F463461

General Info

Members Datasets Scaffolds Average Seq Length
558 176 558 135

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10449765|Ga0307414_104497651
Length 148
Sequence MPGSGPAPTAMPYLRTRTAAAAIGIALLGALAAGVIIDATDARRDMREHAAAVTGGNPARGEAMFIQYGCGGCHGLKHVRKATGAVGPPLDGIAVRAILAGRLDNSPTNLQAWIRNPQKVAPGTAMPDLNVGERDARDISAFLYTRAE

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
165 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
166 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
172 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 5.02
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10060807 2162886012 Bacteria 2310
2 JGI24739J22299_10001193 3300001989 Bacteria 9735
3 JGI24737J22298_10027128 3300001990 Unclassified 1807
4 JGI24743J22301_10002364 3300001991 Bacteria 2826
5 JGI24735J21928_10138474 3300002067 Bacteria 702
6 JGI24738J21930_10021547 3300002075 Bacteria 1336
7 JGI24738J21930_10048750 3300002075 Unclassified 862
8 Ga0065712_10069244 3300005290 Bacteria 7665
9 Ga0070658_10046607 3300005327 Bacteria 3507
10 Ga0070658_10063251 3300005327 Bacteria 3017
11 Ga0070658_10122773 3300005327 Bacteria 2159
12 Ga0070676_10500523 3300005328 Bacteria 862
13 Ga0070683_100029289 3300005329 Bacteria 4982
14 Ga0070683_100471802 3300005329 Bacteria 1198
15 Ga0070683_101885347 3300005329 Bacteria 574
16 Ga0070670_100018598 3300005331 Bacteria 5955
17 Ga0070670_100038404 3300005331 Bacteria 4117
18 Ga0070677_10033005 3300005333 Bacteria 1990
19 Ga0070666_10052671 3300005335 Bacteria 2743
20 Ga0070666_10128257 3300005335 Bacteria 1761
21 Ga0070680_100020346 3300005336 Bacteria 5268
22 Ga0070680_100411277 3300005336 Bacteria 1154
23 Ga0070682_100004425 3300005337 Bacteria 7798
24 Ga0068868_100054192 3300005338 Bacteria 3160
25 Ga0070660_100074074 3300005339 Bacteria 2663
26 Ga0070660_100227209 3300005339 Bacteria 1518
27 Ga0070660_100268978 3300005339 Bacteria 1393
28 Ga0070660_100312007 3300005339 Bacteria 1291
29 Ga0070691_10011078 3300005341 Bacteria 4118
30 Ga0070687_100439118 3300005343 Unclassified 865
31 Ga0070661_100026675 3300005344 Bacteria 4156
32 Ga0070661_100033991 3300005344 Bacteria 3696
33 Ga0070661_100040469 3300005344 Bacteria 3400
34 Ga0070661_100055236 3300005344 Bacteria 2908
35 Ga0070661_100072049 3300005344 Bacteria 2543
36 Ga0070661_100427649 3300005344 Bacteria 1050
37 Ga0070661_101172432 3300005344 Unclassified 642
38 Ga0070669_100021135 3300005353 Bacteria 4651
39 Ga0070675_100006586 3300005354 Bacteria 8931
40 Ga0070675_100162093 3300005354 Bacteria 1924
41 Ga0070671_100003794 3300005355 Bacteria 11858
42 Ga0070671_100004019 3300005355 Bacteria 11591
43 Ga0070671_100081810 3300005355 Bacteria 2700
44 Ga0070671_100137714 3300005355 Bacteria 2058
45 Ga0070671_100338754 3300005355 Unclassified 1283
46 Ga0070671_100526533 3300005355 Unclassified 1018
47 Ga0070674_100098835 3300005356 Bacteria 2122
48 Ga0070673_100022907 3300005364 Bacteria 4556
49 Ga0070673_100057506 3300005364 Bacteria 3072
50 Ga0070673_100394710 3300005364 Bacteria 1236
51 Ga0070673_100420361 3300005364 Bacteria 1198
52 Ga0070673_101204718 3300005364 Bacteria 709
53 Ga0070659_100020281 3300005366 Bacteria 5047
54 Ga0070659_100028709 3300005366 Bacteria 4298
55 Ga0070659_100039339 3300005366 Bacteria 3691
56 Ga0070659_100074050 3300005366 Bacteria 2712
57 Ga0070659_100328187 3300005366 Bacteria 1280
58 Ga0070659_100604718 3300005366 Unclassified 942
59 Ga0070667_100004258 3300005367 Bacteria 12087
60 Ga0070667_100090475 3300005367 Unclassified 2630
61 Ga0070667_100305070 3300005367 Bacteria 1434
62 Ga0070711_101299075 3300005439 Unclassified 631
63 Ga0070663_100021563 3300005455 Bacteria 4288
64 Ga0070663_100045193 3300005455 Unclassified 3110
65 Ga0070663_100109329 3300005455 Bacteria 2075
66 Ga0070663_100113458 3300005455 Bacteria 2039
67 Ga0070663_100157027 3300005455 Unclassified 1748
68 Ga0070663_100202066 3300005455 Unclassified 1551
69 Ga0070663_100427361 3300005455 Bacteria 1088
70 Ga0070678_100493357 3300005456 Unclassified 1079
71 Ga0070662_100019376 3300005457 Bacteria 4618
72 Ga0070662_100021192 3300005457 Bacteria 4436
73 Ga0070662_100423961 3300005457 Unclassified 1101
74 Ga0070662_100435101 3300005457 Bacteria 1087
75 Ga0070662_100734902 3300005457 Bacteria 836
76 Ga0070681_10117783 3300005458 Bacteria 2593
77 Ga0070681_10349141 3300005458 Bacteria 1390
78 Ga0070681_10642460 3300005458 Bacteria 976
79 Ga0068867_100066046 3300005459 Bacteria 2694
80 Ga0068867_100598880 3300005459 Bacteria 961
81 Ga0070679_100057899 3300005530 Bacteria 3862
82 Ga0070679_100062927 3300005530 Bacteria 3699
83 Ga0070679_100349707 3300005530 Bacteria 1426
84 Ga0070679_102170346 3300005530 Bacteria 505
85 Ga0070684_100064491 3300005535 Bacteria 3213
86 Ga0070684_100090091 3300005535 Unclassified 2727
87 Ga0068853_100072538 3300005539 Bacteria 3000
88 Ga0068853_100074013 3300005539 Bacteria 2971
89 Ga0068853_100907731 3300005539 Unclassified 846
90 Ga0070672_100014000 3300005543 Bacteria 5674
91 Ga0070672_100330489 3300005543 Bacteria 1297
92 Ga0070672_100909696 3300005543 Unclassified 777
93 Ga0070696_101094955 3300005546 Unclassified 669
94 Ga0070665_100070537 3300005548 Bacteria 3501
95 Ga0070665_100122437 3300005548 Bacteria 2603
96 Ga0068855_100177543 3300005563 Unclassified 2409
97 Ga0068855_100331314 3300005563 Bacteria 1680
98 Ga0070664_100006053 3300005564 Bacteria 9781
99 Ga0070664_100044341 3300005564 Bacteria 3755
100 Ga0070664_100084409 3300005564 Bacteria 2741
101 Ga0070664_100301293 3300005564 Unclassified 1448
102 Ga0070664_100346305 3300005564 Unclassified 1351
103 Ga0070664_100433992 3300005564 Bacteria 1204
104 Ga0070664_100547849 3300005564 Bacteria 1069
105 Ga0068857_100001543 3300005577 Bacteria 18432
106 Ga0068857_100005219 3300005577 Bacteria 11060
107 Ga0068857_100209043 3300005577 Bacteria 1780
108 Ga0068854_100002843 3300005578 Bacteria 10755
109 Ga0068854_100077050 3300005578 Bacteria 2452
110 Ga0068854_100098182 3300005578 Unclassified 2191
111 Ga0068854_100553903 3300005578 Bacteria 976
112 Ga0068856_100011171 3300005614 Bacteria 8718
113 Ga0068856_100108886 3300005614 Bacteria 2767
114 Ga0068856_100308734 3300005614 Unclassified 1599
115 Ga0068856_100639488 3300005614 Bacteria 1084
116 Ga0068852_100068191 3300005616 Unclassified 3112
117 Ga0068852_100083998 3300005616 Bacteria 2832
118 Ga0068852_100270610 3300005616 Bacteria 1635
119 Ga0068852_100532464 3300005616 Unclassified 1173
120 Ga0068852_100807322 3300005616 Unclassified 952
121 Ga0068859_100070398 3300005617 Unclassified 3533
122 Ga0068859_101718897 3300005617 Bacteria 693
123 Ga0068864_100004870 3300005618 Bacteria 10991
124 Ga0068864_100007933 3300005618 Bacteria 8748
125 Ga0068864_100082593 3300005618 Bacteria 2820
126 Ga0068864_100264596 3300005618 Bacteria 1601
127 Ga0068851_10003906 3300005834 Bacteria 6675
128 Ga0068851_10028519 3300005834 Unclassified 2758
129 Ga0068851_10367399 3300005834 Unclassified 840
130 Ga0068863_100002387 3300005841 Bacteria 18669
131 Ga0068863_102503894 3300005841 Unclassified 525
132 Ga0068858_100031045 3300005842 Bacteria 4962
133 Ga0068858_100856284 3300005842 Unclassified 888
134 Ga0068858_101158518 3300005842 Bacteria 760
135 Ga0081539_10014766 3300005985 Bacteria 5742
136 Ga0097621_100776565 3300006237 Unclassified 886
137 Ga0097621_101550749 3300006237 Bacteria 629
138 Ga0068871_100029351 3300006358 Bacteria 4318
139 Ga0097620_100070393 3300006931 Unclassified 3533
140 Ga0097620_101719091 3300006931 Bacteria 693
141 Ga0105240_10147139 3300009093 Bacteria 2810
142 Ga0105240_12669859 3300009093 Unclassified 516
143 Ga0105247_10397019 3300009101 Bacteria 982
144 Ga0105241_10571752 3300009174 Bacteria 1017
145 Ga0105248_10004659 3300009177 Bacteria 15180
146 Ga0105248_10511629 3300009177 Bacteria 1354
147 Ga0105248_11694322 3300009177 Unclassified 717
148 Ga0105237_10010945 3300009545 Bacteria 9625
149 Ga0105237_10054496 3300009545 Bacteria 4007
150 Ga0105238_10010338 3300009551 Bacteria 9364
151 Ga0105238_10231468 3300009551 Unclassified 1825
152 Ga0105239_12033502 3300010375 Unclassified 667
153 Ga0105239_13009686 3300010375 Unclassified 549
154 Ga0157373_10056427 3300013100 Unclassified 2789
155 Ga0157373_10094492 3300013100 Bacteria 2105
156 Ga0157373_10373358 3300013100 Bacteria 1019
157 Ga0157373_10954344 3300013100 Unclassified 638
158 Ga0157371_10036063 3300013102 Bacteria 3542
159 Ga0157370_10162749 3300013104 Bacteria 2076
160 Ga0157370_10188492 3300013104 Bacteria 1915
161 Ga0157370_10290448 3300013104 Bacteria 1510
162 Ga0157369_10179110 3300013105 Bacteria 2230
163 Ga0157369_11212807 3300013105 Bacteria 770
164 Ga0157374_10568873 3300013296 Bacteria 1142
165 Ga0157372_10004821 3300013307 Bacteria 14340
166 Ga0157372_10194709 3300013307 Bacteria 2348
167 Ga0157372_10912015 3300013307 Bacteria 1019
168 Ga0157375_10083693 3300013308 Bacteria 3236
169 Ga0182008_10041133 3300014497 Unclassified 2306
170 Ga0157379_10006775 3300014968 Bacteria 9904
171 Ga0163161_10085228 3300017792 Bacteria 2331
172 Ga0213876_10038126 3300021384 Bacteria 2535
173 Ga0207656_10014421 3300025321 Bacteria 3044
174 Ga0207656_10069055 3300025321 Bacteria 1567
175 Ga0207682_10029720 3300025893 Unclassified 2186
176 Ga0207710_10200063 3300025900 Bacteria 986
177 Ga0207680_10066396 3300025903 Bacteria 2219
178 Ga0207680_10084339 3300025903 Bacteria 2004
179 Ga0207647_10000435 3300025904 Bacteria 34176
180 Ga0207647_10007159 3300025904 Bacteria 8092
181 Ga0207705_10016874 3300025909 Bacteria 5230
182 Ga0207705_10098119 3300025909 Unclassified 2152
183 Ga0207705_10120940 3300025909 Bacteria 1943
184 Ga0207705_10285000 3300025909 Bacteria 1265
185 Ga0207705_10594802 3300025909 Bacteria 860
186 Ga0207707_10362289 3300025912 Bacteria 1248
187 Ga0207707_10550056 3300025912 Bacteria 981
188 Ga0207695_10183431 3300025913 Unclassified 2013
189 Ga0207695_10369420 3300025913 Bacteria 1321
190 Ga0207671_10021426 3300025914 Bacteria 4904
191 Ga0207671_10061726 3300025914 Unclassified 2782
192 Ga0207660_10066199 3300025917 Bacteria 2613
193 Ga0207660_10120099 3300025917 Bacteria 1989
194 Ga0207657_10003144 3300025919 Bacteria 17663
195 Ga0207657_10006576 3300025919 Bacteria 12036
196 Ga0207657_10010254 3300025919 Bacteria 9357
197 Ga0207657_11069132 3300025919 Unclassified 617
198 Ga0207657_11086319 3300025919 Unclassified 612
199 Ga0207649_10003988 3300025920 Bacteria 8043
200 Ga0207649_10022843 3300025920 Bacteria 3615
201 Ga0207649_10045074 3300025920 Bacteria 2702
202 Ga0207649_10087026 3300025920 Bacteria 2037
203 Ga0207649_10088437 3300025920 Bacteria 2023
204 Ga0207649_10119840 3300025920 Bacteria 1772
205 Ga0207649_10151405 3300025920 Bacteria 1598
206 Ga0207652_10068067 3300025921 Bacteria 3088
207 Ga0207652_10076713 3300025921 Bacteria 2915
208 Ga0207652_10798011 3300025921 Bacteria 838
209 Ga0207681_10023241 3300025923 Bacteria 3963
210 Ga0207694_10508976 3300025924 Unclassified 1008
211 Ga0207694_10811838 3300025924 Unclassified 790
212 Ga0207650_10011650 3300025925 Bacteria 6058
213 Ga0207650_10094257 3300025925 Bacteria 2293
214 Ga0207650_10498649 3300025925 Bacteria 1017
215 Ga0207650_11502824 3300025925 Bacteria 572
216 Ga0207659_10470048 3300025926 Bacteria 1061
217 Ga0207644_10023653 3300025931 Bacteria 4211
218 Ga0207644_10121909 3300025931 Bacteria 1985
219 Ga0207644_10351499 3300025931 Bacteria 1197
220 Ga0207644_10509495 3300025931 Unclassified 993
221 Ga0207690_10024028 3300025932 Bacteria 3812
222 Ga0207690_10074984 3300025932 Bacteria 2345
223 Ga0207690_10094700 3300025932 Bacteria 2119
224 Ga0207690_10186469 3300025932 Bacteria 1566
225 Ga0207690_10380604 3300025932 Bacteria 1121
226 Ga0207690_11110168 3300025932 Bacteria 659
227 Ga0207706_10001833 3300025933 Bacteria 20853
228 Ga0207706_10026108 3300025933 Bacteria 5229
229 Ga0207706_10158530 3300025933 Bacteria 1990
230 Ga0207706_10733434 3300025933 Bacteria 843
231 Ga0207706_11272253 3300025933 Unclassified 609
232 Ga0207691_10002605 3300025940 Bacteria 17613
233 Ga0207691_10495754 3300025940 Unclassified 1037
234 Ga0207691_10547109 3300025940 Unclassified 982
235 Ga0207711_10030915 3300025941 Bacteria 4517
236 Ga0207711_10091518 3300025941 Bacteria 2676
237 Ga0207661_10051801 3300025944 Bacteria 3276
238 Ga0207661_10109987 3300025944 Bacteria 2329
239 Ga0207661_10476975 3300025944 Unclassified 1138
240 Ga0207661_11656046 3300025944 Bacteria 585
241 Ga0207679_10018811 3300025945 Bacteria 4634
242 Ga0207679_10070745 3300025945 Unclassified 2629
243 Ga0207679_10116264 3300025945 Bacteria 2120
244 Ga0207679_10174705 3300025945 Unclassified 1772
245 Ga0207679_10185027 3300025945 Bacteria 1726
246 Ga0207679_10213022 3300025945 Bacteria 1621
247 Ga0207679_10872227 3300025945 Bacteria 822
248 Ga0207679_11366677 3300025945 Unclassified 650
249 Ga0207667_10050040 3300025949 Bacteria 4410
250 Ga0207667_11096706 3300025949 Bacteria 779
251 Ga0207667_11364881 3300025949 Unclassified 683
252 Ga0207651_10014598 3300025960 Bacteria 4542
253 Ga0207651_10144660 3300025960 Unclassified 1841
254 Ga0207651_10939640 3300025960 Bacteria 771
255 Ga0207651_11086275 3300025960 Bacteria 717
256 Ga0207640_10026283 3300025981 Bacteria 3532
257 Ga0207640_10286177 3300025981 Unclassified 1297
258 Ga0207640_10504746 3300025981 Unclassified 1008
259 Ga0207658_10035154 3300025986 Bacteria 3587
260 Ga0207658_10324127 3300025986 Unclassified 1334
261 Ga0207658_10341833 3300025986 Bacteria 1301
262 Ga0207658_11019477 3300025986 Unclassified 755
263 Ga0207703_10861566 3300026035 Bacteria 867
264 Ga0207703_11044911 3300026035 Bacteria 784
265 Ga0207639_10049409 3300026041 Bacteria 3189
266 Ga0207639_10162077 3300026041 Bacteria 1885
267 Ga0207678_10003199 3300026067 Bacteria 14811
268 Ga0207678_10005791 3300026067 Bacteria 11018
269 Ga0207678_10006076 3300026067 Bacteria 10739
270 Ga0207678_10019220 3300026067 Bacteria 5999
271 Ga0207678_10026600 3300026067 Bacteria 5047
272 Ga0207678_10035824 3300026067 Bacteria 4320
273 Ga0207678_10096435 3300026067 Bacteria 2527
274 Ga0207702_10036994 3300026078 Bacteria 4083
275 Ga0207702_10066478 3300026078 Unclassified 3090
276 Ga0207702_10253583 3300026078 Bacteria 1653
277 Ga0207702_10782937 3300026078 Unclassified 942
278 Ga0207641_10010934 3300026088 Bacteria 7437
279 Ga0207641_10174451 3300026088 Bacteria 1965
280 Ga0207641_11915060 3300026088 Unclassified 594
281 Ga0207648_10089861 3300026089 Bacteria 2684
282 Ga0207676_10103475 3300026095 Bacteria 2366
283 Ga0207676_11126530 3300026095 Unclassified 776
284 Ga0207674_10000060 3300026116 Bacteria 112806
285 Ga0207674_10001045 3300026116 Bacteria 36002
286 Ga0207674_10007041 3300026116 Bacteria 13150
287 Ga0207683_10603785 3300026121 Unclassified 1016
288 Ga0207698_10002123 3300026142 Bacteria 11689
289 Ga0207698_10479946 3300026142 Unclassified 1206
290 Ga0207698_10526451 3300026142 Bacteria 1154
291 Ga0207698_10931181 3300026142 Unclassified 877
292 Ga0268266_10098308 3300028379 Bacteria 2575
293 Ga0268266_10492862 3300028379 Bacteria 1169
294 Ga0307408_100073399 3300031548 Unclassified 2536
295 Ga0307408_100138701 3300031548 Bacteria 1906
296 Ga0307408_100144372 3300031548 Unclassified 1871
297 Ga0307408_100182787 3300031548 Unclassified 1683
298 Ga0307408_100358040 3300031548 Unclassified 1240
299 Ga0307408_100511783 3300031548 Bacteria 1053
300 Ga0307408_100644515 3300031548 Bacteria 946
301 Ga0307408_100743872 3300031548 Unclassified 885
302 Ga0307408_100875165 3300031548 Bacteria 820
303 Ga0307408_101108865 3300031548 Unclassified 734
304 Ga0307405_10005326 3300031731 Bacteria 6193
305 Ga0307405_10065911 3300031731 Bacteria 2307
306 Ga0307405_10210802 3300031731 Bacteria 1418
307 Ga0307405_10313638 3300031731 Unclassified 1195
308 Ga0307405_10402832 3300031731 Unclassified 1071
309 Ga0307405_10490043 3300031731 Unclassified 983
310 Ga0307405_10633569 3300031731 Unclassified 877
311 Ga0307405_10643585 3300031731 Bacteria 871
312 Ga0307405_11076922 3300031731 Unclassified 690
313 Ga0307405_11186388 3300031731 Unclassified 660
314 Ga0307405_11401733 3300031731 Unclassified 611
315 Ga0307413_10025770 3300031824 Bacteria 3229
316 Ga0307413_10040119 3300031824 Bacteria 2729
317 Ga0307413_10042751 3300031824 Bacteria 2665
318 Ga0307413_10046235 3300031824 Bacteria 2586
319 Ga0307413_10047868 3300031824 Bacteria 2552
320 Ga0307413_10099182 3300031824 Bacteria 1919
321 Ga0307413_10128997 3300031824 Unclassified 1727
322 Ga0307413_10147204 3300031824 Unclassified 1636
323 Ga0307413_10150594 3300031824 Bacteria 1620
324 Ga0307413_10299613 3300031824 Bacteria 1218
325 Ga0307413_10314043 3300031824 Bacteria 1194
326 Ga0307413_10349319 3300031824 Bacteria 1141
327 Ga0307413_10354604 3300031824 Unclassified 1133
328 Ga0307413_10796058 3300031824 Unclassified 794
329 Ga0307413_10886884 3300031824 Bacteria 756
330 Ga0307413_10990035 3300031824 Unclassified 720
331 Ga0307413_11570540 3300031824 Unclassified 583
332 Ga0307410_10002693 3300031852 Bacteria 8670
333 Ga0307410_10002885 3300031852 Bacteria 8462
334 Ga0307410_10021654 3300031852 Bacteria 3957
335 Ga0307410_10052275 3300031852 Bacteria 2758
336 Ga0307410_10076991 3300031852 Unclassified 2330
337 Ga0307410_10085620 3300031852 Bacteria 2224
338 Ga0307410_10088116 3300031852 Bacteria 2197
339 Ga0307410_10094200 3300031852 Bacteria 2132
340 Ga0307410_10119634 3300031852 Bacteria 1919
341 Ga0307410_10125890 3300031852 Bacteria 1876
342 Ga0307410_10130197 3300031852 Bacteria 1848
343 Ga0307410_10197575 3300031852 Bacteria 1533
344 Ga0307410_10233737 3300031852 Unclassified 1421
345 Ga0307410_10301617 3300031852 Unclassified 1264
346 Ga0307410_10400293 3300031852 Bacteria 1109
347 Ga0307410_10495898 3300031852 Bacteria 1004
348 Ga0307410_10549067 3300031852 Bacteria 957
349 Ga0307410_11031214 3300031852 Unclassified 710
350 Ga0307406_10056531 3300031901 Bacteria 2513
351 Ga0307406_10105969 3300031901 Bacteria 1925
352 Ga0307406_10131021 3300031901 Bacteria 1760
353 Ga0307406_10562958 3300031901 Bacteria 934
354 Ga0307406_10584725 3300031901 Bacteria 918
355 Ga0307406_11197787 3300031901 Bacteria 659
356 Ga0307407_10024608 3300031903 Bacteria 3160
357 Ga0307407_10024728 3300031903 Plasmid 3154
358 Ga0307407_10026847 3300031903 Bacteria 3055
359 Ga0307407_10052514 3300031903 Bacteria 2341
360 Ga0307407_10092375 3300031903 Bacteria 1858
361 Ga0307407_10094056 3300031903 Bacteria 1844
362 Ga0307407_10189915 3300031903 Bacteria 1368
363 Ga0307407_10248933 3300031903 Bacteria 1216
364 Ga0307407_10703872 3300031903 Unclassified 761
365 Ga0307407_11095783 3300031903 Unclassified 619
366 Ga0307407_11147778 3300031903 Unclassified 605
367 Ga0307412_10015985 3300031911 Bacteria 4459
368 Ga0307412_10131901 3300031911 Bacteria 1816
369 Ga0307412_10211453 3300031911 Bacteria 1480
370 Ga0307412_10296933 3300031911 Bacteria 1275
371 Ga0307412_10466751 3300031911 Bacteria 1044
372 Ga0307412_10575120 3300031911 Bacteria 950
373 Ga0307409_100001336 3300031995 Bacteria 11970
374 Ga0307409_100001436 3300031995 Bacteria 11701
375 Ga0307409_100011931 3300031995 Bacteria 5506
376 Ga0307409_100026280 3300031995 Plasmid 4102
377 Ga0307409_100034639 3300031995 Unclassified 3690
378 Ga0307409_100036427 3300031995 Bacteria 3616
379 Ga0307409_100064509 3300031995 Bacteria 2877
380 Ga0307409_100067286 3300031995 Bacteria 2828
381 Ga0307409_100077128 3300031995 Unclassified 2676
382 Ga0307409_100180660 3300031995 Bacteria 1867
383 Ga0307409_100263605 3300031995 Bacteria 1583
384 Ga0307409_100268980 3300031995 Unclassified 1568
385 Ga0307409_100321753 3300031995 Unclassified 1448
386 Ga0307409_100426952 3300031995 Bacteria 1273
387 Ga0307409_100480410 3300031995 Bacteria 1205
388 Ga0307409_100751269 3300031995 Unclassified 979
389 Ga0307409_100811815 3300031995 Bacteria 944
390 Ga0307409_100906328 3300031995 Unclassified 895
391 Ga0307409_101252777 3300031995 Bacteria 766
392 Ga0307409_101313640 3300031995 Bacteria 748
393 Ga0307409_101335962 3300031995 Bacteria 742
394 Ga0307416_100009810 3300032002 Bacteria 6294
395 Ga0307416_100065273 3300032002 Bacteria 2990
396 Ga0307416_100159815 3300032002 Bacteria 2081
397 Ga0307416_100231795 3300032002 Bacteria 1781
398 Ga0307416_100260052 3300032002 Bacteria 1696
399 Ga0307416_100263430 3300032002 Bacteria 1686
400 Ga0307416_100328653 3300032002 Bacteria 1535
401 Ga0307416_100359046 3300032002 Unclassified 1478
402 Ga0307416_100376728 3300032002 Bacteria 1448
403 Ga0307416_100381713 3300032002 Bacteria 1439
404 Ga0307416_100447167 3300032002 Bacteria 1344
405 Ga0307416_100457388 3300032002 Unclassified 1330
406 Ga0307416_100548057 3300032002 Unclassified 1229
407 Ga0307416_100613646 3300032002 Bacteria 1169
408 Ga0307416_102552594 3300032002 Bacteria 609
409 Ga0307414_10002057 3300032004 Bacteria 10455
410 Ga0307414_10002795 3300032004 Bacteria 9191
411 Ga0307414_10050395 3300032004 Bacteria 2884
412 Ga0307414_10095168 3300032004 Bacteria 2225
413 Ga0307414_10202119 3300032004 Viruses 1617
414 Ga0307414_10248720 3300032004 Unclassified 1476
415 Ga0307414_10384641 3300032004 Unclassified 1214
416 Ga0307414_10392965 3300032004 Bacteria 1202
417 Ga0307414_10413561 3300032004 Bacteria 1174
418 Ga0307414_10440922 3300032004 Bacteria 1140
419 Ga0307414_10449765 3300032004 Bacteria 1129
420 Ga0307414_10470419 3300032004 Unclassified 1106
421 Ga0307414_10562254 3300032004 Bacteria 1018
422 Ga0307414_10579328 3300032004 Bacteria 1004
423 Ga0307414_10584676 3300032004 Bacteria 999
424 Ga0307414_11040741 3300032004 Bacteria 754
425 Ga0307414_11781650 3300032004 Unclassified 574
426 Ga0307411_10001097 3300032005 Bacteria 10538
427 Ga0307411_10003386 3300032005 Bacteria 7385
428 Ga0307411_10003773 3300032005 Bacteria 7115
429 Ga0307411_10032744 3300032005 Bacteria 3215
430 Ga0307411_10087125 3300032005 Bacteria 2168
431 Ga0307411_10089777 3300032005 Unclassified 2141
432 Ga0307411_10148010 3300032005 Bacteria 1741
433 Ga0307411_10176629 3300032005 Bacteria 1616
434 Ga0307411_10321108 3300032005 Unclassified 1250
435 Ga0307411_10408567 3300032005 Bacteria 1124
436 Ga0307411_10412869 3300032005 Unclassified 1119
437 Ga0307411_10434704 3300032005 Bacteria 1094
438 Ga0307411_10434746 3300032005 Bacteria 1093
439 Ga0307411_10518212 3300032005 Bacteria 1011
440 Ga0307411_10588131 3300032005 Unclassified 955
441 Ga0307411_10824668 3300032005 Bacteria 819
442 Ga0307411_10896620 3300032005 Unclassified 787
443 Ga0307411_11143917 3300032005 Bacteria 703
444 Ga0307415_100002792 3300032126 Bacteria 8747
445 Ga0307415_100013721 3300032126 Bacteria 4739
446 Ga0307415_100105010 3300032126 Bacteria 2082
447 Ga0307415_100151160 3300032126 Bacteria 1787
448 Ga0307415_100249858 3300032126 Unclassified 1440
449 Ga0307415_100414119 3300032126 Unclassified 1154
450 Ga0307415_100631675 3300032126 Bacteria 957
451 Ga0307415_100682764 3300032126 Unclassified 924
452 Ga0307415_100684473 3300032126 Bacteria 923
453 Ga0307415_100752421 3300032126 Unclassified 885
454 Ga0307415_100903431 3300032126 Unclassified 814
455 Ga0307415_101471590 3300032126 Unclassified 651
456 Ga0307415_101854091 3300032126 Bacteria 584
457 Ga0307415_102168136 3300032126 Unclassified 543
458 Ga0395899_0046616 3300037312 Bacteria 3228
459 Ga0395899_0160865 3300037312 Bacteria 1586
460 Ga0395899_0433937 3300037312 Bacteria 863
461 Ga0395899_0655599 3300037312 Unclassified 663
462 Ga0395899_0739996 3300037312 Unclassified 613
463 Ga0395900_0219496 3300037418 Bacteria 1917
464 Ga0395900_0618185 3300037418 Unclassified 1022
465 Ga0395900_0774732 3300037418 Unclassified 888
466 Ga0395898_0028125 3300037466 Bacteria 5637
467 Ga0395898_0443198 3300037466 Unclassified 1237
468 Ga0395898_0572244 3300037466 Unclassified 1072
469 Ga0395898_1005541 3300037466 Unclassified 769
470 Ga0395898_1232017 3300037466 Bacteria 679
471 Ga0395898_1437934 3300037466 Bacteria 616
472 Ga0395905_0023071 3300037471 Bacteria 5883
473 Ga0395905_0027046 3300037471 Bacteria 5409
474 Ga0395905_0061841 3300037471 Bacteria 3502
475 Ga0395905_0103096 3300037471 Unclassified 2678
476 Ga0395905_0171039 3300037471 Bacteria 2041
477 Ga0395905_0522331 3300037471 Unclassified 1088
478 Ga0395905_0608631 3300037471 Bacteria 994
479 Ga0395905_0754765 3300037471 Bacteria 875
480 Ga0436364_0730044 3300037853 Bacteria 1058
481 Ga0395901_0064105 3300038443 Bacteria 3824
482 Ga0395901_0083658 3300038443 Bacteria 3335
483 Ga0395901_0091008 3300038443 Bacteria 3193
484 Ga0395901_0292902 3300038443 Bacteria 1689
485 Ga0395901_0767007 3300038443 Unclassified 956
486 Ga0395901_0835603 3300038443 Bacteria 907
487 Ga0395901_1326756 3300038443 Unclassified 680
488 Ga0436365_0782179 3300039437 Bacteria 37690
489 Ga0439432_193042 3300042006 Unclassified 591
490 Ga0466963_0062297 3300044694 Bacteria 2495
491 Ga0466963_0089651 3300044694 Bacteria 2092
492 Ga0466970_0743340 3300044765 Bacteria 573
493 Ga0466957_0014687 3300044842 Bacteria 4563
494 Ga0466957_0309141 3300044842 Bacteria 1064
495 Ga0466958_0429271 3300045836 Bacteria 855
496 Ga0466967_0400523 3300045976 Bacteria 1335
497 Ga0466967_0448590 3300045976 Bacteria 1260
498 Ga0466967_0943664 3300045976 Unclassified 858
499 Ga0495663_0037275 3300046525 Bacteria 1466
500 Ga0495663_0139387 3300046525 Bacteria 822
501 Ga0495668_0009715 3300046616 Bacteria 5878
502 Ga0495668_0012839 3300046616 Bacteria 4961
503 Ga0495669_0026739 3300046684 Bacteria 2522
504 Ga0495669_0261421 3300046684 Bacteria 831
505 Ga0495669_0273215 3300046684 Bacteria 812
506 Ga0495669_0428186 3300046684 Bacteria 642
507 Ga0495670_0396158 3300046691 Bacteria 746
508 Ga0495677_0100140 3300047445 Bacteria 1097
509 Ga0496100_0056540 3300048903 Bacteria 2567
510 Ga0496101_0039063 3300048904 Bacteria 3373
511 Ga0496101_0641387 3300048904 Bacteria 839
512 Ga0496101_1182814 3300048904 Unclassified 599
513 Ga0496103_0105275 3300048906 Unclassified 1788
514 Ga0496104_0798439 3300048907 Bacteria 850
515 Ga0496104_0905989 3300048907 Unclassified 787
516 Ga0496105_0273971 3300048908 Bacteria 1362
517 Ga0496106_0140628 3300048909 Unclassified 1898
518 Ga0496106_1584151 3300048909 Unclassified 502
519 Ga0496107_0007058 3300048910 Bacteria 7738
520 Ga0496107_0008391 3300048910 Bacteria 7150
521 Ga0496107_0104292 3300048910 Bacteria 2081
522 Ga0496107_0384639 3300048910 Bacteria 1044
523 Ga0496108_0013860 3300048911 Bacteria 6575
524 Ga0496108_0037788 3300048911 Bacteria 4023
525 Ga0496109_0005611 3300048912 Bacteria 10499
526 Ga0496109_0102331 3300048912 Bacteria 2658
527 Ga0496109_0143560 3300048912 Bacteria 2233
528 Ga0496110_0006066 3300048913 Bacteria 9527
529 Ga0496110_0032564 3300048913 Bacteria 4503
530 Ga0496111_0000920 3300048914 Bacteria 16055
531 Ga0496111_0030876 3300048914 Bacteria 3812
532 Ga0496111_0125577 3300048914 Bacteria 1896
533 Ga0496112_0022697 3300048915 Bacteria 5986
534 Ga0496112_0502322 3300048915 Bacteria 1148
535 Ga0496113_0115111 3300048916 Unclassified 2097
536 Ga0496114_0301083 3300048917 Bacteria 1416
537 Ga0501036_0297034 3300049572 Bacteria 1351
538 Ga0501067_0144695 3300049583 Bacteria 1324
539 Ga0501069_0109149 3300049585 Bacteria 1575
540 Ga0501071_0199899 3300049587 Unclassified 1501
541 Ga0501071_1501712 3300049587 Unclassified 520
542 Ga0501074_0399716 3300049590 Bacteria 974
543 Ga0501075_0370776 3300049591 Bacteria 1091
544 Ga0501076_0281532 3300049592 Bacteria 1362
545 Ga0501077_0687523 3300049593 Bacteria 657
546 Ga0501217_033112 3300049661 Unclassified 1282
547 Ga0501230_018101 3300049667 Bacteria 1199
548 Ga0501249_011547 3300049679 Bacteria 1856
549 Ga0501225_0175162 3300049705 Unclassified 667
550 Ga0501079_0083203 3300049741 Bacteria 2476
551 Ga0501080_0234179 3300049742 Bacteria 1678
552 Ga0501081_0011354 3300049743 Bacteria 5830
553 Ga0501268_006579 3300049765 Unclassified 1712
554 Ga0501272_063141 3300049769 Unclassified 532
555 Ga0501035_1260525 3300049822 Bacteria 571
556 Ga0495655_0213377 3300053083 Bacteria 636
557 Ga0500658_0004072 3300053134 Bacteria 5497
558 Ga0501084_0696849 3300054114 Unclassified 856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0743340 Ga0466970_0743340_17_349 106
2 3300013102 Ga0157371_10036063 Ga0157371_100360634 116
3 3300013307 Ga0157372_10004821 Ga0157372_1000482112 116
4 3300037418 Ga0395900_0618185 Ga0395900_0618185_268_645 116
5 3300037471 Ga0395905_0103096 Ga0395905_0103096_1131_1508 116
6 3300038443 Ga0395901_0091008 Ga0395901_0091008_2488_2865 116
7 3300038443 Ga0395901_0767007 Ga0395901_0767007_292_669 116
8 3300031548 Ga0307408_100875165 Ga0307408_1008751652 117
9 3300031731 Ga0307405_10210802 Ga0307405_102108022 117
10 3300031852 Ga0307410_10088116 Ga0307410_100881162 117
11 3300031903 Ga0307407_10189915 Ga0307407_101899152 117
12 3300031911 Ga0307412_10296933 Ga0307412_102969332 117
13 3300031995 Ga0307409_101313640 Ga0307409_1013136402 117
14 3300032002 Ga0307416_100263430 Ga0307416_1002634302 117
15 3300032005 Ga0307411_10087125 Ga0307411_100871252 117
16 3300032126 Ga0307415_100013721 Ga0307415_1000137212 117
17 3300037466 Ga0395898_1232017 Ga0395898_1232017_56_436 117
18 3300046684 Ga0495669_0273215 Ga0495669_0273215_289_669 117
19 3300047445 Ga0495677_0100140 Ga0495677_0100140_495_875 117
20 3300049572 Ga0501036_0297034 Ga0501036_0297034_828_1202 117
21 3300049587 Ga0501071_0199899 Ga0501071_0199899_24_398 117
22 3300049590 Ga0501074_0399716 Ga0501074_0399716_249_623 117
23 3300049591 Ga0501075_0370776 Ga0501075_0370776_646_1020 117
24 3300049592 Ga0501076_0281532 Ga0501076_0281532_755_1129 117
25 3300049593 Ga0501077_0687523 Ga0501077_0687523_132_506 117
26 3300049741 Ga0501079_0083203 Ga0501079_0083203_1971_2345 117
27 3300049742 Ga0501080_0234179 Ga0501080_0234179_877_1251 117
28 3300049743 Ga0501081_0011354 Ga0501081_0011354_2990_3364 117
29 3300049822 Ga0501035_1260525 Ga0501035_1260525_114_488 117
30 3300054114 Ga0501084_0696849 Ga0501084_0696849_430_804 117
31 3300026067 Ga0207678_10026600 Ga0207678_100266004 118
32 3300031824 Ga0307413_10299613 Ga0307413_102996132 118
33 3300031852 Ga0307410_10085620 Ga0307410_100856202 118
34 3300031852 Ga0307410_10197575 Ga0307410_101975752 118
35 3300031903 Ga0307407_10092375 Ga0307407_100923754 118
36 3300031903 Ga0307407_11095783 Ga0307407_110957831 118
37 3300031911 Ga0307412_10466751 Ga0307412_104667512 118
38 3300031995 Ga0307409_100064509 Ga0307409_1000645095 118
39 3300032002 Ga0307416_100260052 Ga0307416_1002600522 118
40 3300032002 Ga0307416_100613646 Ga0307416_1006136462 118
41 3300032004 Ga0307414_10248720 Ga0307414_102487203 118
42 3300032004 Ga0307414_10413561 Ga0307414_104135612 118
43 3300032005 Ga0307411_10032744 Ga0307411_100327445 118
44 3300032005 Ga0307411_10518212 Ga0307411_105182123 118
45 3300032126 Ga0307415_100684473 Ga0307415_1006844732 118
46 3300037312 Ga0395899_0046616 Ga0395899_0046616_2534_2959 118
47 3300037466 Ga0395898_0028125 Ga0395898_0028125_5088_5513 118
48 3300037471 Ga0395905_0027046 Ga0395905_0027046_3183_3608 118
49 3300038443 Ga0395901_0064105 Ga0395901_0064105_1414_1839 118
50 3300046691 Ga0495670_0396158 Ga0495670_0396158_213_596 118
51 3300049705 Ga0501225_0175162 Ga0501225_0175162_55_438 118
52 3300053083 Ga0495655_0213377 Ga0495655_0213377_236_619 118
53 3300031548 Ga0307408_100511783 Ga0307408_1005117832 119
54 3300032126 Ga0307415_101471590 Ga0307415_1014715902 119
55 3300046616 Ga0495668_0009715 Ga0495668_0009715_5071_5487 119
56 3300053134 Ga0500658_0004072 Ga0500658_0004072_3110_3526 119
57 3300031548 Ga0307408_100743872 Ga0307408_1007438722 120
58 3300031824 Ga0307413_10128997 Ga0307413_101289972 120
59 3300031852 Ga0307410_10002693 Ga0307410_100026932 120
60 3300031852 Ga0307410_11031214 Ga0307410_110312142 120
61 3300031903 Ga0307407_10024728 Ga0307407_100247282 120
62 3300031903 Ga0307407_10703872 Ga0307407_107038722 120
63 3300031995 Ga0307409_100034639 Ga0307409_1000346392 120
64 3300031995 Ga0307409_100036427 Ga0307409_1000364275 120
65 3300031995 Ga0307409_100751269 Ga0307409_1007512692 120
66 3300032002 Ga0307416_100009810 Ga0307416_1000098108 120
67 3300032002 Ga0307416_100159815 Ga0307416_1001598151 120
68 3300032004 Ga0307414_10002057 Ga0307414_100020575 120
69 3300032005 Ga0307411_10003386 Ga0307411_100033861 120
70 3300031731 Ga0307405_10643585 Ga0307405_106435851 122
71 3300031824 Ga0307413_10047868 Ga0307413_100478682 122
72 3300031824 Ga0307413_10349319 Ga0307413_103493192 122
73 3300031995 Ga0307409_101252777 Ga0307409_1012527772 122
74 3300032002 Ga0307416_100457388 Ga0307416_1004573883 122
75 3300032004 Ga0307414_10470419 Ga0307414_104704192 122
76 3300032005 Ga0307411_10896620 Ga0307411_108966202 122
77 3300049661 Ga0501217_033112 Ga0501217_033112_758_1174 122
78 3300049765 Ga0501268_006579 Ga0501268_006579_380_796 122
79 3300031548 Ga0307408_100138701 Ga0307408_1001387014 123
80 3300031731 Ga0307405_10005326 Ga0307405_100053265 123
81 3300031824 Ga0307413_10040119 Ga0307413_100401194 123
82 3300031852 Ga0307410_10002885 Ga0307410_100028852 123
83 3300031901 Ga0307406_10056531 Ga0307406_100565312 123
84 3300031903 Ga0307407_10026847 Ga0307407_100268475 123
85 3300031911 Ga0307412_10015985 Ga0307412_100159851 123
86 3300031995 Ga0307409_100268980 Ga0307409_1002689802 123
87 3300032002 Ga0307416_100065273 Ga0307416_1000652733 123
88 3300032002 Ga0307416_102552594 Ga0307416_1025525942 123
89 3300032004 Ga0307414_10050395 Ga0307414_100503955 123
90 3300032005 Ga0307411_10003773 Ga0307411_100037736 123
91 3300032005 Ga0307411_11143917 Ga0307411_111439172 123
92 3300032126 Ga0307415_100002792 Ga0307415_1000027929 123
93 3300032126 Ga0307415_100249858 Ga0307415_1002498581 123
94 3300005344 Ga0070661_100072049 Ga0070661_1000720493 127
95 3300005355 Ga0070671_100004019 Ga0070671_1000040193 127
96 3300005364 Ga0070673_100394710 Ga0070673_1003947102 127
97 3300005564 Ga0070664_100433992 Ga0070664_1004339922 127
98 3300005618 Ga0068864_100007933 Ga0068864_1000079333 127
99 3300005842 Ga0068858_100856284 Ga0068858_1008562842 127
100 3300009177 Ga0105248_10511629 Ga0105248_105116293 127
101 3300013296 Ga0157374_10568873 Ga0157374_105688732 127
102 3300025919 Ga0207657_11069132 Ga0207657_110691322 127
103 3300025920 Ga0207649_10045074 Ga0207649_100450744 127
104 3300025931 Ga0207644_10121909 Ga0207644_101219093 127
105 3300025932 Ga0207690_10186469 Ga0207690_101864692 127
106 3300025940 Ga0207691_10547109 Ga0207691_105471092 127
107 3300025941 Ga0207711_10030915 Ga0207711_100309156 127
108 3300025944 Ga0207661_11656046 Ga0207661_116560461 127
109 3300025960 Ga0207651_10014598 Ga0207651_100145983 127
110 3300025986 Ga0207658_10341833 Ga0207658_103418332 127
111 3300026035 Ga0207703_10861566 Ga0207703_108615663 127
112 3300026088 Ga0207641_10174451 Ga0207641_101744513 127
113 3300026095 Ga0207676_10103475 Ga0207676_101034754 127
114 3300032002 Ga0307416_100231795 Ga0307416_1002317954 127
115 3300046525 Ga0495663_0139387 Ga0495663_0139387_290_700 127
116 3300048903 Ga0496100_0056540 Ga0496100_0056540_1939_2349 127
117 3300048904 Ga0496101_0039063 Ga0496101_0039063_407_817 127
118 3300048907 Ga0496104_0798439 Ga0496104_0798439_282_692 127
119 3300048910 Ga0496107_0007058 Ga0496107_0007058_323_733 127
120 3300048911 Ga0496108_0037788 Ga0496108_0037788_3589_3999 127
121 3300048912 Ga0496109_0102331 Ga0496109_0102331_965_1375 127
122 3300048913 Ga0496110_0032564 Ga0496110_0032564_3845_4255 127
123 3300048914 Ga0496111_0030876 Ga0496111_0030876_1197_1607 127
124 3300048915 Ga0496112_0022697 Ga0496112_0022697_546_956 127
125 3300001989 JGI24739J22299_10001193 JGI24739J22299_100011932 128
126 3300001990 JGI24737J22298_10027128 JGI24737J22298_100271282 128
127 3300001991 JGI24743J22301_10002364 JGI24743J22301_100023642 128
128 3300002075 JGI24738J21930_10021547 JGI24738J21930_100215473 128
129 3300005327 Ga0070658_10046607 Ga0070658_100466072 128
130 3300005331 Ga0070670_100018598 Ga0070670_1000185985 128
131 3300005335 Ga0070666_10128257 Ga0070666_101282572 128
132 3300005338 Ga0068868_100054192 Ga0068868_1000541924 128
133 3300005339 Ga0070660_100312007 Ga0070660_1003120072 128
134 3300005344 Ga0070661_100427649 Ga0070661_1004276492 128
135 3300005355 Ga0070671_100137714 Ga0070671_1001377142 128
136 3300005364 Ga0070673_100022907 Ga0070673_1000229075 128
137 3300005366 Ga0070659_100020281 Ga0070659_1000202816 128
138 3300005367 Ga0070667_100004258 Ga0070667_1000042585 128
139 3300005455 Ga0070663_100109329 Ga0070663_1001093291 128
140 3300005457 Ga0070662_100019376 Ga0070662_1000193761 128
141 3300005535 Ga0070684_100090091 Ga0070684_1000900912 128
142 3300005548 Ga0070665_100070537 Ga0070665_1000705375 128
143 3300005564 Ga0070664_100084409 Ga0070664_1000844094 128
144 3300005577 Ga0068857_100001543 Ga0068857_10000154320 128
145 3300005578 Ga0068854_100098182 Ga0068854_1000981825 128
146 3300005616 Ga0068852_100270610 Ga0068852_1002706104 128
147 3300005618 Ga0068864_100264596 Ga0068864_1002645963 128
148 3300025903 Ga0207680_10066396 Ga0207680_100663964 128
149 3300025904 Ga0207647_10007159 Ga0207647_100071598 128
150 3300025909 Ga0207705_10285000 Ga0207705_102850002 128
151 3300025919 Ga0207657_10010254 Ga0207657_100102543 128
152 3300025920 Ga0207649_10151405 Ga0207649_101514054 128
153 3300025925 Ga0207650_10011650 Ga0207650_100116506 128
154 3300025925 Ga0207650_11502824 Ga0207650_115028242 128
155 3300025932 Ga0207690_10024028 Ga0207690_100240285 128
156 3300025933 Ga0207706_10001833 Ga0207706_1000183311 128
157 3300025945 Ga0207679_10018811 Ga0207679_100188114 128
158 3300025960 Ga0207651_10144660 Ga0207651_101446605 128
159 3300025981 Ga0207640_10026283 Ga0207640_100262833 128
160 3300025986 Ga0207658_10035154 Ga0207658_100351545 128
161 3300026041 Ga0207639_10162077 Ga0207639_101620774 128
162 3300026067 Ga0207678_10006076 Ga0207678_100060764 128
163 3300026116 Ga0207674_10007041 Ga0207674_100070415 128
164 3300028379 Ga0268266_10098308 Ga0268266_100983082 128
165 3300031852 Ga0307410_10301617 Ga0307410_103016172 128
166 3300031995 Ga0307409_100026280 Ga0307409_1000262805 128
167 3300032002 Ga0307416_100328653 Ga0307416_1003286532 128
168 3300032004 Ga0307414_10202119 Ga0307414_102021193 128
169 3300032005 Ga0307411_10321108 Ga0307411_103211082 128
170 3300032126 Ga0307415_100903431 Ga0307415_1009034311 128
171 3300037312 Ga0395899_0655599 Ga0395899_0655599_145_558 128
172 3300037466 Ga0395898_0443198 Ga0395898_0443198_421_834 128
173 3300037471 Ga0395905_0061841 Ga0395905_0061841_1229_1642 128
174 2162886012 MBSR1b_contig_10060807 MBSR1b_0634.00003240 129
175 3300002067 JGI24735J21928_10138474 JGI24735J21928_101384742 129
176 3300002075 JGI24738J21930_10048750 JGI24738J21930_100487502 129
177 3300005290 Ga0065712_10069244 Ga0065712_100692448 129
178 3300005327 Ga0070658_10063251 Ga0070658_100632515 129
179 3300005327 Ga0070658_10122773 Ga0070658_101227734 129
180 3300005328 Ga0070676_10500523 Ga0070676_105005231 129
181 3300005329 Ga0070683_100029289 Ga0070683_1000292894 129
182 3300005329 Ga0070683_100471802 Ga0070683_1004718022 129
183 3300005329 Ga0070683_101885347 Ga0070683_1018853471 129
184 3300005331 Ga0070670_100038404 Ga0070670_1000384042 129
185 3300005333 Ga0070677_10033005 Ga0070677_100330052 129
186 3300005335 Ga0070666_10052671 Ga0070666_100526712 129
187 3300005336 Ga0070680_100020346 Ga0070680_1000203465 129
188 3300005336 Ga0070680_100411277 Ga0070680_1004112771 129
189 3300005337 Ga0070682_100004425 Ga0070682_1000044254 129
190 3300005339 Ga0070660_100074074 Ga0070660_1000740744 129
191 3300005339 Ga0070660_100227209 Ga0070660_1002272092 129
192 3300005339 Ga0070660_100268978 Ga0070660_1002689782 129
193 3300005341 Ga0070691_10011078 Ga0070691_100110785 129
194 3300005343 Ga0070687_100439118 Ga0070687_1004391182 129
195 3300005344 Ga0070661_100026675 Ga0070661_1000266757 129
196 3300005344 Ga0070661_100033991 Ga0070661_1000339915 129
197 3300005344 Ga0070661_100040469 Ga0070661_1000404693 129
198 3300005344 Ga0070661_100055236 Ga0070661_1000552364 129
199 3300005344 Ga0070661_101172432 Ga0070661_1011724321 129
200 3300005353 Ga0070669_100021135 Ga0070669_1000211355 129
201 3300005354 Ga0070675_100006586 Ga0070675_10000658610 129
202 3300005354 Ga0070675_100162093 Ga0070675_1001620931 129
203 3300005355 Ga0070671_100003794 Ga0070671_10000379415 129
204 3300005355 Ga0070671_100081810 Ga0070671_1000818102 129
205 3300005355 Ga0070671_100338754 Ga0070671_1003387541 129
206 3300005355 Ga0070671_100526533 Ga0070671_1005265332 129
207 3300005356 Ga0070674_100098835 Ga0070674_1000988354 129
208 3300005364 Ga0070673_100057506 Ga0070673_1000575064 129
209 3300005364 Ga0070673_100420361 Ga0070673_1004203612 129
210 3300005364 Ga0070673_101204718 Ga0070673_1012047181 129
211 3300005366 Ga0070659_100028709 Ga0070659_1000287096 129
212 3300005366 Ga0070659_100039339 Ga0070659_1000393392 129
213 3300005366 Ga0070659_100074050 Ga0070659_1000740505 129
214 3300005366 Ga0070659_100328187 Ga0070659_1003281872 129
215 3300005366 Ga0070659_100604718 Ga0070659_1006047182 129
216 3300005367 Ga0070667_100090475 Ga0070667_1000904752 129
217 3300005367 Ga0070667_100305070 Ga0070667_1003050702 129
218 3300005439 Ga0070711_101299075 Ga0070711_1012990751 129
219 3300005455 Ga0070663_100021563 Ga0070663_1000215635 129
220 3300005455 Ga0070663_100045193 Ga0070663_1000451932 129
221 3300005455 Ga0070663_100113458 Ga0070663_1001134582 129
222 3300005455 Ga0070663_100157027 Ga0070663_1001570274 129
223 3300005455 Ga0070663_100202066 Ga0070663_1002020662 129
224 3300005455 Ga0070663_100427361 Ga0070663_1004273611 129
225 3300005456 Ga0070678_100493357 Ga0070678_1004933572 129
226 3300005457 Ga0070662_100021192 Ga0070662_1000211927 129
227 3300005457 Ga0070662_100423961 Ga0070662_1004239611 129
228 3300005457 Ga0070662_100435101 Ga0070662_1004351012 129
229 3300005457 Ga0070662_100734902 Ga0070662_1007349021 129
230 3300005458 Ga0070681_10117783 Ga0070681_101177833 129
231 3300005458 Ga0070681_10349141 Ga0070681_103491412 129
232 3300005458 Ga0070681_10642460 Ga0070681_106424602 129
233 3300005459 Ga0068867_100066046 Ga0068867_1000660462 129
234 3300005459 Ga0068867_100598880 Ga0068867_1005988801 129
235 3300005530 Ga0070679_100057899 Ga0070679_1000578994 129
236 3300005530 Ga0070679_100062927 Ga0070679_1000629275 129
237 3300005530 Ga0070679_100349707 Ga0070679_1003497071 129
238 3300005530 Ga0070679_102170346 Ga0070679_1021703461 129
239 3300005535 Ga0070684_100064491 Ga0070684_1000644915 129
240 3300005539 Ga0068853_100072538 Ga0068853_1000725384 129
241 3300005539 Ga0068853_100074013 Ga0068853_1000740131 129
242 3300005539 Ga0068853_100907731 Ga0068853_1009077313 129
243 3300005543 Ga0070672_100014000 Ga0070672_1000140005 129
244 3300005543 Ga0070672_100330489 Ga0070672_1003304892 129
245 3300005543 Ga0070672_100909696 Ga0070672_1009096962 129
246 3300005546 Ga0070696_101094955 Ga0070696_1010949551 129
247 3300005548 Ga0070665_100122437 Ga0070665_1001224372 129
248 3300005563 Ga0068855_100177543 Ga0068855_1001775435 129
249 3300005563 Ga0068855_100331314 Ga0068855_1003313142 129
250 3300005564 Ga0070664_100006053 Ga0070664_1000060538 129
251 3300005564 Ga0070664_100044341 Ga0070664_1000443415 129
252 3300005564 Ga0070664_100301293 Ga0070664_1003012931 129
253 3300005564 Ga0070664_100346305 Ga0070664_1003463052 129
254 3300005564 Ga0070664_100547849 Ga0070664_1005478492 129
255 3300005577 Ga0068857_100005219 Ga0068857_10000521912 129
256 3300005577 Ga0068857_100209043 Ga0068857_1002090431 129
257 3300005578 Ga0068854_100002843 Ga0068854_10000284310 129
258 3300005578 Ga0068854_100077050 Ga0068854_1000770502 129
259 3300005578 Ga0068854_100553903 Ga0068854_1005539032 129
260 3300005614 Ga0068856_100011171 Ga0068856_1000111714 129
261 3300005614 Ga0068856_100108886 Ga0068856_1001088863 129
262 3300005614 Ga0068856_100308734 Ga0068856_1003087342 129
263 3300005614 Ga0068856_100639488 Ga0068856_1006394882 129
264 3300005616 Ga0068852_100068191 Ga0068852_1000681915 129
265 3300005616 Ga0068852_100083998 Ga0068852_1000839983 129
266 3300005616 Ga0068852_100532464 Ga0068852_1005324642 129
267 3300005616 Ga0068852_100807322 Ga0068852_1008073221 129
268 3300005617 Ga0068859_100070398 Ga0068859_1000703983 129
269 3300005617 Ga0068859_101718897 Ga0068859_1017188972 129
270 3300005618 Ga0068864_100004870 Ga0068864_1000048702 129
271 3300005618 Ga0068864_100082593 Ga0068864_1000825932 129
272 3300005834 Ga0068851_10003906 Ga0068851_100039065 129
273 3300005834 Ga0068851_10028519 Ga0068851_100285192 129
274 3300005834 Ga0068851_10367399 Ga0068851_103673992 129
275 3300005841 Ga0068863_100002387 Ga0068863_10000238713 129
276 3300005841 Ga0068863_102503894 Ga0068863_1025038941 129
277 3300005842 Ga0068858_100031045 Ga0068858_1000310454 129
278 3300005842 Ga0068858_101158518 Ga0068858_1011585182 129
279 3300005985 Ga0081539_10014766 Ga0081539_100147666 129
280 3300006237 Ga0097621_100776565 Ga0097621_1007765652 129
281 3300006237 Ga0097621_101550749 Ga0097621_1015507492 129
282 3300006358 Ga0068871_100029351 Ga0068871_1000293512 129
283 3300006931 Ga0097620_100070393 Ga0097620_1000703933 129
284 3300006931 Ga0097620_101719091 Ga0097620_1017190912 129
285 3300009093 Ga0105240_10147139 Ga0105240_101471392 129
286 3300009093 Ga0105240_12669859 Ga0105240_126698591 129
287 3300009101 Ga0105247_10397019 Ga0105247_103970192 129
288 3300009174 Ga0105241_10571752 Ga0105241_105717521 129
289 3300009177 Ga0105248_10004659 Ga0105248_1000465911 129
290 3300009177 Ga0105248_11694322 Ga0105248_116943222 129
291 3300009545 Ga0105237_10010945 Ga0105237_100109456 129
292 3300009545 Ga0105237_10054496 Ga0105237_100544965 129
293 3300009551 Ga0105238_10010338 Ga0105238_100103388 129
294 3300009551 Ga0105238_10231468 Ga0105238_102314682 129
295 3300010375 Ga0105239_12033502 Ga0105239_120335022 129
296 3300010375 Ga0105239_13009686 Ga0105239_130096862 129
297 3300013100 Ga0157373_10056427 Ga0157373_100564272 129
298 3300013100 Ga0157373_10094492 Ga0157373_100944923 129
299 3300013100 Ga0157373_10373358 Ga0157373_103733582 129
300 3300013100 Ga0157373_10954344 Ga0157373_109543442 129
301 3300013104 Ga0157370_10162749 Ga0157370_101627492 129
302 3300013104 Ga0157370_10188492 Ga0157370_101884922 129
303 3300013104 Ga0157370_10290448 Ga0157370_102904483 129
304 3300013105 Ga0157369_10179110 Ga0157369_101791103 129
305 3300013105 Ga0157369_11212807 Ga0157369_112128072 129
306 3300013307 Ga0157372_10194709 Ga0157372_101947092 129
307 3300013307 Ga0157372_10912015 Ga0157372_109120152 129
308 3300013308 Ga0157375_10083693 Ga0157375_100836935 129
309 3300014497 Ga0182008_10041133 Ga0182008_100411332 129
310 3300014968 Ga0157379_10006775 Ga0157379_100067755 129
311 3300017792 Ga0163161_10085228 Ga0163161_100852282 129
312 3300021384 Ga0213876_10038126 Ga0213876_100381265 129
313 3300025321 Ga0207656_10014421 Ga0207656_100144214 129
314 3300025321 Ga0207656_10069055 Ga0207656_100690554 129
315 3300025893 Ga0207682_10029720 Ga0207682_100297204 129
316 3300025900 Ga0207710_10200063 Ga0207710_102000632 129
317 3300025903 Ga0207680_10084339 Ga0207680_100843392 129
318 3300025904 Ga0207647_10000435 Ga0207647_100004358 129
319 3300025909 Ga0207705_10016874 Ga0207705_100168742 129
320 3300025909 Ga0207705_10098119 Ga0207705_100981194 129
321 3300025909 Ga0207705_10120940 Ga0207705_101209403 129
322 3300025909 Ga0207705_10594802 Ga0207705_105948021 129
323 3300025912 Ga0207707_10362289 Ga0207707_103622894 129
324 3300025912 Ga0207707_10550056 Ga0207707_105500563 129
325 3300025913 Ga0207695_10183431 Ga0207695_101834312 129
326 3300025913 Ga0207695_10369420 Ga0207695_103694202 129
327 3300025914 Ga0207671_10021426 Ga0207671_100214263 129
328 3300025914 Ga0207671_10061726 Ga0207671_100617262 129
329 3300025917 Ga0207660_10066199 Ga0207660_100661994 129
330 3300025917 Ga0207660_10120099 Ga0207660_101200993 129
331 3300025919 Ga0207657_10003144 Ga0207657_100031447 129
332 3300025919 Ga0207657_10006576 Ga0207657_1000657610 129
333 3300025919 Ga0207657_11086319 Ga0207657_110863191 129
334 3300025920 Ga0207649_10003988 Ga0207649_100039888 129
335 3300025920 Ga0207649_10022843 Ga0207649_100228432 129
336 3300025920 Ga0207649_10087026 Ga0207649_100870262 129
337 3300025920 Ga0207649_10088437 Ga0207649_100884374 129
338 3300025920 Ga0207649_10119840 Ga0207649_101198402 129
339 3300025921 Ga0207652_10068067 Ga0207652_100680675 129
340 3300025921 Ga0207652_10076713 Ga0207652_100767134 129
341 3300025921 Ga0207652_10798011 Ga0207652_107980111 129
342 3300025923 Ga0207681_10023241 Ga0207681_100232417 129
343 3300025924 Ga0207694_10508976 Ga0207694_105089762 129
344 3300025924 Ga0207694_10811838 Ga0207694_108118381 129
345 3300025925 Ga0207650_10094257 Ga0207650_100942572 129
346 3300025925 Ga0207650_10498649 Ga0207650_104986492 129
347 3300025926 Ga0207659_10470048 Ga0207659_104700481 129
348 3300025931 Ga0207644_10023653 Ga0207644_100236535 129
349 3300025931 Ga0207644_10351499 Ga0207644_103514991 129
350 3300025931 Ga0207644_10509495 Ga0207644_105094952 129
351 3300025932 Ga0207690_10074984 Ga0207690_100749844 129
352 3300025932 Ga0207690_10094700 Ga0207690_100947003 129
353 3300025932 Ga0207690_10380604 Ga0207690_103806042 129
354 3300025932 Ga0207690_11110168 Ga0207690_111101682 129
355 3300025933 Ga0207706_10026108 Ga0207706_100261087 129
356 3300025933 Ga0207706_10158530 Ga0207706_101585302 129
357 3300025933 Ga0207706_10733434 Ga0207706_107334342 129
358 3300025933 Ga0207706_11272253 Ga0207706_112722531 129
359 3300025940 Ga0207691_10002605 Ga0207691_1000260514 129
360 3300025940 Ga0207691_10495754 Ga0207691_104957542 129
361 3300025941 Ga0207711_10091518 Ga0207711_100915181 129
362 3300025944 Ga0207661_10051801 Ga0207661_100518013 129
363 3300025944 Ga0207661_10109987 Ga0207661_101099873 129
364 3300025944 Ga0207661_10476975 Ga0207661_104769752 129
365 3300025945 Ga0207679_10070745 Ga0207679_100707453 129
366 3300025945 Ga0207679_10116264 Ga0207679_101162644 129
367 3300025945 Ga0207679_10174705 Ga0207679_101747052 129
368 3300025945 Ga0207679_10185027 Ga0207679_101850275 129
369 3300025945 Ga0207679_10213022 Ga0207679_102130222 129
370 3300025945 Ga0207679_10872227 Ga0207679_108722272 129
371 3300025945 Ga0207679_11366677 Ga0207679_113666771 129
372 3300025949 Ga0207667_10050040 Ga0207667_100500405 129
373 3300025949 Ga0207667_11096706 Ga0207667_110967061 129
374 3300025949 Ga0207667_11364881 Ga0207667_113648811 129
375 3300025960 Ga0207651_10939640 Ga0207651_109396402 129
376 3300025960 Ga0207651_11086275 Ga0207651_110862753 129
377 3300025981 Ga0207640_10286177 Ga0207640_102861772 129
378 3300025981 Ga0207640_10504746 Ga0207640_105047461 129
379 3300025986 Ga0207658_10324127 Ga0207658_103241272 129
380 3300025986 Ga0207658_11019477 Ga0207658_110194772 129
381 3300026035 Ga0207703_11044911 Ga0207703_110449112 129
382 3300026041 Ga0207639_10049409 Ga0207639_100494095 129
383 3300026067 Ga0207678_10003199 Ga0207678_1000319911 129
384 3300026067 Ga0207678_10005791 Ga0207678_100057915 129
385 3300026067 Ga0207678_10019220 Ga0207678_100192205 129
386 3300026067 Ga0207678_10035824 Ga0207678_100358243 129
387 3300026067 Ga0207678_10096435 Ga0207678_100964353 129
388 3300026078 Ga0207702_10036994 Ga0207702_100369943 129
389 3300026078 Ga0207702_10066478 Ga0207702_100664782 129
390 3300026078 Ga0207702_10253583 Ga0207702_102535831 129
391 3300026078 Ga0207702_10782937 Ga0207702_107829372 129
392 3300026088 Ga0207641_10010934 Ga0207641_100109344 129
393 3300026088 Ga0207641_11915060 Ga0207641_119150601 129
394 3300026089 Ga0207648_10089861 Ga0207648_100898613 129
395 3300026095 Ga0207676_11126530 Ga0207676_111265302 129
396 3300026116 Ga0207674_10000060 Ga0207674_1000006095 129
397 3300026116 Ga0207674_10001045 Ga0207674_100010454 129
398 3300026121 Ga0207683_10603785 Ga0207683_106037852 129
399 3300026142 Ga0207698_10002123 Ga0207698_1000212312 129
400 3300026142 Ga0207698_10479946 Ga0207698_104799462 129
401 3300026142 Ga0207698_10526451 Ga0207698_105264512 129
402 3300026142 Ga0207698_10931181 Ga0207698_109311813 129
403 3300028379 Ga0268266_10492862 Ga0268266_104928622 129
404 3300031548 Ga0307408_100073399 Ga0307408_1000733992 129
405 3300031548 Ga0307408_100144372 Ga0307408_1001443723 129
406 3300031548 Ga0307408_100182787 Ga0307408_1001827873 129
407 3300031548 Ga0307408_100358040 Ga0307408_1003580403 129
408 3300031548 Ga0307408_100644515 Ga0307408_1006445152 129
409 3300031548 Ga0307408_101108865 Ga0307408_1011088652 129
410 3300031731 Ga0307405_10065911 Ga0307405_100659112 129
411 3300031731 Ga0307405_10313638 Ga0307405_103136382 129
412 3300031731 Ga0307405_10402832 Ga0307405_104028323 129
413 3300031731 Ga0307405_10490043 Ga0307405_104900432 129
414 3300031731 Ga0307405_10633569 Ga0307405_106335692 129
415 3300031731 Ga0307405_11076922 Ga0307405_110769222 129
416 3300031731 Ga0307405_11186388 Ga0307405_111863881 129
417 3300031731 Ga0307405_11401733 Ga0307405_114017331 129
418 3300031824 Ga0307413_10025770 Ga0307413_100257704 129
419 3300031824 Ga0307413_10042751 Ga0307413_100427514 129
420 3300031824 Ga0307413_10046235 Ga0307413_100462352 129
421 3300031824 Ga0307413_10099182 Ga0307413_100991823 129
422 3300031824 Ga0307413_10147204 Ga0307413_101472042 129
423 3300031824 Ga0307413_10150594 Ga0307413_101505942 129
424 3300031824 Ga0307413_10314043 Ga0307413_103140432 129
425 3300031824 Ga0307413_10354604 Ga0307413_103546043 129
426 3300031824 Ga0307413_10796058 Ga0307413_107960582 129
427 3300031824 Ga0307413_10886884 Ga0307413_108868842 129
428 3300031824 Ga0307413_10990035 Ga0307413_109900351 129
429 3300031824 Ga0307413_11570540 Ga0307413_115705401 129
430 3300031852 Ga0307410_10021654 Ga0307410_100216545 129
431 3300031852 Ga0307410_10052275 Ga0307410_100522755 129
432 3300031852 Ga0307410_10076991 Ga0307410_100769912 129
433 3300031852 Ga0307410_10094200 Ga0307410_100942002 129
434 3300031852 Ga0307410_10119634 Ga0307410_101196342 129
435 3300031852 Ga0307410_10125890 Ga0307410_101258903 129
436 3300031852 Ga0307410_10130197 Ga0307410_101301972 129
437 3300031852 Ga0307410_10233737 Ga0307410_102337372 129
438 3300031852 Ga0307410_10400293 Ga0307410_104002932 129
439 3300031852 Ga0307410_10495898 Ga0307410_104958982 129
440 3300031852 Ga0307410_10549067 Ga0307410_105490672 129
441 3300031901 Ga0307406_10105969 Ga0307406_101059694 129
442 3300031901 Ga0307406_10131021 Ga0307406_101310212 129
443 3300031901 Ga0307406_10562958 Ga0307406_105629582 129
444 3300031901 Ga0307406_10584725 Ga0307406_105847253 129
445 3300031901 Ga0307406_11197787 Ga0307406_111977872 129
446 3300031903 Ga0307407_10024608 Ga0307407_100246082 129
447 3300031903 Ga0307407_10052514 Ga0307407_100525144 129
448 3300031903 Ga0307407_10094056 Ga0307407_100940561 129
449 3300031903 Ga0307407_10248933 Ga0307407_102489333 129
450 3300031903 Ga0307407_11147778 Ga0307407_111477781 129
451 3300031911 Ga0307412_10131901 Ga0307412_101319012 129
452 3300031911 Ga0307412_10211453 Ga0307412_102114531 129
453 3300031911 Ga0307412_10575120 Ga0307412_105751201 129
454 3300031995 Ga0307409_100001336 Ga0307409_1000013366 129
455 3300031995 Ga0307409_100001436 Ga0307409_10000143613 129
456 3300031995 Ga0307409_100011931 Ga0307409_1000119313 129
457 3300031995 Ga0307409_100067286 Ga0307409_1000672863 129
458 3300031995 Ga0307409_100077128 Ga0307409_1000771283 129
459 3300031995 Ga0307409_100180660 Ga0307409_1001806602 129
460 3300031995 Ga0307409_100263605 Ga0307409_1002636052 129
461 3300031995 Ga0307409_100321753 Ga0307409_1003217532 129
462 3300031995 Ga0307409_100426952 Ga0307409_1004269522 129
463 3300031995 Ga0307409_100480410 Ga0307409_1004804103 129
464 3300031995 Ga0307409_100811815 Ga0307409_1008118152 129
465 3300031995 Ga0307409_100906328 Ga0307409_1009063281 129
466 3300031995 Ga0307409_101335962 Ga0307409_1013359622 129
467 3300032002 Ga0307416_100359046 Ga0307416_1003590463 129
468 3300032002 Ga0307416_100376728 Ga0307416_1003767281 129
469 3300032002 Ga0307416_100381713 Ga0307416_1003817132 129
470 3300032002 Ga0307416_100447167 Ga0307416_1004471672 129
471 3300032002 Ga0307416_100548057 Ga0307416_1005480572 129
472 3300032004 Ga0307414_10002795 Ga0307414_100027955 129
473 3300032004 Ga0307414_10095168 Ga0307414_100951684 129
474 3300032004 Ga0307414_10384641 Ga0307414_103846411 129
475 3300032004 Ga0307414_10392965 Ga0307414_103929652 129
476 3300032004 Ga0307414_10440922 Ga0307414_104409224 129
477 3300032004 Ga0307414_10449765 Ga0307414_104497651 129
478 3300032004 Ga0307414_10562254 Ga0307414_105622543 129
479 3300032004 Ga0307414_10579328 Ga0307414_105793282 129
480 3300032004 Ga0307414_10584676 Ga0307414_105846763 129
481 3300032004 Ga0307414_11040741 Ga0307414_110407412 129
482 3300032004 Ga0307414_11781650 Ga0307414_117816501 129
483 3300032005 Ga0307411_10001097 Ga0307411_1000109710 129
484 3300032005 Ga0307411_10089777 Ga0307411_100897773 129
485 3300032005 Ga0307411_10148010 Ga0307411_101480102 129
486 3300032005 Ga0307411_10176629 Ga0307411_101766292 129
487 3300032005 Ga0307411_10408567 Ga0307411_104085672 129
488 3300032005 Ga0307411_10412869 Ga0307411_104128692 129
489 3300032005 Ga0307411_10434704 Ga0307411_104347042 129
490 3300032005 Ga0307411_10434746 Ga0307411_104347461 129
491 3300032005 Ga0307411_10588131 Ga0307411_105881312 129
492 3300032005 Ga0307411_10824668 Ga0307411_108246682 129
493 3300032126 Ga0307415_100105010 Ga0307415_1001050102 129
494 3300032126 Ga0307415_100151160 Ga0307415_1001511602 129
495 3300032126 Ga0307415_100414119 Ga0307415_1004141192 129
496 3300032126 Ga0307415_100631675 Ga0307415_1006316752 129
497 3300032126 Ga0307415_100682764 Ga0307415_1006827643 129
498 3300032126 Ga0307415_100752421 Ga0307415_1007524212 129
499 3300032126 Ga0307415_101854091 Ga0307415_1018540912 129
500 3300032126 Ga0307415_102168136 Ga0307415_1021681361 129
501 3300037312 Ga0395899_0160865 Ga0395899_0160865_222_641 129
502 3300037312 Ga0395899_0433937 Ga0395899_0433937_72_491 129
503 3300037312 Ga0395899_0739996 Ga0395899_0739996_95_511 129
504 3300037418 Ga0395900_0219496 Ga0395900_0219496_852_1271 129
505 3300037418 Ga0395900_0774732 Ga0395900_0774732_430_846 129
506 3300037466 Ga0395898_0572244 Ga0395898_0572244_347_766 129
507 3300037466 Ga0395898_1005541 Ga0395898_1005541_39_458 129
508 3300037466 Ga0395898_1437934 Ga0395898_1437934_83_499 129
509 3300037471 Ga0395905_0023071 Ga0395905_0023071_2138_2554 129
510 3300037471 Ga0395905_0171039 Ga0395905_0171039_129_548 129
511 3300037471 Ga0395905_0522331 Ga0395905_0522331_543_959 129
512 3300037471 Ga0395905_0608631 Ga0395905_0608631_450_869 129
513 3300037471 Ga0395905_0754765 Ga0395905_0754765_126_545 129
514 3300037853 Ga0436364_0730044 Ga0436364_0730044_219_638 129
515 3300038443 Ga0395901_0083658 Ga0395901_0083658_222_641 129
516 3300038443 Ga0395901_0292902 Ga0395901_0292902_577_996 129
517 3300038443 Ga0395901_0835603 Ga0395901_0835603_142_561 129
518 3300038443 Ga0395901_1326756 Ga0395901_1326756_118_537 129
519 3300039437 Ga0436365_0782179 Ga0436365_0782179_7458_7877 129
520 3300042006 Ga0439432_193042 Ga0439432_193042_74_490 129
521 3300044694 Ga0466963_0062297 Ga0466963_0062297_282_698 129
522 3300044694 Ga0466963_0089651 Ga0466963_0089651_722_1141 129
523 3300044842 Ga0466957_0014687 Ga0466957_0014687_2138_2557 129
524 3300044842 Ga0466957_0309141 Ga0466957_0309141_179_595 129
525 3300045836 Ga0466958_0429271 Ga0466958_0429271_393_812 129
526 3300045976 Ga0466967_0400523 Ga0466967_0400523_764_1183 129
527 3300045976 Ga0466967_0448590 Ga0466967_0448590_648_1067 129
528 3300045976 Ga0466967_0943664 Ga0466967_0943664_367_783 129
529 3300046525 Ga0495663_0037275 Ga0495663_0037275_162_578 129
530 3300046616 Ga0495668_0012839 Ga0495668_0012839_1996_2412 129
531 3300046684 Ga0495669_0026739 Ga0495669_0026739_1354_1770 129
532 3300046684 Ga0495669_0261421 Ga0495669_0261421_216_632 129
533 3300046684 Ga0495669_0428186 Ga0495669_0428186_109_525 129
534 3300048904 Ga0496101_0641387 Ga0496101_0641387_169_585 129
535 3300048904 Ga0496101_1182814 Ga0496101_1182814_44_460 129
536 3300048906 Ga0496103_0105275 Ga0496103_0105275_997_1413 129
537 3300048907 Ga0496104_0905989 Ga0496104_0905989_122_538 129
538 3300048908 Ga0496105_0273971 Ga0496105_0273971_67_483 129
539 3300048909 Ga0496106_0140628 Ga0496106_0140628_453_869 129
540 3300048909 Ga0496106_1584151 Ga0496106_1584151_35_451 129
541 3300048910 Ga0496107_0008391 Ga0496107_0008391_5904_6320 129
542 3300048910 Ga0496107_0104292 Ga0496107_0104292_1429_1845 129
543 3300048910 Ga0496107_0384639 Ga0496107_0384639_468_890 129
544 3300048911 Ga0496108_0013860 Ga0496108_0013860_6119_6535 129
545 3300048912 Ga0496109_0005611 Ga0496109_0005611_9874_10290 129
546 3300048912 Ga0496109_0143560 Ga0496109_0143560_282_698 129
547 3300048913 Ga0496110_0006066 Ga0496110_0006066_7106_7522 129
548 3300048914 Ga0496111_0000920 Ga0496111_0000920_9806_10222 129
549 3300048914 Ga0496111_0125577 Ga0496111_0125577_47_463 129
550 3300048915 Ga0496112_0502322 Ga0496112_0502322_711_1130 129
551 3300048916 Ga0496113_0115111 Ga0496113_0115111_1247_1663 129
552 3300048917 Ga0496114_0301083 Ga0496114_0301083_14_430 129
553 3300049583 Ga0501067_0144695 Ga0501067_0144695_816_1232 129
554 3300049585 Ga0501069_0109149 Ga0501069_0109149_36_452 129
555 3300049587 Ga0501071_1501712 Ga0501071_1501712_83_499 129
556 3300049667 Ga0501230_018101 Ga0501230_018101_396_812 129
557 3300049679 Ga0501249_011547 Ga0501249_011547_180_596 129
558 3300049769 Ga0501272_063141 Ga0501272_063141_76_492 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

58

147

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cyt-assembly1.cif.gz_R refinement of myoglobin and cytochrome c 0.6978 37 129
4ged-assembly1.cif.gz_B crystal structure of the leishmania major peroxidase-cytochrome c complex 0.6973 37 124
1i55-assembly1.cif.gz_A cytochrome c (tuna) with 2zn:1fe mixed-metal porphyrins 0.6918 37 129
5c9m-assembly1.cif.gz_A the structure of oxidized rat cytochrome c (t28a) at 1.362 angstroms resolution. 0.6908 37 124
1ql3-assembly1.cif.gz_A structure of the soluble domain of cytochrome c552 from paracoccus denitrificans in the reduced state 0.6849 37 124
ID Description Score Start End Superfamily
1ql3A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6849 37 124 1.10.760.10
1hroB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6827 37 124 1.10.760.10
1i6dA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6743 37 124 1.10.760.10
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.6717 32 129 2.60.40.420
5cieD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6701 37 124 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A440JNU8-F1-model_v4 deleted 0.946 74 125
AF-A0A068SSU2-F1-model_v4 Cytochrome c domain-containing protein 0.9205 71 125 GO:0009055
GO:0020037
AF-A0A7W1HUZ2-F1-model_v4 C-type cytochrome 0.8733 8 127 GO:0009055
GO:0020037
GO:0046872
AF-A0A440JNU8-F1-model_v4 deleted 0.8676 74 125
AF-A0A2G5QPT1-F1-model_v4 Cytochrome C 0.8638 8 127 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
77.22 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map