690_100065238 | |||
| 591 | Ga0070690_100093894 | |||
| 592 | Ga0070666_10092640 | |||
| 593 | Ga0070680_100036707 | |||
| 594 | Ga0070680_100395246 | |||
| 595 | Ga0068868_100006655 | |||
| 596 | Ga0068868_100077055 | |||
| 597 | Ga0068868_100128766 | |||
| 598 | Ga0070660_100198782 | |||
| 599 | Ga0070689_100016735 | |||
| 600 | Ga0070689_100031310 | |||
| 601 | Ga0070689_100064185 | |||
| 602 | Ga0070687_100028866 | |||
| 603 | Ga0070687_100050317 | |||
| 604 | Ga0070661_100029219 | |||
| 605 | Ga0070668_100065768 | |||
| 606 | Ga0070668_100140709 | |||
| 607 | Ga0070668_101483150 | |||
| 608 | Ga0070669_100004177 | |||
| 609 | Ga0070675_100022574 | |||
| 610 | Ga0070675_100080971 | |||
| 611 | Ga0070675_100103216 | |||
| 612 | Ga0070675_100117795 | |||
| 613 | Ga0070675_100500748 | |||
| 614 | Ga0070675_100537364 | |||
| 615 | Ga0070675_100589085 | |||
| 616 | Ga0070671_100011335 | |||
| 617 | Ga0070671_100059775 | |||
| 618 | Ga0070671_100195959 | |||
| 619 | Ga0070674_101781517 | |||
| 620 | Ga0070673_100067963 | |||
| 621 | Ga0070673_100268343 | |||
| 622 | Ga0070673_101522931 | |||
| 623 | Ga0070688_100038306 | |||
| 624 | Ga0070688_100049783 | |||
| 625 | Ga0070688_100219711 | |||
| 626 | Ga0070659_100007119 | |||
| 627 | Ga0070659_100021775 | |||
| 628 | Ga0070659_100268849 | |||
| 629 | Ga0070659_100358849 | |||
| 630 | Ga0070659_100684621 | |||
| 631 | Ga0070659_101019066 | |||
| 632 | Ga0070667_100004390 | |||
| 633 | Ga0070667_100267247 | |||
| 634 | Ga0070667_100570742 | |||
| 635 | Ga0070667_100767217 | |||
| 636 | Ga0070709_10264958 | |||
| 637 | Ga0070714_100153087 | |||
| 638 | Ga0070714_100184306 | |||
| 639 | Ga0070714_100544475 | |||
| 640 | Ga0070714_101944773 | |||
| 641 | Ga0070713_100039977 | |||
| 642 | Ga0070713_100159659 | |||
| 643 | Ga0070710_10059206 | |||
| 644 | Ga0070701_10729678 | |||
| 645 | Ga0070711_100324058 | |||
| 646 | Ga0070705_100278192 | |||
| 647 | Ga0070705_100495222 | |||
| 648 | Ga0070700_100017924 | |||
| 649 | Ga0070708_100027791 | |||
| 650 | Ga0070708_100039802 | |||
| 651 | Ga0070708_100110864 | |||
| 652 | Ga0070708_100227142 | |||
| 653 | Ga0070708_100349873 | |||
| 654 | Ga0070708_100413847 | |||
| 655 | Ga0070708_100502561 | |||
| 656 | Ga0070708_101284629 | |||
| 657 | Ga0070708_101745578 | |||
| 658 | Ga0070678_100170576 | |||
| 659 | Ga0070678_100425393 | |||
| 660 | Ga0070662_100001546 | |||
| 661 | Ga0070662_100052211 | |||
| 662 | Ga0070662_100955737 | |||
| 663 | Ga0070681_10011031 | |||
| 664 | Ga0070681_10574130 | |||
| 665 | Ga0070681_10896606 | |||
| 666 | Ga0068867_100676580 | |||
| 667 | Ga0070685_10053155 | |||
| 668 | Ga0070706_100000035 | |||
| 669 | Ga0070706_100007350 | |||
| 670 | Ga0070706_100156020 | |||
| 671 | Ga0070706_100331121 | |||
| 672 | Ga0070706_100624340 | |||
| 673 | Ga0070706_100644314 | |||
| 674 | Ga0070706_100960697 | |||
| 675 | Ga0070706_101059555 | |||
| 676 | Ga0070706_101165037 | |||
| 677 | Ga0070707_100002759 | |||
| 678 | Ga0070707_100019676 | |||
| 679 | Ga0070707_100021772 | |||
| 680 | Ga0070707_100296901 | |||
| 681 | Ga0070707_100354975 | |||
| 682 | Ga0070707_100394739 | |||
| 683 | Ga0070707_100506721 | |||
| 684 | Ga0070707_101029710 | |||
| 685 | Ga0070698_100001022 | |||
| 686 | Ga0070698_100026006 | |||
| 687 | Ga0070698_100103586 | |||
| 688 | Ga0070698_100164416 | |||
| 689 | Ga0070698_100380559 | |||
| 690 | Ga0070698_100791225 | |||
| 691 | Ga0070699_100147831 | |||
| 692 | Ga0070699_100174426 | |||
| 693 | Ga0070699_100326928 | |||
| 694 | Ga0070699_100550622 | |||
| 695 | Ga0070699_100907310 | |||
| 696 | Ga0070699_101841444 | |||
| 697 | Ga0070699_102139626 | |||
| 698 | Ga0070679_100009498 | |||
| 699 | Ga0070684_100002121 | |||
| 700 | Ga0070684_100442029 | |||
| 701 | Ga0070684_100470402 | |||
| 702 | Ga0070697_100006797 | |||
| 703 | Ga0070697_100046174 | |||
| 704 | Ga0070697_100102497 | |||
| 705 | Ga0070697_100249175 | |||
| 706 | Ga0070697_100251470 | |||
| 707 | Ga0070697_100354199 | |||
| 708 | Ga0070697_100389692 | |||
| 709 | Ga0068853_100595947 | |||
| 710 | Ga0070672_100102883 | |||
| 711 | Ga0070672_100217726 | |||
| 712 | Ga0070686_100304619 | |||
| 713 | Ga0070695_100239720 | |||
| 714 | Ga0070695_101422670 | |||
| 715 | Ga0070693_100329417 | |||
| 716 | Ga0070665_100013634 | |||
| 717 | Ga0070665_100052248 | |||
| 718 | Ga0070665_100362550 | |||
| 719 | Ga0070665_100459082 | |||
| 720 | Ga0070704_100018482 | |||
| 721 | Ga0068855_101466973 | |||
| 722 | Ga0070664_100034554 | |||
| 723 | Ga0070664_101855786 | |||
| 724 | Ga0068854_100745720 | |||
| 725 | Ga0068856_100082372 | |||
| 726 | Ga0070702_100081033 | |||
| 727 | Ga0070702_100102189 | |||
| 728 | Ga0070702_100694259 | |||
| 729 | Ga0070702_101486215 | |||
| 730 | Ga0068852_100517618 | |||
| 731 | Ga0068861_100057171 | |||
| 732 | Ga0068861_100127311 | |||
| 733 | Ga0068863_100498627 | |||
| 734 | Ga0068863_101132545 | |||
| 735 | Ga0068858_100341611 | |||
| 736 | Ga0068858_102334958 | |||
| 737 | Ga0068860_100002246 | |||
| 738 | Ga0068860_100059423 | |||
| 739 | Ga0068862_100010280 | |||
| 740 | Ga0068862_101028500 | |||
| 741 | Ga0081455_10000281 | |||
| 742 | Ga0081455_10003189 | |||
| 743 | Ga0081455_10003558 | |||
| 744 | Ga0081455_10008185 | |||
| 745 | Ga0081540_1015564 | |||
| 746 | Ga0081540_1121914 | |||
| 747 | Ga0081540_1202675 | |||
| 748 | Ga0081539_10000287 | |||
| 749 | Ga0081539_10024836 | |||
| 750 | Ga0081539_10130481 | |||
| 751 | Ga0081539_10137078 | |||
| 752 | Ga0070717_10121884 | |||
| 753 | Ga0070717_10155224 | |||
| 754 | Ga0070717_10223823 | |||
| 755 | Ga0070717_12095427 | |||
| 756 | Ga0070715_10016363 | |||
| 757 | Ga0070716_100020092 | |||
| 758 | Ga0070716_100515612 | |||
| 759 | Ga0070716_100826948 | |||
| 760 | Ga0070716_100943727 | |||
| 761 | Ga0070712_100028740 | |||
| 762 | Ga0070712_100198771 | |||
| 763 | Ga0070712_100208746 | |||
| 764 | Ga0070712_100619139 | |||
| 765 | Ga0070712_101230455 | |||
| 766 | Ga0097621_100059525 | |||
| 767 | Ga0097621_100786590 | |||
| 768 | Ga0097621_101048066 | |||
| 769 | Ga0097621_102410625 | |||
| 770 | Ga0068871_100100311 | |||
| 771 | Ga0068871_100998506 | |||
| 772 | Ga0075431_101100235 | |||
| 773 | Ga0075433_10000013 | |||
| 774 | Ga0075433_10406751 | |||
| 775 | Ga0075434_100000707 | |||
| 776 | Ga0075434_102570089 | |||
| 777 | Ga0075436_100240123 | |||
| 778 | Ga0075436_100521281 | |||
| 779 | Ga0075435_100000262 | |||
| 780 | Ga0075435_100196290 | |||
| 781 | Ga0075435_100765579 | |||
| 782 | Ga0075435_100789960 | |||
| 783 | Ga0075435_101844832 | |||
| 784 | Ga0099795_10216084 | |||
| 785 | Ga0105240_10674566 | |||
| 786 | Ga0105240_11812996 | |||
| 787 | Ga0111539_10546083 | |||
| 788 | Ga0105245_10017104 | |||
| 789 | Ga0105245_10246659 | |||
| 790 | Ga0105245_10998095 | |||
| 791 | Ga0105245_11527435 | |||
| 792 | Ga0105247_10229849 | |||
| 793 | Ga0114129_10014026 | |||
| 794 | Ga0114129_10178050 | |||
| 795 | Ga0114129_10216235 | |||
| 796 | Ga0114129_10312940 | |||
| 797 | Ga0105243_10012007 | |||
| 798 | Ga0105243_10118703 | |||
| 799 | Ga0105241_10232662 | |||
| 800 | Ga0105242_10384116 | |||
| 801 | Ga0105242_11152160 | |||
| 802 | Ga0105237_10064070 | |||
| 803 | Ga0105237_10304409 | |||
| 804 | Ga0105237_10358385 | |||
| 805 | Ga0105238_11924046 | |||
| 806 | Ga0105249_10000764 | |||
| 807 | Ga0105249_10006018 | |||
| 808 | Ga0105249_13482021 | |||
| 809 | Ga0099796_10196328 | |||
| 810 | Ga0099796_10522643 | |||
| 811 | Ga0105239_10006314 | |||
| 812 | Ga0105239_10088096 | |||
| 813 | Ga0105239_10117843 | |||
| 814 | Ga0105239_10394534 | |||
| 815 | Ga0105239_11465759 | |||
| 816 | Ga0105246_10063113 | |||
| 817 | Ga0105246_10484178 | |||
| 818 | Ga0157371_10497703 | |||
| 819 | Ga0157370_10303491 | |||
| 820 | Ga0157374_10004212 | |||
| 821 | Ga0157374_10021742 | |||
| 822 | Ga0157374_10053022 | |||
| 823 | Ga0157374_10109229 | |||
| 824 | Ga0157374_10242718 | |||
| 825 | Ga0157374_10358468 | |||
| 826 | Ga0157374_10797652 | |||
| 827 | Ga0157374_10958830 | |||
| 828 | Ga0157374_11003739 | |||
| 829 | Ga0157374_11375966 | |||
| 830 | Ga0157378_10001788 | |||
| 831 | Ga0157378_10355630 | |||
| 832 | Ga0157378_10358474 | |||
| 833 | Ga0157378_10501780 | |||
| 834 | Ga0157378_10625943 | |||
| 835 | Ga0157378_10777100 | |||
| 836 | Ga0157378_10801201 | |||
| 837 | Ga0163162_10011970 | |||
| 838 | Ga0163162_10475906 | |||
| 839 | Ga0163162_10536902 | |||
| 840 | Ga0163162_10855968 | |||
| 841 | Ga0163162_11115953 | |||
| 842 | Ga0163162_12181820 | |||
| 843 | Ga0157372_10009787 | |||
| 844 | Ga0157372_10022040 | |||
| 845 | Ga0157372_10325969 | |||
| 846 | Ga0157375_10014729 | |||
| 847 | Ga0163163_10180054 | |||
| 848 | Ga0163163_10182957 | |||
| 849 | Ga0163163_12698500 | |||
| 850 | Ga0182008_10129152 | |||
| 851 | Ga0157377_10011990 | |||
| 852 | Ga0157377_10133644 | |||
| 853 | Ga0157379_10023094 | |||
| 854 | Ga0157379_10824413 | |||
| 855 | Ga0157376_10043972 | |||
| 856 | Ga0157376_10059035 | |||
| 857 | Ga0157376_10378110 | |||
| 858 | Ga0157376_10600084 | |||
| 859 | Ga0157376_12216819 | |||
| 860 | Ga0182006_1031927 | |||
| 861 | Ga0213873_10000798 | |||
| 862 | Ga0207666_1001462 | |||
| 863 | Ga0207673_1003406 | |||
| 864 | Ga0207673_1005791 | |||
| 865 | Ga0207697_10000521 | |||
| 866 | Ga0207697_10001466 | |||
| 867 | Ga0207697_10005749 | |||
| 868 | Ga0207697_10007383 | |||
| 869 | Ga0207697_10027423 | |||
| 870 | Ga0207697_10456215 | |||
| 871 | Ga0207653_10007362 | |||
| 872 | Ga0207692_10053297 | |||
| 873 | Ga0207688_10090698 | |||
| 874 | Ga0207688_10122727 | |||
| 875 | Ga0207688_10482227 | |||
| 876 | Ga0207680_10056409 | |||
| 877 | Ga0207647_10378837 | |||
| 878 | Ga0207699_10577958 | |||
| 879 | Ga0207645_10001439 | |||
| 880 | Ga0207645_10255602 | |||
| 881 | Ga0207645_10583743 | |||
| 882 | Ga0207705_10326658 | |||
| 883 | Ga0207684_10026185 | |||
| 884 | Ga0207684_10039749 | |||
| 885 | Ga0207684_10142432 | |||
| 886 | Ga0207684_10220794 | |||
| 887 | Ga0207684_10435596 | |||
| 888 | Ga0207684_10450853 | |||
| 889 | Ga0207654_10056206 | |||
| 890 | Ga0207707_10076833 | |||
| 891 | Ga0207695_10783046 | |||
| 892 | Ga0207671_10043627 | |||
| 893 | Ga0207671_10347401 | |||
| 894 | Ga0207693_10007547 | |||
| 895 | Ga0207693_10018504 | |||
| 896 | Ga0207693_10207397 | |||
| 897 | Ga0207693_10386652 | |||
| 898 | Ga0207693_10794407 | |||
| 899 | Ga0207663_10318453 | |||
| 900 | Ga0207663_10652762 | |||
| 901 | Ga0207662_10000373 | |||
| 902 | Ga0207662_10011981 | |||
| 903 | Ga0207657_10033426 | |||
| 904 | Ga0207657_10102571 | |||
| 905 | Ga0207657_10195363 | |||
| 906 | Ga0207649_10043251 | |||
| 907 | Ga0207649_10733067 | |||
| 908 | Ga0207652_10062558 | |||
| 909 | Ga0207652_10679201 | |||
| 910 | Ga0207646_10000925 | |||
| 911 | Ga0207646_10086437 | |||
| 912 | Ga0207646_10205579 | |||
| 913 | Ga0207646_10243298 | |||
| 914 | Ga0207646_10270946 | |||
| 915 | Ga0207646_10326653 | |||
| 916 | Ga0207681_10034723 | |||
| 917 | Ga0207650_10323938 | |||
| 918 | Ga0207650_10540595 | |||
| 919 | Ga0207659_10036562 | |||
| 920 | Ga0207659_10148490 | |||
| 921 | Ga0207659_10230184 | |||
| 922 | Ga0207659_10493530 | |||
| 923 | Ga0207659_11598247 | |||
| 924 | Ga0207687_10530765 | |||
| 925 | Ga0207700_10148655 | |||
| 926 | Ga0207664_10144879 | |||
| 927 | Ga0207664_10377300 | |||
| 928 | Ga0207644_10104388 | |||
| 929 | Ga0207644_10299206 | |||
| 930 | Ga0207690_10005958 | |||
| 931 | Ga0207690_10098058 | |||
| 932 | Ga0207690_10149041 | |||
| 933 | Ga0207690_10526448 | |||
| 934 | Ga0207706_10000900 | |||
| 935 | Ga0207706_10060993 | |||
| 936 | Ga0207706_10146797 | |||
| 937 | Ga0207706_11590482 | |||
| 938 | Ga0207686_11269151 | |||
| 939 | Ga0207709_10064785 | |||
| 940 | Ga0207670_10044671 | |||
| 941 | Ga0207670_11758286 | |||
| 942 | Ga0207665_10116006 | |||
| 943 | Ga0207665_10263838 | |||
| 944 | Ga0207665_10282973 | |||
| 945 | Ga0207665_10824142 | |||
| 946 | Ga0207691_10047516 | |||
| 947 | Ga0207711_10153279 | |||
| 948 | Ga0207661_10030284 | |||
| 949 | Ga0207661_10401061 | |||
| 950 | Ga0207661_10477197 | |||
| 951 | Ga0207679_10454231 | |||
| 952 | Ga0207667_11516292 | |||
| 953 | Ga0207651_10019170 | |||
| 954 | Ga0207651_11285024 | |||
| 955 | Ga0207712_11262697 | |||
| 956 | Ga0207712_11804182 | |||
| 957 | Ga0207668_10002460 | |||
| 958 | Ga0207668_10648399 | |||
| 959 | Ga0207640_11055558 | |||
| 960 | Ga0207658_10002958 | |||
| 961 | Ga0207658_10643569 | |||
| 962 | Ga0207658_11695792 | |||
| 963 | Ga0207677_10039334 | |||
| 964 | Ga0207677_10294539 | |||
| 965 | Ga0207639_10454204 | |||
| 966 | Ga0207678_10005584 | |||
| 967 | Ga0207708_10009263 | |||
| 968 | Ga0207708_10730295 | |||
| 969 | Ga0207702_10472522 | |||
| 970 | Ga0207702_10475053 | |||
| 971 | Ga0207641_10021653 | |||
| 972 | Ga0207648_10537084 | |||
| 973 | Ga0207676_10021986 | |||
| 974 | Ga0207675_100168215 | |||
| 975 | Ga0207675_100343661 | |||
| 976 | Ga0207683_10022740 | |||
| 977 | Ga0207683_10098757 | |||
| 978 | Ga0207698_10281061 | |||
| 979 | Ga0268266_10142896 | |||
| 980 | Ga0268266_10404394 | |||
| 981 | Ga0268265_10158024 | |||
| 982 | Ga0268265_11560265 | |||
| 983 | Ga0268264_10067484 | |||
| 984 | Ga0268264_10134501 | |||
| 985 | Ga0265334_10025432 | |||
| 986 | Ga0265338_10000238 | |||
| 987 | Ga0265332_10029939 | |||
| 988 | Ga0265325_10000113 | |||
| 989 | Ga0265329_10323150 | |||
| 990 | Ga0265327_10067046 | |||
| 991 | Ga0265313_10000826 | |||
| 992 | Ga0265342_10004123 | |||
| 993 | Ga0307409_100260272 | |||
| 994 | Ga0373923_0321724 | |||
| 995 | Ga0373945_0099404 | |||
| 996 | Ga0373953_0111277 | |||
| 997 | Ga0373953_0401737 | |||
| 998 | Ga0373954_0473503 | |||
| 999 | Ga0373957_0094422 | |||
| 1000 | Ga0373955_0146222 | |||
| 1001 | Ga0373955_0533820 | |||
| 1002 | Ga0373955_0958789 | |||
| 1003 | Ga0373942_0134456 | |||
| 1004 | Ga0373935_0040877 | |||
| 1005 | Ga0373927_0241702 | |||
| 1006 | Ga0373933_0219394 | |||
| 1007 | Ga0373933_0799698 | |||
| 1008 | Ga0373947_0253365 | |||
| 1009 | Ga0373937_0091661 | |||
| 1010 | Ga0373937_0204986 | |||
| 1011 | Ga0373937_0389317 | |||
| 1012 | Ga0373937_0807382 | |||
| 1013 | Ga0373925_0160246 | |||
| 1014 | Ga0395899_0048702 | |||
| 1015 | Ga0395900_0055082 | |||
| 1016 | Ga0395900_0191555 | |||
| 1017 | Ga0395900_0476604 | |||
| 1018 | Ga0395898_0036474 | |||
| 1019 | Ga0395898_1481634 | |||
| 1020 | Ga0395905_0006840 | |||
| 1021 | Ga0395901_0073647 | |||
| 1022 | Ga0395901_0799294 | |||
| 1023 | Ga0451853_1916849 | |||
| 1024 | Ga0439464_0151704 | |||
| 1025 | Ga0439460_0163277 | |||
| 1026 | Ga0453683_0414461 | |||
| 1027 | Ga0466964_0012552 | |||
| 1028 | Ga0451576_0160448 | |||
| 1029 | Ga0466967_0151511 | |||
| 1030 | Ga0495592_0049484 | |||
| 1031 | Ga0495592_0176660 | |||
| 1032 | Ga0495603_0150204 | |||
| 1033 | Ga0495651_0371538 | |||
| 1034 | Ga0495651_0707298 | |||
| 1035 | Ga0495653_0647967 | |||
| 1036 | Ga0495664_0142938 | |||
| 1037 | Ga0495618_0093453 | |||
| 1038 | Ga0495628_0034749 | |||
| 1039 | Ga0495628_0778503 | |||
| 1040 | Ga0495630_0324051 | |||
| 1041 | Ga0495630_1017102 | |||
| 1042 | Ga0495652_0127942 | |||
| 1043 | Ga0495665_0352357 | |||
| 1044 | Ga0495640_0513737 | |||
| 1045 | Ga0495640_0703905 | |||
| 1046 | Ga0495587_0376035 | |||
| 1047 | Ga0495645_0017166 | |||
| 1048 | Ga0495667_0978328 | |||
| 1049 | Ga0495635_0715185 | |||
| 1050 | Ga0495599_0007411 | |||
| 1051 | Ga0495623_0076795 | |||
| 1052 | Ga0495646_0013455 | |||
| 1053 | Ga0495613_0722019 | |||
| 1054 | Ga0495600_0311822 | |||
| 1055 | Ga0495581_0052882 | |||
| 1056 | Ga0495581_0604509 | |||
| 1057 | Ga0495604_0113407 | |||
| 1058 | Ga0495674_0075914 | |||
| 1059 | Ga0495675_0528603 | |||
| 1060 | Ga0496100_0189312 | |||
| 1061 | Ga0496100_0405645 | |||
| 1062 | Ga0496101_0009105 | |||
| 1063 | Ga0496101_0233828 | |||
| 1064 | Ga0496102_0398451 | |||
| 1065 | Ga0496102_1350233 | |||
| 1066 | Ga0496103_0886062 | |||
| 1067 | Ga0496104_0033307 | |||
| 1068 | Ga0496104_0283736 | |||
| 1069 | Ga0496105_0323481 | |||
| 1070 | Ga0496105_0509379 | |||
| 1071 | Ga0496106_0310687 | |||
| 1072 | Ga0496106_1208735 | |||
| 1073 | Ga0496107_0044016 | |||
| 1074 | Ga0496107_0046760 | |||
| 1075 | Ga0496108_0054959 | |||
| 1076 | Ga0496108_0274061 | |||
| 1077 | Ga0496109_0015819 | |||
| 1078 | Ga0496109_0108782 | |||
| 1079 | Ga0496109_0489553 | |||
| 1080 | Ga0496109_1239861 | |||
| 1081 | Ga0496109_1731983 | |||
| 1082 | Ga0496110_0532680 | |||
| 1083 | Ga0496112_0058368 | |||
| 1084 | Ga0496113_0201046 | |||
| 1085 | Ga0496113_0479857 | |||
| 1086 | Ga0496113_0643298 | |||
| 1087 | Ga0496114_0073147 | |||
| 1088 | Ga0496114_0096962 | |||
| 1089 | Ga0496115_0001050 | |||
| 1090 | Ga0496115_0143632 | |||
| 1091 | Ga0496115_0192962 | |||
| 1092 | Ga0496115_0231278 | |||
| 1093 | nmdc:mga05p37_289690_c1 | |||
| 1094 | nmdc:mga05p37_363021_c1 | |||
| 1095 | nmdc:mga05p37_9698_c1 | |||
| 1096 | nmdc:mga0qj67_621265_c1 | |||
| 1097 | nmdc:mga08y16_189849_c1 | |||
| 1098 | nmdc:mga0n895_111049_c1 | |||
| 1099 | nmdc:mga0n895_124024_c1 | |||
| 1100 | nmdc:mga0n895_2006655_c1 | |||
| 1101 | nmdc:mga0rr50_258_c1 | |||
| 1102 | nmdc:mga0rr50_470120_c1 | |||
| 1103 | nmdc:mga0rr50_597700_c1 | |||
| 1104 | nmdc:mga0rr50_848325_c1 | |||
| 1105 | nmdc:mga08x19_2516_c1 | |||
| 1106 | nmdc:mga08x19_377705_c1 | |||
| 1107 | nmdc:mga08x19_543312_c1 | |||
| 1108 | nmdc:mga08x19_644403_c1 | |||
| 1109 | nmdc:mga08x19_8060_c1 | |||
| 1110 | nmdc:mga0a205_28_c1 | |||
| 1111 | nmdc:mga0a205_444273_c1 | |||
| 1112 | Ga0495601_0021321 | |||
| 1113 | Ga0495601_0438135 | |||
| 1114 | Ga0495612_0191039 | |||
| 1115 | Ga0495619_0442601 | |||
| 1116 | Ga0495619_0452753 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d82-assembly1.cif.gz_E | crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution | 0.9625 | 25 | 120 |
| 3dl3-assembly3.cif.gz_B | crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 . | 0.9236 | 62 | 118 |
| 5fpx-assembly1.cif.gz_A | the structure of kdgf from yersinia enterocolitica. | 0.9035 | 41 | 118 |
| 3d82-assembly1.cif.gz_E | crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution | 0.8991 | 25 | 120 |
| 5fpz-assembly1.cif.gz_A-2 | the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. | 0.8953 | 41 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3d82C00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9405 | 24 | 120 | 2.60.120.10 |
| 5fpxA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9035 | 41 | 118 | 2.60.120.10 |
| 3d82C00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.903 | 24 | 120 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8948 | 48 | 118 | 2.60.120.10 |
| af_Q10LJ3_463_844_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.8864 | 88 | 120 | 2.60.120.650 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7M3SCW3-F1-model_v4 | Cupin domain-containing protein | 0.9974 | 41 | 120 |
|
| AF-A0A2B3L6T5-F1-model_v4 | deleted | 0.9957 | 45 | 120 |
|
| AF-A0A7W0TFE7-F1-model_v4 | Cupin domain-containing protein | 0.9941 | 41 | 122 |
|
| AF-A0A7Z7CCP4-F1-model_v4 | Cupin domain-containing protein | 0.9895 | 47 | 122 |
|
| AF-A0A434AYR3-F1-model_v4 | Cupin domain-containing protein | 0.9809 | 10 | 125 |
|