F463466

General Info

Members Datasets Scaffolds Average Seq Length
558 256 1116 129

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0858937|Ga0436362_0858937_375_758
Length 127
Sequence MTMQEQLPRPFTNNEDVKYGMLRLVDIPAEAAANQPWFNQTLTTVDQAVVRVGIFQGEFPWHKHIEQDEFFLVLEGEIALDVEGQEPVLLSQHQGFTVPKSTMHRPRASQRSVVLMVESLGIVPTGD

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.91
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 45.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0858937 3300039453 Unclassified 781
2 SwRhRL2b_contig_455266 2162886007 Unclassified 1353
3 JGI24750J21931_1081098 3300002070 Bacteria 540
4 JGI24035J26624_1000950 3300002126 Bacteria 2733
5 JGI24035J26624_1002123 3300002126 Unclassified 1850
6 JGI25406J46586_10000067 3300003203 Bacteria 47883
7 JGI25405J52794_10047487 3300003911 Unclassified 916
8 Ga0065714_10306699 3300005288 Bacteria 673
9 Ga0065714_10445391 3300005288 Unclassified 557
10 Ga0065704_10087106 3300005289 Unclassified 3054
11 Ga0065704_10536454 3300005289 Bacteria 644
12 Ga0065704_10568642 3300005289 Unclassified 625
13 Ga0065704_10730457 3300005289 Unclassified 546
14 Ga0065712_10033944 3300005290 Bacteria 1338
15 Ga0065712_10131832 3300005290 Bacteria 1540
16 Ga0065712_10204465 3300005290 Unclassified 1096
17 Ga0065712_10267956 3300005290 Unclassified 907
18 Ga0065715_10002584 3300005293 Bacteria 8292
19 Ga0065715_10026469 3300005293 Bacteria 1266
20 Ga0065715_10311466 3300005293 Bacteria 1019
21 Ga0065715_10447634 3300005293 Unclassified 818
22 Ga0065715_10739763 3300005293 Unclassified 635
23 Ga0065715_10900609 3300005293 Bacteria 575
24 Ga0065707_10095695 3300005295 Bacteria 3345
25 Ga0070658_10782516 3300005327 Unclassified 829
26 Ga0070676_10024671 3300005328 Bacteria 3390
27 Ga0070676_10170926 3300005328 Bacteria 1406
28 Ga0070683_100017017 3300005329 Bacteria 6416
29 Ga0070683_100415267 3300005329 Unclassified 1283
30 Ga0070683_100592529 3300005329 Bacteria 1061
31 Ga0070690_100044368 3300005330 Unclassified 2821
32 Ga0070690_100065238 3300005330 Bacteria 2354
33 Ga0070690_100093894 3300005330 Unclassified 1979
34 Ga0070666_10092640 3300005335 Unclassified 2078
35 Ga0070680_100036707 3300005336 Bacteria 3960
36 Ga0070680_100395246 3300005336 Bacteria 1178
37 Ga0068868_100006655 3300005338 Bacteria 8198
38 Ga0068868_100077055 3300005338 Unclassified 2667
39 Ga0068868_100128766 3300005338 Bacteria 2070
40 Ga0070660_100198782 3300005339 Unclassified 1626
41 Ga0070689_100016735 3300005340 Bacteria 5371
42 Ga0070689_100031310 3300005340 Bacteria 4042
43 Ga0070689_100064185 3300005340 Unclassified 2858
44 Ga0070687_100028866 3300005343 Bacteria 2695
45 Ga0070687_100050317 3300005343 Bacteria 2151
46 Ga0070661_100029219 3300005344 Bacteria 3977
47 Ga0070668_100065768 3300005347 Unclassified 2812
48 Ga0070668_100140709 3300005347 Bacteria 1944
49 Ga0070668_101483150 3300005347 Unclassified 620
50 Ga0070669_100004177 3300005353 Bacteria 10462
51 Ga0070675_100022574 3300005354 Bacteria 5029
52 Ga0070675_100080971 3300005354 Bacteria 2707
53 Ga0070675_100103216 3300005354 Unclassified 2404
54 Ga0070675_100117795 3300005354 Unclassified 2254
55 Ga0070675_100500748 3300005354 Bacteria 1095
56 Ga0070675_100537364 3300005354 Unclassified 1056
57 Ga0070675_100589085 3300005354 Bacteria 1008
58 Ga0070671_100011335 3300005355 Bacteria 7166
59 Ga0070671_100059775 3300005355 Bacteria 3172
60 Ga0070671_100195959 3300005355 Unclassified 1713
61 Ga0070674_101781517 3300005356 Unclassified 558
62 Ga0070673_100067963 3300005364 Unclassified 2852
63 Ga0070673_100268343 3300005364 Bacteria 1493
64 Ga0070673_101522931 3300005364 Unclassified 631
65 Ga0070688_100038306 3300005365 Unclassified 2927
66 Ga0070688_100049783 3300005365 Bacteria 2608
67 Ga0070688_100219711 3300005365 Bacteria 1338
68 Ga0070659_100007119 3300005366 Bacteria 8112
69 Ga0070659_100021775 3300005366 Bacteria 4887
70 Ga0070659_100268849 3300005366 Unclassified 1416
71 Ga0070659_100358849 3300005366 Unclassified 1224
72 Ga0070659_100684621 3300005366 Bacteria 886
73 Ga0070659_101019066 3300005366 Unclassified 727
74 Ga0070667_100004390 3300005367 Bacteria 11898
75 Ga0070667_100267247 3300005367 Unclassified 1533
76 Ga0070667_100570742 3300005367 Unclassified 1041
77 Ga0070667_100767217 3300005367 Bacteria 894
78 Ga0070709_10264958 3300005434 Bacteria 1243
79 Ga0070714_100153087 3300005435 Bacteria 2080
80 Ga0070714_100184306 3300005435 Bacteria 1901
81 Ga0070714_100544475 3300005435 Unclassified 1110
82 Ga0070714_101944773 3300005435 Unclassified 574
83 Ga0070713_100039977 3300005436 Bacteria 3811
84 Ga0070713_100159659 3300005436 Bacteria 2011
85 Ga0070710_10059206 3300005437 Bacteria 2175
86 Ga0070701_10729678 3300005438 Unclassified 669
87 Ga0070711_100324058 3300005439 Unclassified 1232
88 Ga0070705_100278192 3300005440 Bacteria 1189
89 Ga0070705_100495222 3300005440 Bacteria 927
90 Ga0070700_100017924 3300005441 Bacteria 4060
91 Ga0070708_100027791 3300005445 Bacteria 4859
92 Ga0070708_100039802 3300005445 Unclassified 4115
93 Ga0070708_100110864 3300005445 Bacteria 2522
94 Ga0070708_100227142 3300005445 Bacteria 1751
95 Ga0070708_100349873 3300005445 Bacteria 1393
96 Ga0070708_100413847 3300005445 Unclassified 1271
97 Ga0070708_100502561 3300005445 Bacteria 1144
98 Ga0070708_101284629 3300005445 Unclassified 684
99 Ga0070708_101745578 3300005445 Unclassified 578
100 Ga0070678_100170576 3300005456 Unclassified 1772
101 Ga0070678_100425393 3300005456 Bacteria 1158
102 Ga0070662_100001546 3300005457 Bacteria 14200
103 Ga0070662_100052211 3300005457 Unclassified 2954
104 Ga0070662_100955737 3300005457 Unclassified 732
105 Ga0070681_10011031 3300005458 Bacteria 8933
106 Ga0070681_10574130 3300005458 Bacteria 1041
107 Ga0070681_10896606 3300005458 Unclassified 805
108 Ga0068867_100676580 3300005459 Bacteria 908
109 Ga0070685_10053155 3300005466 Bacteria 2346
110 Ga0070706_100000035 3300005467 Bacteria 152107
111 Ga0070706_100007350 3300005467 Bacteria 10334
112 Ga0070706_100156020 3300005467 Bacteria 2131
113 Ga0070706_100331121 3300005467 Bacteria 1420
114 Ga0070706_100624340 3300005467 Bacteria 1001
115 Ga0070706_100644314 3300005467 Unclassified 984
116 Ga0070706_100960697 3300005467 Unclassified 788
117 Ga0070706_101059555 3300005467 Unclassified 747
118 Ga0070706_101165037 3300005467 Unclassified 709
119 Ga0070707_100002759 3300005468 Bacteria 16720
120 Ga0070707_100019676 3300005468 Bacteria 6363
121 Ga0070707_100021772 3300005468 Bacteria 6059
122 Ga0070707_100296901 3300005468 Bacteria 1570
123 Ga0070707_100354975 3300005468 Bacteria 1424
124 Ga0070707_100394739 3300005468 Unclassified 1343
125 Ga0070707_100506721 3300005468 Unclassified 1169
126 Ga0070707_101029710 3300005468 Bacteria 789
127 Ga0070698_100001022 3300005471 Bacteria 30790
128 Ga0070698_100026006 3300005471 Bacteria 6097
129 Ga0070698_100103586 3300005471 Bacteria 2816
130 Ga0070698_100164416 3300005471 Bacteria 2162
131 Ga0070698_100380559 3300005471 Bacteria 1344
132 Ga0070698_100791225 3300005471 Bacteria 892
133 Ga0070699_100147831 3300005518 Unclassified 2077
134 Ga0070699_100174426 3300005518 Unclassified 1906
135 Ga0070699_100326928 3300005518 Bacteria 1379
136 Ga0070699_100550622 3300005518 Unclassified 1050
137 Ga0070699_100907310 3300005518 Unclassified 807
138 Ga0070699_101841444 3300005518 Unclassified 554
139 Ga0070699_102139626 3300005518 Unclassified 511
140 Ga0070679_100009498 3300005530 Bacteria 9200
141 Ga0070684_100002121 3300005535 Bacteria 14623
142 Ga0070684_100442029 3300005535 Unclassified 1201
143 Ga0070684_100470402 3300005535 Unclassified 1163
144 Ga0070697_100006797 3300005536 Bacteria 8876
145 Ga0070697_100046174 3300005536 Unclassified 3530
146 Ga0070697_100102497 3300005536 Unclassified 2378
147 Ga0070697_100249175 3300005536 Unclassified 1518
148 Ga0070697_100251470 3300005536 Unclassified 1511
149 Ga0070697_100354199 3300005536 Unclassified 1268
150 Ga0070697_100389692 3300005536 Bacteria 1208
151 Ga0068853_100595947 3300005539 Bacteria 1049
152 Ga0070672_100102883 3300005543 Unclassified 2319
153 Ga0070672_100217726 3300005543 Unclassified 1601
154 Ga0070686_100304619 3300005544 Bacteria 1183
155 Ga0070695_100239720 3300005545 Unclassified 1315
156 Ga0070695_101422670 3300005545 Bacteria 575
157 Ga0070693_100329417 3300005547 Unclassified 1039
158 Ga0070665_100013634 3300005548 Bacteria 8175
159 Ga0070665_100052248 3300005548 Bacteria 4100
160 Ga0070665_100362550 3300005548 Bacteria 1455
161 Ga0070665_100459082 3300005548 Unclassified 1284
162 Ga0070704_100018482 3300005549 Bacteria 4459
163 Ga0068855_101466973 3300005563 Bacteria 701
164 Ga0070664_100034554 3300005564 Bacteria 4241
165 Ga0070664_101855786 3300005564 Unclassified 572
166 Ga0068854_100745720 3300005578 Unclassified 849
167 Ga0068856_100082372 3300005614 Bacteria 3193
168 Ga0070702_100081033 3300005615 Unclassified 1944
169 Ga0070702_100102189 3300005615 Bacteria 1760
170 Ga0070702_100694259 3300005615 Bacteria 775
171 Ga0070702_101486215 3300005615 Unclassified 557
172 Ga0068852_100517618 3300005616 Unclassified 1190
173 Ga0068861_100057171 3300005719 Bacteria 2979
174 Ga0068861_100127311 3300005719 Bacteria 2063
175 Ga0068863_100498627 3300005841 Bacteria 1199
176 Ga0068863_101132545 3300005841 Unclassified 787
177 Ga0068858_100341611 3300005842 Bacteria 1433
178 Ga0068858_102334958 3300005842 Unclassified 529
179 Ga0068860_100002246 3300005843 Bacteria 20333
180 Ga0068860_100059423 3300005843 Bacteria 3635
181 Ga0068862_100010280 3300005844 Bacteria 7720
182 Ga0068862_101028500 3300005844 Unclassified 816
183 Ga0081455_10000281 3300005937 Bacteria 67337
184 Ga0081455_10003189 3300005937 Bacteria 19030
185 Ga0081455_10003558 3300005937 Bacteria 17872
186 Ga0081455_10008185 3300005937 Bacteria 10907
187 Ga0081540_1015564 3300005983 Bacteria 4810
188 Ga0081540_1121914 3300005983 Bacteria 1080
189 Ga0081540_1202675 3300005983 Unclassified 720
190 Ga0081539_10000287 3300005985 Bacteria 113988
191 Ga0081539_10024836 3300005985 Bacteria 3875
192 Ga0081539_10130481 3300005985 Unclassified 1235
193 Ga0081539_10137078 3300005985 Bacteria 1193
194 Ga0070717_10121884 3300006028 Bacteria 2234
195 Ga0070717_10155224 3300006028 Unclassified 1982
196 Ga0070717_10223823 3300006028 Bacteria 1654
197 Ga0070717_12095427 3300006028 Unclassified 509
198 Ga0070715_10016363 3300006163 Unclassified 2785
199 Ga0070716_100020092 3300006173 Unclassified 3502
200 Ga0070716_100515612 3300006173 Unclassified 885
201 Ga0070716_100826948 3300006173 Unclassified 719
202 Ga0070716_100943727 3300006173 Unclassified 678
203 Ga0070712_100028740 3300006175 Unclassified 3721
204 Ga0070712_100198771 3300006175 Bacteria 1573
205 Ga0070712_100208746 3300006175 Bacteria 1539
206 Ga0070712_100619139 3300006175 Unclassified 917
207 Ga0070712_101230455 3300006175 Bacteria 652
208 Ga0097621_100059525 3300006237 Bacteria 3128
209 Ga0097621_100786590 3300006237 Bacteria 881
210 Ga0097621_101048066 3300006237 Unclassified 764
211 Ga0097621_102410625 3300006237 Unclassified 503
212 Ga0068871_100100311 3300006358 Unclassified 2425
213 Ga0068871_100998506 3300006358 Unclassified 779
214 Ga0075431_101100235 3300006847 Unclassified 759
215 Ga0075433_10000013 3300006852 Bacteria 68708
216 Ga0075433_10406751 3300006852 Unclassified 1201
217 Ga0075434_100000707 3300006871 Bacteria 26071
218 Ga0075434_102570089 3300006871 Unclassified 510
219 Ga0075436_100240123 3300006914 Bacteria 1288
220 Ga0075436_100521281 3300006914 Bacteria 871
221 Ga0075435_100000262 3300007076 Bacteria 32699
222 Ga0075435_100196290 3300007076 Bacteria 1709
223 Ga0075435_100765579 3300007076 Unclassified 840
224 Ga0075435_100789960 3300007076 Unclassified 826
225 Ga0075435_101844832 3300007076 Bacteria 531
226 Ga0099795_10216084 3300007788 Unclassified 814
227 Ga0105240_10674566 3300009093 Bacteria 1131
228 Ga0105240_11812996 3300009093 Unclassified 636
229 Ga0111539_10546083 3300009094 Bacteria 1350
230 Ga0105245_10017104 3300009098 Bacteria 6328
231 Ga0105245_10246659 3300009098 Unclassified 1733
232 Ga0105245_10998095 3300009098 Unclassified 881
233 Ga0105245_11527435 3300009098 Unclassified 719
234 Ga0105247_10229849 3300009101 Bacteria 1259
235 Ga0114129_10014026 3300009147 Bacteria 11414
236 Ga0114129_10178050 3300009147 Unclassified 2895
237 Ga0114129_10216235 3300009147 Unclassified 2588
238 Ga0114129_10312940 3300009147 Unclassified 2089
239 Ga0105243_10012007 3300009148 Bacteria 6548
240 Ga0105243_10118703 3300009148 Bacteria 2226
241 Ga0105241_10232662 3300009174 Unclassified 1554
242 Ga0105242_10384116 3300009176 Bacteria 1306
243 Ga0105242_11152160 3300009176 Unclassified 792
244 Ga0105237_10064070 3300009545 Bacteria 3673
245 Ga0105237_10304409 3300009545 Bacteria 1597
246 Ga0105237_10358385 3300009545 Bacteria 1463
247 Ga0105238_11924046 3300009551 Bacteria 624
248 Ga0105249_10000764 3300009553 Bacteria 28918
249 Ga0105249_10006018 3300009553 Bacteria 10511
250 Ga0105249_13482021 3300009553 Unclassified 507
251 Ga0099796_10196328 3300010159 Unclassified 817
252 Ga0099796_10522643 3300010159 Unclassified 532
253 Ga0105239_10006314 3300010375 Bacteria 13788
254 Ga0105239_10088096 3300010375 Bacteria 3422
255 Ga0105239_10117843 3300010375 Bacteria 2947
256 Ga0105239_10394534 3300010375 Bacteria 1566
257 Ga0105239_11465759 3300010375 Unclassified 788
258 Ga0105246_10063113 3300011119 Unclassified 2583
259 Ga0105246_10484178 3300011119 Bacteria 1047
260 Ga0157371_10497703 3300013102 Unclassified 900
261 Ga0157370_10303491 3300013104 Unclassified 1473
262 Ga0157374_10004212 3300013296 Bacteria 12088
263 Ga0157374_10021742 3300013296 Bacteria 5713
264 Ga0157374_10053022 3300013296 Bacteria 3780
265 Ga0157374_10109229 3300013296 Bacteria 2659
266 Ga0157374_10242718 3300013296 Unclassified 1772
267 Ga0157374_10358468 3300013296 Unclassified 1450
268 Ga0157374_10797652 3300013296 Bacteria 960
269 Ga0157374_10958830 3300013296 Unclassified 874
270 Ga0157374_11003739 3300013296 Unclassified 854
271 Ga0157374_11375966 3300013296 Unclassified 728
272 Ga0157378_10001788 3300013297 Bacteria 19301
273 Ga0157378_10355630 3300013297 Unclassified 1432
274 Ga0157378_10358474 3300013297 Unclassified 1426
275 Ga0157378_10501780 3300013297 Bacteria 1212
276 Ga0157378_10625943 3300013297 Bacteria 1090
277 Ga0157378_10777100 3300013297 Bacteria 982
278 Ga0157378_10801201 3300013297 Bacteria 968
279 Ga0163162_10011970 3300013306 Bacteria 8460
280 Ga0163162_10475906 3300013306 Bacteria 1380
281 Ga0163162_10536902 3300013306 Unclassified 1298
282 Ga0163162_10855968 3300013306 Bacteria 1024
283 Ga0163162_11115953 3300013306 Unclassified 894
284 Ga0163162_12181820 3300013306 Unclassified 636
285 Ga0157372_10009787 3300013307 Bacteria 10194
286 Ga0157372_10022040 3300013307 Bacteria 6888
287 Ga0157372_10325969 3300013307 Unclassified 1788
288 Ga0157375_10014729 3300013308 Bacteria 6988
289 Ga0163163_10180054 3300014325 Bacteria 2161
290 Ga0163163_10182957 3300014325 Bacteria 2143
291 Ga0163163_12698500 3300014325 Unclassified 554
292 Ga0182008_10129152 3300014497 Unclassified 1259
293 Ga0157377_10011990 3300014745 Bacteria 4346
294 Ga0157377_10133644 3300014745 Bacteria 1518
295 Ga0157379_10023094 3300014968 Bacteria 5514
296 Ga0157379_10824413 3300014968 Unclassified 877
297 Ga0157376_10043972 3300014969 Unclassified 3669
298 Ga0157376_10059035 3300014969 Bacteria 3216
299 Ga0157376_10378110 3300014969 Bacteria 1363
300 Ga0157376_10600084 3300014969 Unclassified 1096
301 Ga0157376_12216819 3300014969 Unclassified 588
302 Ga0182006_1031927 3300015261 Bacteria 2120
303 Ga0213873_10000798 3300021358 Bacteria 5096
304 Ga0207666_1001462 3300025271 Bacteria 2788
305 Ga0207673_1003406 3300025290 Unclassified 1860
306 Ga0207673_1005791 3300025290 Bacteria 1516
307 Ga0207697_10000521 3300025315 Bacteria 21689
308 Ga0207697_10001466 3300025315 Bacteria 12889
309 Ga0207697_10005749 3300025315 Bacteria 5716
310 Ga0207697_10007383 3300025315 Bacteria 4907
311 Ga0207697_10027423 3300025315 Bacteria 2328
312 Ga0207697_10456215 3300025315 Bacteria 566
313 Ga0207653_10007362 3300025885 Bacteria 3430
314 Ga0207692_10053297 3300025898 Bacteria 2060
315 Ga0207688_10090698 3300025901 Bacteria 1755
316 Ga0207688_10122727 3300025901 Unclassified 1517
317 Ga0207688_10482227 3300025901 Bacteria 775
318 Ga0207680_10056409 3300025903 Unclassified 2372
319 Ga0207647_10378837 3300025904 Bacteria 799
320 Ga0207699_10577958 3300025906 Unclassified 817
321 Ga0207645_10001439 3300025907 Bacteria 19481
322 Ga0207645_10255602 3300025907 Bacteria 1160
323 Ga0207645_10583743 3300025907 Bacteria 759
324 Ga0207705_10326658 3300025909 Unclassified 1179
325 Ga0207684_10026185 3300025910 Unclassified 4971
326 Ga0207684_10039749 3300025910 Bacteria 3988
327 Ga0207684_10142432 3300025910 Bacteria 2061
328 Ga0207684_10220794 3300025910 Bacteria 1635
329 Ga0207684_10435596 3300025910 Bacteria 1126
330 Ga0207684_10450853 3300025910 Bacteria 1104
331 Ga0207654_10056206 3300025911 Unclassified 2282
332 Ga0207707_10076833 3300025912 Unclassified 2914
333 Ga0207695_10783046 3300025913 Bacteria 834
334 Ga0207671_10043627 3300025914 Bacteria 3316
335 Ga0207671_10347401 3300025914 Bacteria 1176
336 Ga0207693_10007547 3300025915 Bacteria 8936
337 Ga0207693_10018504 3300025915 Bacteria 5547
338 Ga0207693_10207397 3300025915 Unclassified 1541
339 Ga0207693_10386652 3300025915 Unclassified 1094
340 Ga0207693_10794407 3300025915 Bacteria 730
341 Ga0207663_10318453 3300025916 Unclassified 1168
342 Ga0207663_10652762 3300025916 Bacteria 830
343 Ga0207662_10000373 3300025918 Bacteria 20188
344 Ga0207662_10011981 3300025918 Bacteria 4823
345 Ga0207657_10033426 3300025919 Unclassified 4636
346 Ga0207657_10102571 3300025919 Unclassified 2373
347 Ga0207657_10195363 3300025919 Unclassified 1630
348 Ga0207649_10043251 3300025920 Unclassified 2753
349 Ga0207649_10733067 3300025920 Unclassified 768
350 Ga0207652_10062558 3300025921 Bacteria 3216
351 Ga0207652_10679201 3300025921 Bacteria 920
352 Ga0207646_10000925 3300025922 Bacteria 37781
353 Ga0207646_10086437 3300025922 Bacteria 2806
354 Ga0207646_10205579 3300025922 Unclassified 1778
355 Ga0207646_10243298 3300025922 Unclassified 1625
356 Ga0207646_10270946 3300025922 Bacteria 1534
357 Ga0207646_10326653 3300025922 Bacteria 1386
358 Ga0207681_10034723 3300025923 Bacteria 3317
359 Ga0207650_10323938 3300025925 Unclassified 1263
360 Ga0207650_10540595 3300025925 Unclassified 976
361 Ga0207659_10036562 3300025926 Bacteria 3402
362 Ga0207659_10148490 3300025926 Bacteria 1828
363 Ga0207659_10230184 3300025926 Unclassified 1494
364 Ga0207659_10493530 3300025926 Unclassified 1036
365 Ga0207659_11598247 3300025926 Unclassified 556
366 Ga0207687_10530765 3300025927 Bacteria 985
367 Ga0207700_10148655 3300025928 Bacteria 1934
368 Ga0207664_10144879 3300025929 Bacteria 2013
369 Ga0207664_10377300 3300025929 Bacteria 1258
370 Ga0207644_10104388 3300025931 Unclassified 2134
371 Ga0207644_10299206 3300025931 Unclassified 1296
372 Ga0207690_10005958 3300025932 Bacteria 7220
373 Ga0207690_10098058 3300025932 Unclassified 2087
374 Ga0207690_10149041 3300025932 Bacteria 1733
375 Ga0207690_10526448 3300025932 Bacteria 959
376 Ga0207706_10000900 3300025933 Bacteria 30537
377 Ga0207706_10060993 3300025933 Unclassified 3321
378 Ga0207706_10146797 3300025933 Bacteria 2075
379 Ga0207706_11590482 3300025933 Unclassified 530
380 Ga0207686_11269151 3300025934 Unclassified 604
381 Ga0207709_10064785 3300025935 Bacteria 2296
382 Ga0207670_10044671 3300025936 Unclassified 2932
383 Ga0207670_11758286 3300025936 Bacteria 527
384 Ga0207665_10116006 3300025939 Unclassified 1887
385 Ga0207665_10263838 3300025939 Bacteria 1277
386 Ga0207665_10282973 3300025939 Unclassified 1235
387 Ga0207665_10824142 3300025939 Unclassified 734
388 Ga0207691_10047516 3300025940 Bacteria 3938
389 Ga0207711_10153279 3300025941 Unclassified 2081
390 Ga0207661_10030284 3300025944 Bacteria 4167
391 Ga0207661_10401061 3300025944 Unclassified 1244
392 Ga0207661_10477197 3300025944 Bacteria 1138
393 Ga0207679_10454231 3300025945 Bacteria 1137
394 Ga0207667_11516292 3300025949 Bacteria 641
395 Ga0207651_10019170 3300025960 Unclassified 4092
396 Ga0207651_11285024 3300025960 Unclassified 658
397 Ga0207712_11262697 3300025961 Bacteria 660
398 Ga0207712_11804182 3300025961 Unclassified 548
399 Ga0207668_10002460 3300025972 Bacteria 10815
400 Ga0207668_10648399 3300025972 Unclassified 924
401 Ga0207640_11055558 3300025981 Unclassified 717
402 Ga0207658_10002958 3300025986 Bacteria 12162
403 Ga0207658_10643569 3300025986 Unclassified 955
404 Ga0207658_11695792 3300025986 Bacteria 577
405 Ga0207677_10039334 3300026023 Unclassified 3109
406 Ga0207677_10294539 3300026023 Bacteria 1338
407 Ga0207639_10454204 3300026041 Bacteria 1164
408 Ga0207678_10005584 3300026067 Bacteria 11246
409 Ga0207708_10009263 3300026075 Bacteria 7288
410 Ga0207708_10730295 3300026075 Bacteria 849
411 Ga0207702_10472522 3300026078 Unclassified 1219
412 Ga0207702_10475053 3300026078 Bacteria 1216
413 Ga0207641_10021653 3300026088 Bacteria 5281
414 Ga0207648_10537084 3300026089 Bacteria 1073
415 Ga0207676_10021986 3300026095 Bacteria 4686
416 Ga0207675_100168215 3300026118 Bacteria 2094
417 Ga0207675_100343661 3300026118 Unclassified 1461
418 Ga0207683_10022740 3300026121 Bacteria 5385
419 Ga0207683_10098757 3300026121 Unclassified 2605
420 Ga0207698_10281061 3300026142 Bacteria 1539
421 Ga0268266_10142896 3300028379 Bacteria 2149
422 Ga0268266_10404394 3300028379 Bacteria 1291
423 Ga0268265_10158024 3300028380 Bacteria 1921
424 Ga0268265_11560265 3300028380 Unclassified 665
425 Ga0268264_10067484 3300028381 Bacteria 3019
426 Ga0268264_10134501 3300028381 Bacteria 2196
427 Ga0265334_10025432 3300028573 Unclassified 2396
428 Ga0265338_10000238 3300028800 Bacteria 101800
429 Ga0265332_10029939 3300031238 Unclassified 2378
430 Ga0265325_10000113 3300031241 Bacteria 55789
431 Ga0265329_10323150 3300031242 Bacteria 524
432 Ga0265327_10067046 3300031251 Unclassified 1809
433 Ga0265313_10000826 3300031595 Bacteria 31286
434 Ga0265342_10004123 3300031712 Bacteria 11569
435 Ga0307409_100260272 3300031995 Bacteria 1592
436 Ga0373923_0321724 3300035111 Unclassified 735
437 Ga0373945_0099404 3300035116 Unclassified 1137
438 Ga0373953_0111277 3300035117 Bacteria 1158
439 Ga0373953_0401737 3300035117 Unclassified 603
440 Ga0373954_0473503 3300035118 Unclassified 620
441 Ga0373957_0094422 3300035120 Bacteria 1192
442 Ga0373955_0146222 3300035172 Bacteria 1389
443 Ga0373955_0533820 3300035172 Unclassified 717
444 Ga0373955_0958789 3300035172 Unclassified 527
445 Ga0373942_0134456 3300035207 Bacteria 783
446 Ga0373935_0040877 3300035692 Unclassified 2911
447 Ga0373927_0241702 3300035695 Unclassified 1187
448 Ga0373933_0219394 3300035724 Unclassified 1220
449 Ga0373933_0799698 3300035724 Unclassified 621
450 Ga0373947_0253365 3300035725 Unclassified 1165
451 Ga0373937_0091661 3300036401 Unclassified 2816
452 Ga0373937_0204986 3300036401 Unclassified 1854
453 Ga0373937_0389317 3300036401 Unclassified 1322
454 Ga0373937_0807382 3300036401 Bacteria 886
455 Ga0373925_0160246 3300037068 Unclassified 1772
456 Ga0395899_0048702 3300037312 Bacteria 3152
457 Ga0395900_0055082 3300037418 Unclassified 4094
458 Ga0395900_0191555 3300037418 Unclassified 2074
459 Ga0395900_0476604 3300037418 Bacteria 1201
460 Ga0395898_0036474 3300037466 Bacteria 4882
461 Ga0395898_1481634 3300037466 Unclassified 605
462 Ga0395905_0006840 3300037471 Bacteria 11403
463 Ga0395901_0073647 3300038443 Unclassified 3562
464 Ga0395901_0799294 3300038443 Unclassified 932
465 Ga0451853_1916849 3300041512 Unclassified 836
466 Ga0439464_0151704 3300042439 Unclassified 725
467 Ga0439460_0163277 3300042461 Unclassified 748
468 Ga0453683_0414461 3300044673 Bacteria 869
469 Ga0466964_0012552 3300044706 Unclassified 3207
470 Ga0451576_0160448 3300045051 Bacteria 2346
471 Ga0466967_0151511 3300045976 Unclassified 2168
472 Ga0495592_0049484 3300046454 Unclassified 3124
473 Ga0495592_0176660 3300046454 Bacteria 1458
474 Ga0495603_0150204 3300046455 Bacteria 1354
475 Ga0495651_0371538 3300046462 Bacteria 940
476 Ga0495651_0707298 3300046462 Unclassified 628
477 Ga0495653_0647967 3300046463 Unclassified 645
478 Ga0495664_0142938 3300046477 Bacteria 1451
479 Ga0495618_0093453 3300046514 Bacteria 1923
480 Ga0495628_0034749 3300046516 Unclassified 4053
481 Ga0495628_0778503 3300046516 Unclassified 671
482 Ga0495630_0324051 3300046517 Unclassified 1178
483 Ga0495630_1017102 3300046517 Unclassified 630
484 Ga0495652_0127942 3300046529 Bacteria 2015
485 Ga0495665_0352357 3300046531 Unclassified 750
486 Ga0495640_0513737 3300046533 Unclassified 728
487 Ga0495640_0703905 3300046533 Unclassified 606
488 Ga0495587_0376035 3300046536 Unclassified 790
489 Ga0495645_0017166 3300046543 Bacteria 5184
490 Ga0495667_0978328 3300046559 Unclassified 517
491 Ga0495635_0715185 3300046663 Bacteria 649
492 Ga0495599_0007411 3300046678 Bacteria 6651
493 Ga0495623_0076795 3300046679 Unclassified 2072
494 Ga0495646_0013455 3300046680 Bacteria 5201
495 Ga0495613_0722019 3300046689 Unclassified 655
496 Ga0495600_0311822 3300046809 Bacteria 991
497 Ga0495581_0052882 3300047315 Unclassified 2346
498 Ga0495581_0604509 3300047315 Unclassified 635
499 Ga0495604_0113407 3300047317 Unclassified 1973
500 Ga0495674_0075914 3300047319 Unclassified 2891
501 Ga0495675_0528603 3300047444 Bacteria 675
502 Ga0496100_0189312 3300048903 Unclassified 1493
503 Ga0496100_0405645 3300048903 Unclassified 1039
504 Ga0496101_0009105 3300048904 Bacteria 6514
505 Ga0496101_0233828 3300048904 Unclassified 1429
506 Ga0496102_0398451 3300048905 Unclassified 1294
507 Ga0496102_1350233 3300048905 Unclassified 632
508 Ga0496103_0886062 3300048906 Unclassified 560
509 Ga0496104_0033307 3300048907 Bacteria 4799
510 Ga0496104_0283736 3300048907 Unclassified 1569
511 Ga0496105_0323481 3300048908 Unclassified 1235
512 Ga0496105_0509379 3300048908 Bacteria 944
513 Ga0496106_0310687 3300048909 Unclassified 1265
514 Ga0496106_1208735 3300048909 Unclassified 589
515 Ga0496107_0044016 3300048910 Bacteria 3209
516 Ga0496107_0046760 3300048910 Bacteria 3115
517 Ga0496108_0054959 3300048911 Bacteria 3342
518 Ga0496108_0274061 3300048911 Bacteria 1469
519 Ga0496109_0015819 3300048912 Bacteria 6587
520 Ga0496109_0108782 3300048912 Unclassified 2577
521 Ga0496109_0489553 3300048912 Unclassified 1161
522 Ga0496109_1239861 3300048912 Unclassified 682
523 Ga0496109_1731983 3300048912 Unclassified 558
524 Ga0496110_0532680 3300048913 Unclassified 1068
525 Ga0496112_0058368 3300048915 Bacteria 3800
526 Ga0496113_0201046 3300048916 Bacteria 1584
527 Ga0496113_0479857 3300048916 Bacteria 999
528 Ga0496113_0643298 3300048916 Bacteria 848
529 Ga0496114_0073147 3300048917 Bacteria 2884
530 Ga0496114_0096962 3300048917 Unclassified 2511
531 Ga0496115_0001050 3300048918 Bacteria 20035
532 Ga0496115_0143632 3300048918 Unclassified 1969
533 Ga0496115_0192962 3300048918 Bacteria 1683
534 Ga0496115_0231278 3300048918 Bacteria 1524
535 nmdc:mga05p37_289690_c1 3300050507 Unclassified 1949
536 nmdc:mga05p37_363021_c1 3300050507 Unclassified 1702
537 nmdc:mga05p37_9698_c1 3300050507 Bacteria 11414
538 nmdc:mga0qj67_621265_c1 3300050509 Bacteria 863
539 nmdc:mga08y16_189849_c1 3300050511 Bacteria 2131
540 nmdc:mga0n895_111049_c1 3300050512 Bacteria 2757
541 nmdc:mga0n895_124024_c1 3300050512 Unclassified 2606
542 nmdc:mga0n895_2006655_c1 3300050512 Unclassified 536
543 nmdc:mga0rr50_258_c1 3300050513 Bacteria 28700
544 nmdc:mga0rr50_470120_c1 3300050513 Unclassified 1067
545 nmdc:mga0rr50_597700_c1 3300050513 Unclassified 940
546 nmdc:mga0rr50_848325_c1 3300050513 Bacteria 779
547 nmdc:mga08x19_2516_c1 3300050514 Bacteria 11135
548 nmdc:mga08x19_377705_c1 3300050514 Bacteria 992
549 nmdc:mga08x19_543312_c1 3300050514 Unclassified 822
550 nmdc:mga08x19_644403_c1 3300050514 Unclassified 751
551 nmdc:mga08x19_8060_c1 3300050514 Bacteria 6257
552 nmdc:mga0a205_28_c1 3300050515 Bacteria 82237
553 nmdc:mga0a205_444273_c1 3300050515 Unclassified 1157
554 Ga0495601_0021321 3300053077 Bacteria 3967
555 Ga0495601_0438135 3300053077 Bacteria 846
556 Ga0495612_0191039 3300053078 Unclassified 901
557 Ga0495619_0442601 3300053085 Bacteria 896
558 Ga0495619_0452753 3300053085 Unclassified 885
559 Ga0436362_0858937
560 SwRhRL2b_contig_455266
561 JGI24750J21931_1081098
562 JGI24035J26624_1000950
563 JGI24035J26624_1002123
564 JGI25406J46586_10000067
565 JGI25405J52794_10047487
566 Ga0065714_10306699
567 Ga0065714_10445391
568 Ga0065704_10087106
569 Ga0065704_10536454
570 Ga0065704_10568642
571 Ga0065704_10730457
572 Ga0065712_10033944
573 Ga0065712_10131832
574 Ga0065712_10204465
575 Ga0065712_10267956
576 Ga0065715_10002584
577 Ga0065715_10026469
578 Ga0065715_10311466
579 Ga0065715_10447634
580 Ga0065715_10739763
581 Ga0065715_10900609
582 Ga0065707_10095695
583 Ga0070658_10782516
584 Ga0070676_10024671
585 Ga0070676_10170926
586 Ga0070683_100017017
587 Ga0070683_100415267
588 Ga0070683_100592529
589 Ga0070690_100044368
590 Ga0070690_100065238
591 Ga0070690_100093894
592 Ga0070666_10092640
593 Ga0070680_100036707
594 Ga0070680_100395246
595 Ga0068868_100006655
596 Ga0068868_100077055
597 Ga0068868_100128766
598 Ga0070660_100198782
599 Ga0070689_100016735
600 Ga0070689_100031310
601 Ga0070689_100064185
602 Ga0070687_100028866
603 Ga0070687_100050317
604 Ga0070661_100029219
605 Ga0070668_100065768
606 Ga0070668_100140709
607 Ga0070668_101483150
608 Ga0070669_100004177
609 Ga0070675_100022574
610 Ga0070675_100080971
611 Ga0070675_100103216
612 Ga0070675_100117795
613 Ga0070675_100500748
614 Ga0070675_100537364
615 Ga0070675_100589085
616 Ga0070671_100011335
617 Ga0070671_100059775
618 Ga0070671_100195959
619 Ga0070674_101781517
620 Ga0070673_100067963
621 Ga0070673_100268343
622 Ga0070673_101522931
623 Ga0070688_100038306
624 Ga0070688_100049783
625 Ga0070688_100219711
626 Ga0070659_100007119
627 Ga0070659_100021775
628 Ga0070659_100268849
629 Ga0070659_100358849
630 Ga0070659_100684621
631 Ga0070659_101019066
632 Ga0070667_100004390
633 Ga0070667_100267247
634 Ga0070667_100570742
635 Ga0070667_100767217
636 Ga0070709_10264958
637 Ga0070714_100153087
638 Ga0070714_100184306
639 Ga0070714_100544475
640 Ga0070714_101944773
641 Ga0070713_100039977
642 Ga0070713_100159659
643 Ga0070710_10059206
644 Ga0070701_10729678
645 Ga0070711_100324058
646 Ga0070705_100278192
647 Ga0070705_100495222
648 Ga0070700_100017924
649 Ga0070708_100027791
650 Ga0070708_100039802
651 Ga0070708_100110864
652 Ga0070708_100227142
653 Ga0070708_100349873
654 Ga0070708_100413847
655 Ga0070708_100502561
656 Ga0070708_101284629
657 Ga0070708_101745578
658 Ga0070678_100170576
659 Ga0070678_100425393
660 Ga0070662_100001546
661 Ga0070662_100052211
662 Ga0070662_100955737
663 Ga0070681_10011031
664 Ga0070681_10574130
665 Ga0070681_10896606
666 Ga0068867_100676580
667 Ga0070685_10053155
668 Ga0070706_100000035
669 Ga0070706_100007350
670 Ga0070706_100156020
671 Ga0070706_100331121
672 Ga0070706_100624340
673 Ga0070706_100644314
674 Ga0070706_100960697
675 Ga0070706_101059555
676 Ga0070706_101165037
677 Ga0070707_100002759
678 Ga0070707_100019676
679 Ga0070707_100021772
680 Ga0070707_100296901
681 Ga0070707_100354975
682 Ga0070707_100394739
683 Ga0070707_100506721
684 Ga0070707_101029710
685 Ga0070698_100001022
686 Ga0070698_100026006
687 Ga0070698_100103586
688 Ga0070698_100164416
689 Ga0070698_100380559
690 Ga0070698_100791225
691 Ga0070699_100147831
692 Ga0070699_100174426
693 Ga0070699_100326928
694 Ga0070699_100550622
695 Ga0070699_100907310
696 Ga0070699_101841444
697 Ga0070699_102139626
698 Ga0070679_100009498
699 Ga0070684_100002121
700 Ga0070684_100442029
701 Ga0070684_100470402
702 Ga0070697_100006797
703 Ga0070697_100046174
704 Ga0070697_100102497
705 Ga0070697_100249175
706 Ga0070697_100251470
707 Ga0070697_100354199
708 Ga0070697_100389692
709 Ga0068853_100595947
710 Ga0070672_100102883
711 Ga0070672_100217726
712 Ga0070686_100304619
713 Ga0070695_100239720
714 Ga0070695_101422670
715 Ga0070693_100329417
716 Ga0070665_100013634
717 Ga0070665_100052248
718 Ga0070665_100362550
719 Ga0070665_100459082
720 Ga0070704_100018482
721 Ga0068855_101466973
722 Ga0070664_100034554
723 Ga0070664_101855786
724 Ga0068854_100745720
725 Ga0068856_100082372
726 Ga0070702_100081033
727 Ga0070702_100102189
728 Ga0070702_100694259
729 Ga0070702_101486215
730 Ga0068852_100517618
731 Ga0068861_100057171
732 Ga0068861_100127311
733 Ga0068863_100498627
734 Ga0068863_101132545
735 Ga0068858_100341611
736 Ga0068858_102334958
737 Ga0068860_100002246
738 Ga0068860_100059423
739 Ga0068862_100010280
740 Ga0068862_101028500
741 Ga0081455_10000281
742 Ga0081455_10003189
743 Ga0081455_10003558
744 Ga0081455_10008185
745 Ga0081540_1015564
746 Ga0081540_1121914
747 Ga0081540_1202675
748 Ga0081539_10000287
749 Ga0081539_10024836
750 Ga0081539_10130481
751 Ga0081539_10137078
752 Ga0070717_10121884
753 Ga0070717_10155224
754 Ga0070717_10223823
755 Ga0070717_12095427
756 Ga0070715_10016363
757 Ga0070716_100020092
758 Ga0070716_100515612
759 Ga0070716_100826948
760 Ga0070716_100943727
761 Ga0070712_100028740
762 Ga0070712_100198771
763 Ga0070712_100208746
764 Ga0070712_100619139
765 Ga0070712_101230455
766 Ga0097621_100059525
767 Ga0097621_100786590
768 Ga0097621_101048066
769 Ga0097621_102410625
770 Ga0068871_100100311
771 Ga0068871_100998506
772 Ga0075431_101100235
773 Ga0075433_10000013
774 Ga0075433_10406751
775 Ga0075434_100000707
776 Ga0075434_102570089
777 Ga0075436_100240123
778 Ga0075436_100521281
779 Ga0075435_100000262
780 Ga0075435_100196290
781 Ga0075435_100765579
782 Ga0075435_100789960
783 Ga0075435_101844832
784 Ga0099795_10216084
785 Ga0105240_10674566
786 Ga0105240_11812996
787 Ga0111539_10546083
788 Ga0105245_10017104
789 Ga0105245_10246659
790 Ga0105245_10998095
791 Ga0105245_11527435
792 Ga0105247_10229849
793 Ga0114129_10014026
794 Ga0114129_10178050
795 Ga0114129_10216235
796 Ga0114129_10312940
797 Ga0105243_10012007
798 Ga0105243_10118703
799 Ga0105241_10232662
800 Ga0105242_10384116
801 Ga0105242_11152160
802 Ga0105237_10064070
803 Ga0105237_10304409
804 Ga0105237_10358385
805 Ga0105238_11924046
806 Ga0105249_10000764
807 Ga0105249_10006018
808 Ga0105249_13482021
809 Ga0099796_10196328
810 Ga0099796_10522643
811 Ga0105239_10006314
812 Ga0105239_10088096
813 Ga0105239_10117843
814 Ga0105239_10394534
815 Ga0105239_11465759
816 Ga0105246_10063113
817 Ga0105246_10484178
818 Ga0157371_10497703
819 Ga0157370_10303491
820 Ga0157374_10004212
821 Ga0157374_10021742
822 Ga0157374_10053022
823 Ga0157374_10109229
824 Ga0157374_10242718
825 Ga0157374_10358468
826 Ga0157374_10797652
827 Ga0157374_10958830
828 Ga0157374_11003739
829 Ga0157374_11375966
830 Ga0157378_10001788
831 Ga0157378_10355630
832 Ga0157378_10358474
833 Ga0157378_10501780
834 Ga0157378_10625943
835 Ga0157378_10777100
836 Ga0157378_10801201
837 Ga0163162_10011970
838 Ga0163162_10475906
839 Ga0163162_10536902
840 Ga0163162_10855968
841 Ga0163162_11115953
842 Ga0163162_12181820
843 Ga0157372_10009787
844 Ga0157372_10022040
845 Ga0157372_10325969
846 Ga0157375_10014729
847 Ga0163163_10180054
848 Ga0163163_10182957
849 Ga0163163_12698500
850 Ga0182008_10129152
851 Ga0157377_10011990
852 Ga0157377_10133644
853 Ga0157379_10023094
854 Ga0157379_10824413
855 Ga0157376_10043972
856 Ga0157376_10059035
857 Ga0157376_10378110
858 Ga0157376_10600084
859 Ga0157376_12216819
860 Ga0182006_1031927
861 Ga0213873_10000798
862 Ga0207666_1001462
863 Ga0207673_1003406
864 Ga0207673_1005791
865 Ga0207697_10000521
866 Ga0207697_10001466
867 Ga0207697_10005749
868 Ga0207697_10007383
869 Ga0207697_10027423
870 Ga0207697_10456215
871 Ga0207653_10007362
872 Ga0207692_10053297
873 Ga0207688_10090698
874 Ga0207688_10122727
875 Ga0207688_10482227
876 Ga0207680_10056409
877 Ga0207647_10378837
878 Ga0207699_10577958
879 Ga0207645_10001439
880 Ga0207645_10255602
881 Ga0207645_10583743
882 Ga0207705_10326658
883 Ga0207684_10026185
884 Ga0207684_10039749
885 Ga0207684_10142432
886 Ga0207684_10220794
887 Ga0207684_10435596
888 Ga0207684_10450853
889 Ga0207654_10056206
890 Ga0207707_10076833
891 Ga0207695_10783046
892 Ga0207671_10043627
893 Ga0207671_10347401
894 Ga0207693_10007547
895 Ga0207693_10018504
896 Ga0207693_10207397
897 Ga0207693_10386652
898 Ga0207693_10794407
899 Ga0207663_10318453
900 Ga0207663_10652762
901 Ga0207662_10000373
902 Ga0207662_10011981
903 Ga0207657_10033426
904 Ga0207657_10102571
905 Ga0207657_10195363
906 Ga0207649_10043251
907 Ga0207649_10733067
908 Ga0207652_10062558
909 Ga0207652_10679201
910 Ga0207646_10000925
911 Ga0207646_10086437
912 Ga0207646_10205579
913 Ga0207646_10243298
914 Ga0207646_10270946
915 Ga0207646_10326653
916 Ga0207681_10034723
917 Ga0207650_10323938
918 Ga0207650_10540595
919 Ga0207659_10036562
920 Ga0207659_10148490
921 Ga0207659_10230184
922 Ga0207659_10493530
923 Ga0207659_11598247
924 Ga0207687_10530765
925 Ga0207700_10148655
926 Ga0207664_10144879
927 Ga0207664_10377300
928 Ga0207644_10104388
929 Ga0207644_10299206
930 Ga0207690_10005958
931 Ga0207690_10098058
932 Ga0207690_10149041
933 Ga0207690_10526448
934 Ga0207706_10000900
935 Ga0207706_10060993
936 Ga0207706_10146797
937 Ga0207706_11590482
938 Ga0207686_11269151
939 Ga0207709_10064785
940 Ga0207670_10044671
941 Ga0207670_11758286
942 Ga0207665_10116006
943 Ga0207665_10263838
944 Ga0207665_10282973
945 Ga0207665_10824142
946 Ga0207691_10047516
947 Ga0207711_10153279
948 Ga0207661_10030284
949 Ga0207661_10401061
950 Ga0207661_10477197
951 Ga0207679_10454231
952 Ga0207667_11516292
953 Ga0207651_10019170
954 Ga0207651_11285024
955 Ga0207712_11262697
956 Ga0207712_11804182
957 Ga0207668_10002460
958 Ga0207668_10648399
959 Ga0207640_11055558
960 Ga0207658_10002958
961 Ga0207658_10643569
962 Ga0207658_11695792
963 Ga0207677_10039334
964 Ga0207677_10294539
965 Ga0207639_10454204
966 Ga0207678_10005584
967 Ga0207708_10009263
968 Ga0207708_10730295
969 Ga0207702_10472522
970 Ga0207702_10475053
971 Ga0207641_10021653
972 Ga0207648_10537084
973 Ga0207676_10021986
974 Ga0207675_100168215
975 Ga0207675_100343661
976 Ga0207683_10022740
977 Ga0207683_10098757
978 Ga0207698_10281061
979 Ga0268266_10142896
980 Ga0268266_10404394
981 Ga0268265_10158024
982 Ga0268265_11560265
983 Ga0268264_10067484
984 Ga0268264_10134501
985 Ga0265334_10025432
986 Ga0265338_10000238
987 Ga0265332_10029939
988 Ga0265325_10000113
989 Ga0265329_10323150
990 Ga0265327_10067046
991 Ga0265313_10000826
992 Ga0265342_10004123
993 Ga0307409_100260272
994 Ga0373923_0321724
995 Ga0373945_0099404
996 Ga0373953_0111277
997 Ga0373953_0401737
998 Ga0373954_0473503
999 Ga0373957_0094422
1000 Ga0373955_0146222
1001 Ga0373955_0533820
1002 Ga0373955_0958789
1003 Ga0373942_0134456
1004 Ga0373935_0040877
1005 Ga0373927_0241702
1006 Ga0373933_0219394
1007 Ga0373933_0799698
1008 Ga0373947_0253365
1009 Ga0373937_0091661
1010 Ga0373937_0204986
1011 Ga0373937_0389317
1012 Ga0373937_0807382
1013 Ga0373925_0160246
1014 Ga0395899_0048702
1015 Ga0395900_0055082
1016 Ga0395900_0191555
1017 Ga0395900_0476604
1018 Ga0395898_0036474
1019 Ga0395898_1481634
1020 Ga0395905_0006840
1021 Ga0395901_0073647
1022 Ga0395901_0799294
1023 Ga0451853_1916849
1024 Ga0439464_0151704
1025 Ga0439460_0163277
1026 Ga0453683_0414461
1027 Ga0466964_0012552
1028 Ga0451576_0160448
1029 Ga0466967_0151511
1030 Ga0495592_0049484
1031 Ga0495592_0176660
1032 Ga0495603_0150204
1033 Ga0495651_0371538
1034 Ga0495651_0707298
1035 Ga0495653_0647967
1036 Ga0495664_0142938
1037 Ga0495618_0093453
1038 Ga0495628_0034749
1039 Ga0495628_0778503
1040 Ga0495630_0324051
1041 Ga0495630_1017102
1042 Ga0495652_0127942
1043 Ga0495665_0352357
1044 Ga0495640_0513737
1045 Ga0495640_0703905
1046 Ga0495587_0376035
1047 Ga0495645_0017166
1048 Ga0495667_0978328
1049 Ga0495635_0715185
1050 Ga0495599_0007411
1051 Ga0495623_0076795
1052 Ga0495646_0013455
1053 Ga0495613_0722019
1054 Ga0495600_0311822
1055 Ga0495581_0052882
1056 Ga0495581_0604509
1057 Ga0495604_0113407
1058 Ga0495674_0075914
1059 Ga0495675_0528603
1060 Ga0496100_0189312
1061 Ga0496100_0405645
1062 Ga0496101_0009105
1063 Ga0496101_0233828
1064 Ga0496102_0398451
1065 Ga0496102_1350233
1066 Ga0496103_0886062
1067 Ga0496104_0033307
1068 Ga0496104_0283736
1069 Ga0496105_0323481
1070 Ga0496105_0509379
1071 Ga0496106_0310687
1072 Ga0496106_1208735
1073 Ga0496107_0044016
1074 Ga0496107_0046760
1075 Ga0496108_0054959
1076 Ga0496108_0274061
1077 Ga0496109_0015819
1078 Ga0496109_0108782
1079 Ga0496109_0489553
1080 Ga0496109_1239861
1081 Ga0496109_1731983
1082 Ga0496110_0532680
1083 Ga0496112_0058368
1084 Ga0496113_0201046
1085 Ga0496113_0479857
1086 Ga0496113_0643298
1087 Ga0496114_0073147
1088 Ga0496114_0096962
1089 Ga0496115_0001050
1090 Ga0496115_0143632
1091 Ga0496115_0192962
1092 Ga0496115_0231278
1093 nmdc:mga05p37_289690_c1
1094 nmdc:mga05p37_363021_c1
1095 nmdc:mga05p37_9698_c1
1096 nmdc:mga0qj67_621265_c1
1097 nmdc:mga08y16_189849_c1
1098 nmdc:mga0n895_111049_c1
1099 nmdc:mga0n895_124024_c1
1100 nmdc:mga0n895_2006655_c1
1101 nmdc:mga0rr50_258_c1
1102 nmdc:mga0rr50_470120_c1
1103 nmdc:mga0rr50_597700_c1
1104 nmdc:mga0rr50_848325_c1
1105 nmdc:mga08x19_2516_c1
1106 nmdc:mga08x19_377705_c1
1107 nmdc:mga08x19_543312_c1
1108 nmdc:mga08x19_644403_c1
1109 nmdc:mga08x19_8060_c1
1110 nmdc:mga0a205_28_c1
1111 nmdc:mga0a205_444273_c1
1112 Ga0495601_0021321
1113 Ga0495601_0438135
1114 Ga0495612_0191039
1115 Ga0495619_0442601
1116 Ga0495619_0452753

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

49

118

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9625 25 120
3dl3-assembly3.cif.gz_B crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 . 0.9236 62 118
5fpx-assembly1.cif.gz_A the structure of kdgf from yersinia enterocolitica. 0.9035 41 118
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.8991 25 120
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.8953 41 118
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9405 24 120 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9035 41 118 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.903 24 120 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8948 48 118 2.60.120.10
af_Q10LJ3_463_844_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8864 88 120 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A7M3SCW3-F1-model_v4 Cupin domain-containing protein 0.9974 41 120
AF-A0A2B3L6T5-F1-model_v4 deleted 0.9957 45 120
AF-A0A7W0TFE7-F1-model_v4 Cupin domain-containing protein 0.9941 41 122
AF-A0A7Z7CCP4-F1-model_v4 Cupin domain-containing protein 0.9895 47 122
AF-A0A434AYR3-F1-model_v4 Cupin domain-containing protein 0.9809 10 125

Map