F463440

General Info

Members Datasets Scaffolds Average Seq Length
558 267 445 118

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10993131|Ga0157373_109931311
Length 129
Sequence VIFEESVVRKLVWMVAALALAGCGEGKSVDAQKPKTAVTAAPAAASAPQWDLEVRGETPQAVSDLSGWLIEHAFVPTVIKDSSGKTRILIGPFNSQADAQARKVQVDAALVKAKKQNIESVIVEHPLAP

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231011 Pseudomonas sp. GM30 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231015 Pseudomonas sp. GM49 Isolate Nodule
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231018 Pseudomonas sp. GM60 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2511231020 Pseudomonas sp. GM74 Isolate Nodule
12 2511231021 Pseudomonas sp. GM78 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2511231023 Pseudomonas sp. GM80 Isolate Nodule
15 2511231031 Pseudomonas sp. GM16 Isolate Nodule
16 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
17 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
18 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
19 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
20 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
21 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
22 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
23 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
24 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
25 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
26 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
27 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
28 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
29 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
30 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
31 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
32 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
33 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
34 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
35 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
36 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
37 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
38 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
39 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
40 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
41 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
42 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
43 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
44 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
45 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
46 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
47 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
48 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
49 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
50 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
51 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
52 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
53 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
54 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
55 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
56 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
57 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
58 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
59 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
60 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
61 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
62 2773857670 Pseudomonas sp. 478 Isolate Unclassified
63 2773857673 Pseudomonas sp. 443 Isolate Unclassified
64 2784132063 Pseudomonas sp. 424 Isolate Unclassified
65 2784132072 Pseudomonas sp. 460 Isolate Unclassified
66 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
67 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
68 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
69 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
70 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
71 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
72 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
73 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
74 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
75 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
76 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
77 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
78 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
79 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
80 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
81 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
82 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
83 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
84 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
85 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
86 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
87 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
88 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
89 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
90 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
91 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
92 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
93 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
94 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
95 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
96 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
97 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
98 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
99 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
100 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
101 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
102 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
103 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
104 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
105 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
106 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
107 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
108 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
109 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
110 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
111 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
112 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
113 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
148 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
157 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
160 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
163 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
164 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
165 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
166 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
167 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
168 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
169 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
170 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
171 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
172 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
173 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
174 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
175 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
178 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
182 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
183 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
184 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
234 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
254 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
255 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
256 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
261 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
262 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
263 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
264 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
265 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
266 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
267 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.75
Metatranscriptomes 0
Isolates 20.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 2.69
Rhizoplane 5.91
Rhizosphere 79.21
Stem 0
Stem Tuber 0
Unclassified 9.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5182 2124908027 Bacteria 1785
2 JGI25164J39214_1000566 3300002772 Bacteria 16711
3 JGI25165J46597_1000954 3300003214 Bacteria 19739
4 Ga0055530_10001894 3300003791 Bacteria 14345
5 Ga0055540_1001402 3300003792 Bacteria 14380
6 Ga0065714_10006297 3300005288 Bacteria 4997
7 Ga0065714_10006952 3300005288 Bacteria 4837
8 Ga0065714_10035918 3300005288 Bacteria 1014
9 Ga0065714_10080522 3300005288 Bacteria 2427
10 Ga0070669_100054018 3300005353 Bacteria 2941
11 Ga0070665_100080565 3300005548 Bacteria 3261
12 Ga0075432_10000189 3300006058 Bacteria 15887
13 Ga0075432_10000550 3300006058 Bacteria 11301
14 Ga0075432_10023108 3300006058 Bacteria 2129
15 Ga0105251_10032165 3300009011 Bacteria 2617
16 Ga0105251_10034817 3300009011 Bacteria 2489
17 Ga0105251_10066749 3300009011 Bacteria 1681
18 Ga0105251_10297871 3300009011 Bacteria 731
19 Ga0105244_10002352 3300009036 Bacteria 14359
20 Ga0105244_10072502 3300009036 Bacteria 1716
21 Ga0105244_10264653 3300009036 Bacteria 800
22 Ga0105244_10309511 3300009036 Bacteria 730
23 Ga0105250_10023538 3300009092 Bacteria 2482
24 Ga0105250_10025362 3300009092 Bacteria 2389
25 Ga0105250_10061463 3300009092 Bacteria 1510
26 Ga0105243_10003156 3300009148 Bacteria 13519
27 Ga0105246_10001149 3300011119 Bacteria 15343
28 Ga0105246_10013835 3300011119 Bacteria 5064
29 Ga0105246_10659116 3300011119 Bacteria 912
30 Ga0157345_1000071 3300012498 Bacteria 21085
31 Ga0157373_10002465 3300013100 Bacteria 14101
32 Ga0157373_10533349 3300013100 Bacteria 850
33 Ga0157373_10993131 3300013100 Bacteria 626
34 Ga0157371_10308979 3300013102 Bacteria 1146
35 Ga0157370_10149281 3300013104 Bacteria 2175
36 Ga0157370_10155828 3300013104 Bacteria 2125
37 Ga0157370_11477583 3300013104 Bacteria 611
38 Ga0157369_10029284 3300013105 Bacteria 6086
39 Ga0163162_11787093 3300013306 Bacteria 703
40 Ga0157375_10161927 3300013308 Bacteria 2380
41 Ga0157375_11018481 3300013308 Bacteria 967
42 Ga0182008_10017337 3300014497 Bacteria 3737
43 Ga0182008_10019002 3300014497 Bacteria 3552
44 Ga0182008_10035532 3300014497 Bacteria 2495
45 Ga0182008_10420676 3300014497 Bacteria 721
46 Ga0182006_1000969 3300015261 Bacteria 19011
47 Ga0182006_1084504 3300015261 Bacteria 1152
48 Ga0182006_1188502 3300015261 Bacteria 686
49 Ga0182007_10000713 3300015262 Bacteria 18882
50 Ga0182005_1000562 3300015265 Bacteria 18545
51 Ga0182005_1001332 3300015265 Bacteria 10084
52 Ga0182005_1039321 3300015265 Bacteria 1286
53 Ga0182005_1065976 3300015265 Bacteria 991
54 Ga0182005_1067295 3300015265 Bacteria 982
55 Ga0182005_1275957 3300015265 Bacteria 526
56 Ga0163161_10004750 3300017792 Bacteria 9451
57 Ga0163161_10017430 3300017792 Bacteria 5026
58 Ga0163161_10091277 3300017792 Bacteria 2254
59 Ga0163161_10127447 3300017792 Bacteria 1918
60 Ga0209563_100231 3300025230 Bacteria 27006
61 Ga0209675_1012566 3300025291 Bacteria 2716
62 Ga0209676_1008233 3300025292 Bacteria 4693
63 Ga0209050_1000079 3300025298 Bacteria 277803
64 Ga0209051_1000054 3300025303 Bacteria 280804
65 Ga0209257_1008187 3300025304 Bacteria 6045
66 Ga0207696_1001354 3300025711 Bacteria 13460
67 Ga0207696_1018791 3300025711 Bacteria 2263
68 Ga0207696_1034399 3300025711 Bacteria 1514
69 Ga0207655_1000085 3300025728 Bacteria 206425
70 Ga0207655_1000141 3300025728 Bacteria 138956
71 Ga0207655_1015180 3300025728 Bacteria 4299
72 Ga0207655_1034978 3300025728 Bacteria 2251
73 Ga0207655_1098158 3300025728 Bacteria 1015
74 Ga0207713_1001887 3300025735 Bacteria 15914
75 Ga0207713_1005230 3300025735 Bacteria 8182
76 Ga0207713_1013475 3300025735 Bacteria 4305
77 Ga0207713_1057644 3300025735 Bacteria 1500
78 Ga0207681_10024836 3300025923 Bacteria 3848
79 Ga0207664_10467663 3300025929 Bacteria 1127
80 Ga0207709_10000089 3300025935 Bacteria 149139
81 Ga0209281_1007450 3300027111 Bacteria 2746
82 Ga0207428_10059153 3300027907 Bacteria 3039
83 Ga0207428_10079109 3300027907 Bacteria 2571
84 Ga0207428_10102223 3300027907 Bacteria 2214
85 Ga0207428_10206479 3300027907 Bacteria 1477
86 Ga0207428_11299668 3300027907 Bacteria 504
87 Ga0268266_10014302 3300028379 Bacteria 6825
88 Ga0316177_1211963 3300030731 Bacteria 1136
89 Ga0316181_1234210 3300030744 Bacteria 1599
90 Ga0307408_100166203 3300031548 Bacteria 1757
91 Ga0307516_10146655 3300031730 Bacteria 2125
92 Ga0307405_11261219 3300031731 Bacteria 641
93 Ga0307412_10049056 3300031911 Bacteria 2780
94 Ga0307412_10069970 3300031911 Bacteria 2390
95 Ga0307414_10068418 3300032004 Bacteria 2548
96 Ga0307411_10085840 3300032005 Bacteria 2181
97 Ga0307510_10003652 3300033180 Bacteria 17966
98 Ga0307510_10607664 3300033180 Bacteria 546
99 Ga0237819_01044 3300038705 Bacteria 8240
100 Ga0439438_006274 3300041405 Bacteria 4224
101 Ga0439438_006738 3300041405 Bacteria 4009
102 Ga0439438_072252 3300041405 Bacteria 853
103 Ga0439438_155208 3300041405 Bacteria 545
104 Ga0439447_003238 3300041407 Bacteria 5792
105 Ga0439447_008853 3300041407 Bacteria 3090
106 Ga0439447_010917 3300041407 Bacteria 2675
107 Ga0439447_068649 3300041407 Bacteria 826
108 Ga0439447_077397 3300041407 Bacteria 769
109 Ga0439461_0107114 3300041410 Bacteria 686
110 Ga0439466_0000438 3300041411 Bacteria 15873
111 Ga0439466_0001566 3300041411 Bacteria 8934
112 Ga0439466_0009010 3300041411 Bacteria 3747
113 Ga0439466_0013948 3300041411 Bacteria 2934
114 Ga0439466_0041857 3300041411 Bacteria 1527
115 Ga0439466_0068267 3300041411 Bacteria 1136
116 Ga0439432_001390 3300042006 Bacteria 9142
117 Ga0439432_012947 3300042006 Bacteria 2841
118 Ga0439432_091460 3300042006 Bacteria 915
119 Ga0439432_106695 3300042006 Bacteria 835
120 Ga0439451_003459 3300042009 Bacteria 3200
121 Ga0439452_000473 3300042010 Bacteria 22581
122 Ga0439452_000565 3300042010 Bacteria 19364
123 Ga0439452_002595 3300042010 Bacteria 6624
124 Ga0439452_009290 3300042010 Bacteria 2903
125 Ga0439452_031549 3300042010 Bacteria 1299
126 Ga0439452_098400 3300042010 Bacteria 629
127 Ga0439456_002521 3300042013 Bacteria 3689
128 Ga0439456_047832 3300042013 Bacteria 933
129 Ga0439456_065132 3300042013 Bacteria 804
130 Ga0439456_065949 3300042013 Bacteria 799
131 Ga0439463_017917 3300042016 Bacteria 1760
132 Ga0439463_029947 3300042016 Bacteria 1371
133 Ga0450919_005108 3300042121 Bacteria 1584
134 Ga0450890_000686 3300042127 Bacteria 4922
135 Ga0450892_040175 3300042130 Bacteria 513
136 Ga0450900_040221 3300042136 Bacteria 698
137 Ga0450902_005769 3300042137 Bacteria 1883
138 Ga0450902_017266 3300042137 Bacteria 1178
139 Ga0450903_004501 3300042138 Bacteria 2376
140 Ga0450903_019360 3300042138 Bacteria 1055
141 Ga0450904_001613 3300042139 Bacteria 3055
142 Ga0450904_004983 3300042139 Bacteria 1361
143 Ga0450904_026792 3300042139 Bacteria 596
144 Ga0450905_007493 3300042142 Bacteria 1487
145 Ga0450906_000932 3300042145 Bacteria 6405
146 Ga0450907_000936 3300042146 Bacteria 6937
147 Ga0439446_0001054 3300042156 Bacteria 6068
148 Ga0450908_008146 3300042184 Bacteria 1966
149 Ga0450908_038835 3300042184 Bacteria 825
150 Ga0450909_025603 3300042185 Bacteria 888
151 Ga0439434_0006785 3300042435 Bacteria 3346
152 Ga0439460_0002461 3300042461 Bacteria 4464
153 Ga0450893_0004246 3300042532 Bacteria 2281
154 Ga0450901_002451 3300042533 Bacteria 1999
155 Ga0439440_0000659 3300042993 Bacteria 5888
156 Ga0495617_016819 3300046452 Bacteria 2473
157 Ga0495617_024799 3300046452 Bacteria 2023
158 Ga0495617_040856 3300046452 Bacteria 1550
159 Ga0495617_119469 3300046452 Bacteria 849
160 Ga0495617_153744 3300046452 Bacteria 731
161 Ga0495627_000818 3300046453 Bacteria 22733
162 Ga0495627_001538 3300046453 Bacteria 13202
163 Ga0495627_006388 3300046453 Bacteria 4624
164 Ga0495627_035046 3300046453 Bacteria 1565
165 Ga0495627_092821 3300046453 Bacteria 866
166 Ga0495627_140243 3300046453 Bacteria 677
167 Ga0495627_146014 3300046453 Bacteria 661
168 Ga0495603_0402451 3300046455 Bacteria 785
169 Ga0495603_0769462 3300046455 Bacteria 549
170 Ga0495590_0109481 3300046457 Bacteria 985
171 Ga0495591_001682 3300046458 Bacteria 13221
172 Ga0495591_002008 3300046458 Bacteria 11854
173 Ga0495591_011740 3300046458 Bacteria 3296
174 Ga0495591_014382 3300046458 Bacteria 2848
175 Ga0495591_024861 3300046458 Bacteria 1889
176 Ga0495591_040022 3300046458 Bacteria 1338
177 Ga0495591_044675 3300046458 Bacteria 1239
178 Ga0495638_0000412 3300046460 Bacteria 52337
179 Ga0495638_0015010 3300046460 Bacteria 5214
180 Ga0495638_0019340 3300046460 Bacteria 4505
181 Ga0495638_0050420 3300046460 Bacteria 2599
182 Ga0495638_0061174 3300046460 Bacteria 2327
183 Ga0495638_0070553 3300046460 Bacteria 2139
184 Ga0495638_0107441 3300046460 Bacteria 1661
185 Ga0495638_0181555 3300046460 Bacteria 1200
186 Ga0495638_0225808 3300046460 Bacteria 1044
187 Ga0495638_0347182 3300046460 Bacteria 785
188 Ga0495650_0009065 3300046471 Bacteria 5708
189 Ga0495650_0022700 3300046471 Bacteria 3005
190 Ga0495650_0072852 3300046471 Bacteria 1343
191 Ga0495650_0073169 3300046471 Bacteria 1339
192 Ga0495650_0080893 3300046471 Bacteria 1252
193 Ga0495580_0291742 3300046472 Bacteria 1112
194 Ga0495582_0915274 3300046473 Bacteria 507
195 Ga0495605_0001458 3300046474 Bacteria 15455
196 Ga0495605_0024411 3300046474 Bacteria 3163
197 Ga0495605_0041318 3300046474 Bacteria 2297
198 Ga0495605_0100824 3300046474 Bacteria 1327
199 Ga0495605_0178961 3300046474 Bacteria 933
200 Ga0495605_0214733 3300046474 Bacteria 833
201 Ga0495639_0000032 3300046475 Bacteria 64548
202 Ga0495584_0000328 3300046491 Bacteria 33188
203 Ga0495584_0000732 3300046491 Bacteria 21660
204 Ga0495584_0025901 3300046491 Bacteria 2972
205 Ga0495584_0068670 3300046491 Bacteria 1780
206 Ga0495584_0072912 3300046491 Bacteria 1725
207 Ga0495584_0089862 3300046491 Bacteria 1548
208 Ga0495584_0091016 3300046491 Bacteria 1539
209 Ga0495584_0321643 3300046491 Bacteria 785
210 Ga0495585_0001070 3300046492 Bacteria 22591
211 Ga0495585_0001824 3300046492 Bacteria 16125
212 Ga0495585_0002099 3300046492 Bacteria 14581
213 Ga0495585_0011871 3300046492 Bacteria 5145
214 Ga0495585_0038416 3300046492 Bacteria 2695
215 Ga0495585_0058339 3300046492 Bacteria 2129
216 Ga0495585_0111108 3300046492 Bacteria 1457
217 Ga0495585_0133415 3300046492 Bacteria 1305
218 Ga0495585_0615381 3300046492 Bacteria 510
219 Ga0495594_0122640 3300046499 Bacteria 1469
220 Ga0495596_0010404 3300046500 Bacteria 4051
221 Ga0495596_0062411 3300046500 Bacteria 1450
222 Ga0495607_0007020 3300046501 Bacteria 7833
223 Ga0495607_0008932 3300046501 Bacteria 6821
224 Ga0495607_0019597 3300046501 Bacteria 4295
225 Ga0495607_0044171 3300046501 Bacteria 2628
226 Ga0495607_0062123 3300046501 Bacteria 2119
227 Ga0495607_0066785 3300046501 Bacteria 2022
228 Ga0495583_0002630 3300046506 Bacteria 15012
229 Ga0495583_0003057 3300046506 Bacteria 13292
230 Ga0495583_0009696 3300046506 Bacteria 5720
231 Ga0495606_0005384 3300046507 Bacteria 12273
232 Ga0495606_0006246 3300046507 Bacteria 11060
233 Ga0495606_0032549 3300046507 Bacteria 3610
234 Ga0495606_0051633 3300046507 Bacteria 2680
235 Ga0495606_0052958 3300046507 Bacteria 2635
236 Ga0495606_0106205 3300046507 Bacteria 1700
237 Ga0495606_0115186 3300046507 Bacteria 1616
238 Ga0495610_0003088 3300046512 Bacteria 13294
239 Ga0495610_0010725 3300046512 Bacteria 5667
240 Ga0495610_0038080 3300046512 Bacteria 2442
241 Ga0495610_0045966 3300046512 Bacteria 2157
242 Ga0495616_0001762 3300046513 Bacteria 14733
243 Ga0495616_0022207 3300046513 Bacteria 3427
244 Ga0495616_0034101 3300046513 Bacteria 2646
245 Ga0495616_0044347 3300046513 Bacteria 2255
246 Ga0495616_0087979 3300046513 Bacteria 1475
247 Ga0495616_0096518 3300046513 Bacteria 1391
248 Ga0495616_0209404 3300046513 Bacteria 853
249 Ga0495620_0001050 3300046515 Bacteria 16934
250 Ga0495620_0009335 3300046515 Bacteria 5222
251 Ga0495620_0070046 3300046515 Bacteria 1437
252 Ga0495620_0096249 3300046515 Bacteria 1183
253 Ga0495631_0000738 3300046518 Bacteria 21019
254 Ga0495631_0052045 3300046518 Bacteria 1788
255 Ga0495631_0070388 3300046518 Bacteria 1512
256 Ga0495631_0162747 3300046518 Bacteria 957
257 Ga0495632_0001580 3300046519 Bacteria 18777
258 Ga0495632_0002160 3300046519 Bacteria 15194
259 Ga0495632_0009081 3300046519 Bacteria 6019
260 Ga0495632_0024798 3300046519 Bacteria 3180
261 Ga0495632_0027336 3300046519 Bacteria 2989
262 Ga0495632_0045015 3300046519 Bacteria 2200
263 Ga0495637_0001933 3300046520 Bacteria 11751
264 Ga0495637_0002081 3300046520 Bacteria 11257
265 Ga0495637_0007978 3300046520 Bacteria 5214
266 Ga0495637_0011016 3300046520 Bacteria 4355
267 Ga0495637_0017612 3300046520 Bacteria 3325
268 Ga0495637_0018278 3300046520 Bacteria 3253
269 Ga0495637_0027577 3300046520 Bacteria 2539
270 Ga0495637_0047309 3300046520 Bacteria 1816
271 Ga0495643_0010756 3300046522 Bacteria 5618
272 Ga0495643_0022780 3300046522 Bacteria 3567
273 Ga0495643_0039477 3300046522 Bacteria 2581
274 Ga0495643_0051908 3300046522 Bacteria 2204
275 Ga0495643_0234865 3300046522 Bacteria 863
276 Ga0495644_0000355 3300046523 Bacteria 20713
277 Ga0495644_0084787 3300046523 Bacteria 1194
278 Ga0495644_0114212 3300046523 Bacteria 1025
279 Ga0495648_0000074 3300046524 Bacteria 129886
280 Ga0495648_0002613 3300046524 Bacteria 16446
281 Ga0495648_0007728 3300046524 Bacteria 8563
282 Ga0495648_0031588 3300046524 Bacteria 3484
283 Ga0495648_0084892 3300046524 Bacteria 1790
284 Ga0495648_0123116 3300046524 Bacteria 1390
285 Ga0495648_0337750 3300046524 Bacteria 692
286 Ga0495666_0035969 3300046526 Bacteria 2412
287 Ga0495654_0002011 3300046530 Bacteria 13387
288 Ga0495654_0011542 3300046530 Bacteria 4777
289 Ga0495654_0060738 3300046530 Bacteria 1816
290 Ga0495654_0073799 3300046530 Bacteria 1612
291 Ga0495654_0078885 3300046530 Bacteria 1547
292 Ga0495654_0083923 3300046530 Bacteria 1488
293 Ga0495654_0139076 3300046530 Bacteria 1083
294 Ga0495654_0255882 3300046530 Bacteria 727
295 Ga0495654_0406445 3300046530 Bacteria 540
296 Ga0495609_0002470 3300046538 Bacteria 11358
297 Ga0495609_0006420 3300046538 Bacteria 5999
298 Ga0495609_0045918 3300046538 Bacteria 1956
299 Ga0495609_0046775 3300046538 Bacteria 1937
300 Ga0495609_0063010 3300046538 Bacteria 1636
301 Ga0495597_0000602 3300046542 Bacteria 29457
302 Ga0495597_0008470 3300046542 Bacteria 5154
303 Ga0495597_0008755 3300046542 Bacteria 5055
304 Ga0495597_0017036 3300046542 Bacteria 3425
305 Ga0495597_0021180 3300046542 Bacteria 3023
306 Ga0495622_0000657 3300046557 Bacteria 19582
307 Ga0495622_0065627 3300046557 Bacteria 1678
308 Ga0495633_0467667 3300046558 Bacteria 569
309 Ga0495668_0001693 3300046616 Bacteria 20395
310 Ga0495668_0172915 3300046616 Bacteria 1183
311 Ga0495668_0311910 3300046616 Bacteria 862
312 Ga0495668_0375439 3300046616 Bacteria 781
313 Ga0495668_0577838 3300046616 Bacteria 620
314 Ga0495611_0000391 3300046648 Bacteria 27614
315 Ga0495611_0056211 3300046648 Bacteria 1781
316 Ga0495611_0056781 3300046648 Bacteria 1773
317 Ga0495625_0001906 3300046660 Bacteria 23574
318 Ga0495625_0002566 3300046660 Bacteria 19514
319 Ga0495625_0123998 3300046660 Bacteria 1755
320 Ga0495625_0147772 3300046660 Bacteria 1581
321 Ga0495625_0170907 3300046660 Bacteria 1451
322 Ga0495625_0318348 3300046660 Bacteria 991
323 Ga0495625_0477863 3300046660 Bacteria 765
324 Ga0495659_0000227 3300046664 Bacteria 23762
325 Ga0495659_0048766 3300046664 Bacteria 1535
326 Ga0495659_0355647 3300046664 Bacteria 626
327 Ga0495661_0008772 3300046665 Bacteria 6977
328 Ga0495661_0093222 3300046665 Bacteria 1709
329 Ga0495661_0125668 3300046665 Bacteria 1412
330 Ga0495661_0141650 3300046665 Bacteria 1307
331 Ga0495670_0000329 3300046691 Bacteria 22647
332 Ga0495670_0000721 3300046691 Bacteria 15760
333 Ga0495670_0016605 3300046691 Bacteria 3620
334 Ga0495670_0032053 3300046691 Bacteria 2612
335 Ga0495670_0505629 3300046691 Bacteria 656
336 Ga0495671_0000996 3300046692 Bacteria 19740
337 Ga0495671_0010143 3300046692 Bacteria 5235
338 Ga0495671_0012943 3300046692 Bacteria 4539
339 Ga0495671_0014695 3300046692 Bacteria 4207
340 Ga0495671_0043093 3300046692 Bacteria 2265
341 Ga0495671_0050798 3300046692 Bacteria 2063
342 Ga0495649_0002054 3300046694 Bacteria 14488
343 Ga0495649_0002056 3300046694 Bacteria 14478
344 Ga0495649_0002115 3300046694 Bacteria 14257
345 Ga0495649_0039275 3300046694 Bacteria 2595
346 Ga0495649_0043365 3300046694 Bacteria 2455
347 Ga0495649_0110394 3300046694 Bacteria 1458
348 Ga0495649_0220026 3300046694 Bacteria 982
349 Ga0495589_0011847 3300046794 Bacteria 4524
350 Ga0495589_0022786 3300046794 Bacteria 3193
351 Ga0495589_0139766 3300046794 Bacteria 1160
352 Ga0495589_0378694 3300046794 Bacteria 650
353 Ga0495660_0022275 3300046810 Bacteria 3617
354 Ga0495660_0039618 3300046810 Bacteria 2616
355 Ga0495660_0042479 3300046810 Bacteria 2512
356 Ga0495660_0043072 3300046810 Bacteria 2491
357 Ga0495660_0083918 3300046810 Bacteria 1666
358 Ga0495660_0086946 3300046810 Bacteria 1631
359 Ga0495660_0098582 3300046810 Bacteria 1507
360 Ga0495660_0100046 3300046810 Bacteria 1494
361 Ga0495660_0141122 3300046810 Bacteria 1198
362 Ga0495581_0521296 3300047315 Bacteria 690
363 Ga0495636_0143496 3300047318 Bacteria 1067
364 Ga0495672_0017035 3300047320 Bacteria 4867
365 Ga0495672_0186764 3300047320 Bacteria 1045
366 Ga0495672_0195795 3300047320 Bacteria 1013
367 Ga0495672_0199845 3300047320 Bacteria 1000
368 Ga0495676_0001991 3300047321 Bacteria 17975
369 Ga0495683_0003781 3300047323 Bacteria 8743
370 Ga0495683_0004343 3300047323 Bacteria 8080
371 Ga0495683_0041725 3300047323 Bacteria 2314
372 Ga0495683_0147674 3300047323 Bacteria 1097
373 Ga0495687_003224 3300047443 Bacteria 12060
374 Ga0495679_000856 3300047446 Bacteria 19247
375 Ga0495679_001532 3300047446 Bacteria 13060
376 Ga0495679_020047 3300047446 Bacteria 2335
377 Ga0495679_042146 3300047446 Bacteria 1409
378 Ga0495685_202828 3300047447 Bacteria 635
379 Ga0495673_0002401 3300047469 Bacteria 13204
380 Ga0495673_0002697 3300047469 Bacteria 12213
381 Ga0495673_0031221 3300047469 Bacteria 2495
382 Ga0495673_0061208 3300047469 Bacteria 1612
383 Ga0495673_0276215 3300047469 Bacteria 607
384 Ga0495681_0002606 3300047470 Bacteria 12804
385 Ga0495681_0005270 3300047470 Bacteria 8682
386 Ga0495681_0007114 3300047470 Bacteria 7216
387 Ga0495681_0008823 3300047470 Bacteria 6272
388 Ga0495681_0010384 3300047470 Bacteria 5637
389 Ga0495681_0018824 3300047470 Bacteria 3790
390 Ga0495681_0023971 3300047470 Bacteria 3226
391 Ga0495681_0046781 3300047470 Bacteria 2060
392 Ga0495681_0089546 3300047470 Bacteria 1361
393 Ga0495681_0125090 3300047470 Bacteria 1099
394 Ga0495686_0001725 3300047472 Bacteria 22504
395 Ga0495686_0008731 3300047472 Bacteria 7394
396 Ga0495686_0168592 3300047472 Bacteria 1274
397 Ga0495686_0642175 3300047472 Bacteria 546
398 Ga0495593_0008370 3300047673 Bacteria 6018
399 Ga0495626_0002064 3300048091 Bacteria 14663
400 Ga0495626_0002224 3300048091 Bacteria 13911
401 Ga0495626_0002369 3300048091 Bacteria 13200
402 Ga0495626_0002605 3300048091 Bacteria 12318
403 Ga0495626_0030720 3300048091 Bacteria 2589
404 Ga0495626_0036942 3300048091 Bacteria 2324
405 Ga0495626_0236595 3300048091 Bacteria 736
406 Ga0496106_0017426 3300048909 Bacteria 5315
407 Ga0496107_0143443 3300048910 Bacteria 1765
408 Ga0496110_0200844 3300048913 Bacteria 1811
409 Ga0496116_0002857 3300048919 Bacteria 17698
410 Ga0496116_0003192 3300048919 Bacteria 16397
411 Ga0496116_0009288 3300048919 Bacteria 8401
412 Ga0496117_0044303 3300048920 Bacteria 3224
413 Ga0496117_0088766 3300048920 Bacteria 1999
414 Ga0496117_0195711 3300048920 Bacteria 1147
415 Ga0496118_0034444 3300048921 Bacteria 4130
416 Ga0496118_0050621 3300048921 Bacteria 3186
417 Ga0496118_0205457 3300048921 Bacteria 1161
418 Ga0496118_0502462 3300048921 Bacteria 602
419 Ga0496119_0082451 3300048922 Bacteria 1849
420 Ga0496120_0074809 3300048923 Bacteria 1849
421 Ga0496121_0004635 3300048924 Bacteria 18285
422 Ga0496122_0003890 3300048925 Bacteria 19135
423 Ga0496122_0176144 3300048925 Bacteria 1281
424 Ga0496123_0024286 3300048926 Bacteria 4611
425 Ga0496123_0054121 3300048926 Bacteria 2645
426 Ga0496124_0140317 3300048927 Bacteria 1908
427 Ga0496124_0427392 3300048927 Bacteria 910
428 Ga0496124_0677074 3300048927 Bacteria 658
429 Ga0496126_0692165 3300048929 Bacteria 793
430 Ga0495678_000886 3300049459 Bacteria 26599
431 Ga0495678_002299 3300049459 Bacteria 13202
432 Ga0495678_014139 3300049459 Bacteria 3719
433 Ga0495678_021113 3300049459 Bacteria 2872
434 Ga0495678_025829 3300049459 Bacteria 2516
435 Ga0495678_044207 3300049459 Bacteria 1763
436 Ga0495678_058972 3300049459 Bacteria 1449
437 Ga0495678_196262 3300049459 Bacteria 624
438 Ga0495682_0041450 3300049460 Bacteria 1687
439 Ga0495682_0133997 3300049460 Bacteria 885
440 Ga0501241_000618 3300049758 Bacteria 7636
441 Ga0501269_004511 3300049766 Bacteria 1675
442 nmdc:mga03683_421795_c1 3300050489 Bacteria 639
443 nmdc:mga00v17_301814_c1 3300050491 Bacteria 1040
444 nmdc:mga00v17_702952_c1 3300050491 Bacteria 648
445 Ga0500568_0176642 3300053139 Bacteria 785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030731 Ga0316177_1211963 Ga0316177_12119631 96
2 3300009011 Ga0105251_10032165 Ga0105251_100321654 100
3 3300009092 Ga0105250_10025362 Ga0105250_100253621 100
4 3300015265 Ga0182005_1067295 Ga0182005_10672952 100
5 3300025711 Ga0207696_1018791 Ga0207696_10187914 100
6 3300025735 Ga0207713_1005230 Ga0207713_10052306 100
7 3300049459 Ga0495678_021113 Ga0495678_021113_140_550 100
8 3300002772 JGI25164J39214_1000566 JGI25164J39214_100056617 101
9 3300003214 JGI25165J46597_1000954 JGI25165J46597_10009549 101
10 3300003791 Ga0055530_10001894 Ga0055530_1000189415 102
11 3300003792 Ga0055540_1001402 Ga0055540_100140215 102
12 3300025292 Ga0209676_1008233 Ga0209676_10082335 102
13 3300025298 Ga0209050_1000079 Ga0209050_100007915 102
14 3300025303 Ga0209051_1000054 Ga0209051_100005418 102
15 3300025304 Ga0209257_1008187 Ga0209257_10081874 102
16 3300013104 Ga0157370_10149281 Ga0157370_101492814 104
17 3300015265 Ga0182005_1039321 Ga0182005_10393211 104
18 3300015265 Ga0182005_1065976 Ga0182005_10659761 104
19 3300025929 Ga0207664_10467663 Ga0207664_104676632 104
20 3300046692 Ga0495671_0014695 Ga0495671_0014695_2728_3114 104
21 3300031730 Ga0307516_10146655 Ga0307516_101466553 106
22 3300047323 Ga0495683_0041725 Ga0495683_0041725_1713_2084 106
23 3300027907 Ga0207428_10102223 Ga0207428_101022232 107
24 3300046507 Ga0495606_0006246 Ga0495606_0006246_2654_3064 107
25 3300046520 Ga0495637_0011016 Ga0495637_0011016_2309_2719 107
26 3300047321 Ga0495676_0001991 Ga0495676_0001991_11895_12263 107
27 3300030744 Ga0316181_1234210 Ga0316181_12342103 108
28 3300031731 Ga0307405_11261219 Ga0307405_112612191 108
29 3300046452 Ga0495617_153744 Ga0495617_153744_276_632 108
30 3300046453 Ga0495627_092821 Ga0495627_092821_259_615 108
31 3300046460 Ga0495638_0019340 Ga0495638_0019340_1479_1835 108
32 3300046460 Ga0495638_0061174 Ga0495638_0061174_1740_2096 108
33 3300046491 Ga0495584_0000328 Ga0495584_0000328_24128_24484 108
34 3300046492 Ga0495585_0002099 Ga0495585_0002099_2810_3166 108
35 3300046512 Ga0495610_0010725 Ga0495610_0010725_2621_2977 108
36 3300046519 Ga0495632_0027336 Ga0495632_0027336_1801_2157 108
37 3300046522 Ga0495643_0051908 Ga0495643_0051908_1221_1577 108
38 3300046542 Ga0495597_0008755 Ga0495597_0008755_1393_1749 108
39 3300046665 Ga0495661_0125668 Ga0495661_0125668_188_544 108
40 3300046694 Ga0495649_0220026 Ga0495649_0220026_271_627 108
41 3300046810 Ga0495660_0100046 Ga0495660_0100046_223_579 108
42 3300047470 Ga0495681_0010384 Ga0495681_0010384_2423_2779 108
43 3300047472 Ga0495686_0008731 Ga0495686_0008731_3789_4145 108
44 3300053139 Ga0500568_0176642 Ga0500568_0176642_199_555 108
45 3300009011 Ga0105251_10297871 Ga0105251_102978711 109
46 3300009036 Ga0105244_10264653 Ga0105244_102646532 109
47 3300009092 Ga0105250_10023538 Ga0105250_100235381 109
48 3300013104 Ga0157370_11477583 Ga0157370_114775831 109
49 3300025711 Ga0207696_1001354 Ga0207696_100135417 109
50 3300048920 Ga0496117_0195711 Ga0496117_0195711_215_580 109
51 3300046458 Ga0495591_024861 Ga0495591_024861_1376_1744 110
52 3300046460 Ga0495638_0225808 Ga0495638_0225808_539_907 110
53 3300046492 Ga0495585_0001824 Ga0495585_0001824_3057_3425 110
54 3300046507 Ga0495606_0051633 Ga0495606_0051633_2090_2458 110
55 3300046530 Ga0495654_0255882 Ga0495654_0255882_40_408 110
56 3300046616 Ga0495668_0001693 Ga0495668_0001693_12694_13062 110
57 3300046694 Ga0495649_0043365 Ga0495649_0043365_157_525 110
58 3300047446 Ga0495679_020047 Ga0495679_020047_171_539 110
59 3300048091 Ga0495626_0036942 Ga0495626_0036942_156_524 110
60 3300025728 Ga0207655_1034978 Ga0207655_10349783 111
61 3300025735 Ga0207713_1013475 Ga0207713_10134754 111
62 3300048921 Ga0496118_0502462 Ga0496118_0502462_103_468 111
63 3300009036 Ga0105244_10309511 Ga0105244_103095111 112
64 3300042010 Ga0439452_000473 Ga0439452_000473_10634_10999 113
65 iso_pu_bacteria 2599185289 2599887125 113
66 iso_pu_bacteria 2599185291 2599898710 113
67 iso_pu_bacteria 2599185315 2600016987 113
68 iso_pu_bacteria 2599185321 2600051810 113
69 iso_pu_bacteria 2667528170 2671091202 113
70 iso_pu_bacteria 2904550169 2904554268 113
71 3300041405 Ga0439438_155208 Ga0439438_155208_100_444 114
72 3300041407 Ga0439447_077397 Ga0439447_077397_255_599 114
73 3300041410 Ga0439461_0107114 Ga0439461_0107114_85_429 114
74 3300042006 Ga0439432_091460 Ga0439432_091460_403_747 114
75 3300042010 Ga0439452_098400 Ga0439452_098400_71_415 114
76 3300006058 Ga0075432_10023108 Ga0075432_100231084 115
77 3300009148 Ga0105243_10003156 Ga0105243_1000315618 115
78 3300011119 Ga0105246_10001149 Ga0105246_1000114917 115
79 3300027907 Ga0207428_10079109 Ga0207428_100791093 115
80 3300046452 Ga0495617_119469 Ga0495617_119469_249_707 115
81 3300046453 Ga0495627_006388 Ga0495627_006388_2565_3023 115
82 3300046458 Ga0495591_014382 Ga0495591_014382_2253_2603 115
83 3300046460 Ga0495638_0000412 Ga0495638_0000412_20358_20708 115
84 3300046460 Ga0495638_0015010 Ga0495638_0015010_171_629 115
85 3300046474 Ga0495605_0100824 Ga0495605_0100824_724_1074 115
86 3300046474 Ga0495605_0214733 Ga0495605_0214733_61_519 115
87 3300046492 Ga0495585_0011871 Ga0495585_0011871_248_598 115
88 3300046492 Ga0495585_0038416 Ga0495585_0038416_2136_2594 115
89 3300046507 Ga0495606_0032549 Ga0495606_0032549_724_1074 115
90 3300046513 Ga0495616_0044347 Ga0495616_0044347_1627_2085 115
91 3300046513 Ga0495616_0209404 Ga0495616_0209404_201_551 115
92 3300046515 Ga0495620_0070046 Ga0495620_0070046_245_595 115
93 3300046518 Ga0495631_0162747 Ga0495631_0162747_402_752 115
94 3300046520 Ga0495637_0017612 Ga0495637_0017612_869_1327 115
95 3300046520 Ga0495637_0027577 Ga0495637_0027577_2050_2400 115
96 3300046523 Ga0495644_0000355 Ga0495644_0000355_12676_13134 115
97 3300046524 Ga0495648_0084892 Ga0495648_0084892_1184_1534 115
98 3300046524 Ga0495648_0123116 Ga0495648_0123116_867_1325 115
99 3300046530 Ga0495654_0060738 Ga0495654_0060738_1206_1556 115
100 3300046538 Ga0495609_0046775 Ga0495609_0046775_224_574 115
101 3300046542 Ga0495597_0017036 Ga0495597_0017036_1456_1914 115
102 3300046557 Ga0495622_0065627 Ga0495622_0065627_1121_1471 115
103 3300046648 Ga0495611_0056211 Ga0495611_0056211_72_422 115
104 3300046660 Ga0495625_0170907 Ga0495625_0170907_745_1203 115
105 3300046660 Ga0495625_0318348 Ga0495625_0318348_435_785 115
106 3300046665 Ga0495661_0093222 Ga0495661_0093222_249_707 115
107 3300046691 Ga0495670_0032053 Ga0495670_0032053_1306_1764 115
108 3300046692 Ga0495671_0012943 Ga0495671_0012943_256_606 115
109 3300046694 Ga0495649_0002054 Ga0495649_0002054_8343_8693 115
110 3300046794 Ga0495589_0139766 Ga0495589_0139766_681_1139 115
111 3300046810 Ga0495660_0083918 Ga0495660_0083918_1038_1496 115
112 3300047323 Ga0495683_0004343 Ga0495683_0004343_7452_7910 115
113 3300047323 Ga0495683_0147674 Ga0495683_0147674_183_533 115
114 3300047469 Ga0495673_0031221 Ga0495673_0031221_1895_2353 115
115 3300047469 Ga0495673_0061208 Ga0495673_0061208_124_474 115
116 3300047470 Ga0495681_0007114 Ga0495681_0007114_2444_2902 115
117 3300048091 Ga0495626_0030720 Ga0495626_0030720_2043_2393 115
118 3300049459 Ga0495678_014139 Ga0495678_014139_2010_2360 115
119 3300049459 Ga0495678_196262 Ga0495678_196262_251_601 115
120 iso_pu_bacteria 3007861166 3007862792 115
121 iso_pu_bacteria 2511231014 2511316790 116
122 iso_pu_bacteria 2600255318 2601795843 116
123 iso_pu_bacteria 2603880185 2606075309 116
124 iso_pu_bacteria 2603880199 2606128172 116
125 iso_pu_bacteria 2623620443 2624479781 116
126 iso_pu_bacteria 2713897148 2715752551 116
127 iso_pu_bacteria 2713897149 2715758910 116
128 iso_pu_bacteria 2718217725 2718633453 116
129 iso_pu_bacteria 2842832357 2842835464 116
130 iso_pu_bacteria 2842843487 2842848673 116
131 iso_pu_bacteria 2878029506 2878031796 116
132 iso_pu_bacteria 2919063839 2919068267 116
133 iso_pu_bacteria 2919385768 2919386758 116
134 iso_pu_bacteria 2919487758 2919491540 116
135 iso_pu_bacteria 2974289157 2974291727 116
136 iso_pu_bacteria 2998139840 2998142052 116
137 iso_pu_bacteria 8029995093 8029998726 116
138 3300005288 Ga0065714_10080522 Ga0065714_100805223 117
139 3300005353 Ga0070669_100054018 Ga0070669_1000540185 117
140 3300005548 Ga0070665_100080565 Ga0070665_1000805655 117
141 3300009011 Ga0105251_10034817 Ga0105251_100348171 117
142 3300013105 Ga0157369_10029284 Ga0157369_100292841 117
143 3300015261 Ga0182006_1188502 Ga0182006_11885021 117
144 3300025291 Ga0209675_1012566 Ga0209675_10125662 117
145 3300025735 Ga0207713_1001887 Ga0207713_10018874 117
146 3300025923 Ga0207681_10024836 Ga0207681_100248361 117
147 3300027111 Ga0209281_1007450 Ga0209281_10074503 117
148 3300028379 Ga0268266_10014302 Ga0268266_100143022 117
149 3300031548 Ga0307408_100166203 Ga0307408_1001662031 117
150 3300031911 Ga0307412_10049056 Ga0307412_100490565 117
151 3300031911 Ga0307412_10069970 Ga0307412_100699703 117
152 3300032004 Ga0307414_10068418 Ga0307414_100684184 117
153 3300042013 Ga0439456_065949 Ga0439456_065949_115_498 117
154 3300046471 Ga0495650_0073169 Ga0495650_0073169_154_519 117
155 3300046491 Ga0495584_0089862 Ga0495584_0089862_1054_1419 117
156 3300046507 Ga0495606_0052958 Ga0495606_0052958_2077_2442 117
157 3300046513 Ga0495616_0087979 Ga0495616_0087979_97_462 117
158 3300046515 Ga0495620_0001050 Ga0495620_0001050_5069_5434 117
159 3300046518 Ga0495631_0052045 Ga0495631_0052045_135_500 117
160 3300046519 Ga0495632_0045015 Ga0495632_0045015_80_445 117
161 3300046520 Ga0495637_0018278 Ga0495637_0018278_2689_3054 117
162 3300046530 Ga0495654_0406445 Ga0495654_0406445_162_527 117
163 3300046538 Ga0495609_0006420 Ga0495609_0006420_263_628 117
164 3300046616 Ga0495668_0172915 Ga0495668_0172915_17_382 117
165 3300046660 Ga0495625_0123998 Ga0495625_0123998_135_500 117
166 3300046694 Ga0495649_0039275 Ga0495649_0039275_263_628 117
167 3300046794 Ga0495589_0011847 Ga0495589_0011847_4024_4389 117
168 3300046810 Ga0495660_0042479 Ga0495660_0042479_136_501 117
169 3300047446 Ga0495679_001532 Ga0495679_001532_12471_12836 117
170 3300047470 Ga0495681_0008823 Ga0495681_0008823_3787_4140 117
171 3300047470 Ga0495681_0023971 Ga0495681_0023971_2726_3091 117
172 3300048921 Ga0496118_0205457 Ga0496118_0205457_662_1027 117
173 3300049459 Ga0495678_025829 Ga0495678_025829_206_571 117
174 3300049758 Ga0501241_000618 Ga0501241_000618_2581_2946 117
175 3300049766 Ga0501269_004511 Ga0501269_004511_932_1297 117
176 3300050489 nmdc:mga03683_421795_c1 nmdc:mga03683_421795_c1_56_421 117
177 3300050491 nmdc:mga00v17_702952_c1 nmdc:mga00v17_702952_c1_204_557 117
178 iso_pu_bacteria 2511231004 2511257577 117
179 iso_pu_bacteria 2511231007 2511271803 117
180 iso_pu_bacteria 2511231011 2511293552 117
181 iso_pu_bacteria 2511231012 2511302468 117
182 iso_pu_bacteria 2511231015 2511317369 117
183 iso_pu_bacteria 2511231016 2511324807 117
184 iso_pu_bacteria 2511231018 2511337981 117
185 iso_pu_bacteria 2511231019 2511342802 117
186 iso_pu_bacteria 2511231020 2511348747 117
187 iso_pu_bacteria 2511231021 2511355380 117
188 iso_pu_bacteria 2511231022 2511365874 117
189 iso_pu_bacteria 2511231023 2511369982 117
190 iso_pu_bacteria 2511231031 2511413276 117
191 iso_pu_bacteria 2511231156 2511823991 117
192 iso_pu_bacteria 2599185248 2599769802 117
193 iso_pu_bacteria 2599185300 2599933028 117
194 iso_pu_bacteria 2599185304 2599953504 117
195 iso_pu_bacteria 2599185305 2599959169 117
196 iso_pu_bacteria 2599185306 2599964438 117
197 iso_pu_bacteria 2599185308 2599975689 117
198 iso_pu_bacteria 2599185309 2599982235 117
199 iso_pu_bacteria 2599185310 2599989039 117
200 iso_pu_bacteria 2599185312 2599999497 117
201 iso_pu_bacteria 2599185313 2600007795 117
202 iso_pu_bacteria 2599185314 2600009674 117
203 iso_pu_bacteria 2599185316 2600022854 117
204 iso_pu_bacteria 2599185317 2600029005 117
205 iso_pu_bacteria 2599185318 2600036687 117
206 iso_pu_bacteria 2599185319 2600044794 117
207 iso_pu_bacteria 2599185320 2600046993 117
208 iso_pu_bacteria 2599185322 2600057947 117
209 iso_pu_bacteria 2599185323 2600068373 117
210 iso_pu_bacteria 2599185324 2600069987 117
211 iso_pu_bacteria 2599185325 2600076222 117
212 iso_pu_bacteria 2600254930 2600358172 117
213 iso_pu_bacteria 2623620446 2624491433 117
214 iso_pu_bacteria 2643221565 2643842540 117
215 iso_pu_bacteria 2643221589 2643952985 117
216 iso_pu_bacteria 2643221602 2644022747 117
217 iso_pu_bacteria 2643221633 2644188930 117
218 iso_pu_bacteria 2643221650 2644282201 117
219 iso_pu_bacteria 2667528176 2671130212 117
220 iso_pu_bacteria 2675903515 2678263110 117
221 iso_pu_bacteria 2738543004 2739199770 117
222 iso_pu_bacteria 2738543015 2739259361 117
223 iso_pu_bacteria 2738543025 2739315819 117
224 iso_pu_bacteria 2744054620 2745009443 117
225 iso_pu_bacteria 2773857670 2774123754 117
226 iso_pu_bacteria 2773857673 2774137361 117
227 iso_pu_bacteria 2784132063 2784263671 117
228 iso_pu_bacteria 2784132072 2784317792 117
229 iso_pu_bacteria 2791355520 2794598162 117
230 iso_pu_bacteria 2808606361 2808857522 117
231 iso_pu_bacteria 2808606376 2808925278 117
232 iso_pu_bacteria 2808606377 2808927800 117
233 iso_pu_bacteria 2808606378 2808937692 117
234 iso_pu_bacteria 2808606380 2808947374 117
235 iso_pu_bacteria 2808606381 2808949660 117
236 iso_pu_bacteria 2808606382 2808960225 117
237 iso_pu_bacteria 2808606383 2808966006 117
238 iso_pu_bacteria 2808606389 2809000898 117
239 iso_pu_bacteria 2808606445 2809216740 117
240 iso_pu_bacteria 2818991456 2819656481 117
241 iso_pu_bacteria 2825651385 2825656913 117
242 iso_pu_bacteria 2842854478 2842854956 117
243 iso_pu_bacteria 2852657418 2852658253 117
244 iso_pu_bacteria 2880230671 2880234257 117
245 iso_pu_bacteria 2904518522 2904523627 117
246 iso_pu_bacteria 2913036834 2913040645 117
247 iso_pu_bacteria 2919481497 2919482246 117
248 iso_pu_bacteria 2919697872 2919701007 117
249 iso_pu_bacteria 2923586266 2923587823 117
250 iso_pu_bacteria 2929144301 2929147995 117
251 iso_pu_bacteria 2931396565 2931400526 117
252 iso_pu_bacteria 2969304461 2969306586 117
253 iso_pu_bacteria 2988728565 2988729781 117
254 iso_pu_bacteria 3007511990 3007513402 117
255 iso_pu_bacteria 3007614139 3007614873 117
256 iso_pu_bacteria 3007619802 3007624164 117
257 iso_pu_bacteria 3007718800 3007723755 117
258 iso_pu_bacteria 3007855910 3007860647 117
259 iso_pu_bacteria 3007866637 3007868412 117
260 iso_pu_bacteria 8019775933 8019778328 117
261 iso_pu_bacteria 8056143049 8056147029 117
262 iso_pu_bacteria 8056155041 8056155956 117
263 iso_pu_bacteria 8056166840 8056169022 117
264 iso_pu_bacteria 8056172158 8056175177 117
265 iso_pu_bacteria 8056177738 8056183490 117
266 iso_pu_bacteria 8056569372 8056572975 117
267 2124908027 MRS2a_Contig_5182 MRS2a_00082400 118
268 3300005288 Ga0065714_10006297 Ga0065714_100062972 118
269 3300005288 Ga0065714_10006952 Ga0065714_100069522 118
270 3300005288 Ga0065714_10035918 Ga0065714_100359183 118
271 3300006058 Ga0075432_10000189 Ga0075432_1000018915 118
272 3300006058 Ga0075432_10000550 Ga0075432_1000055013 118
273 3300009011 Ga0105251_10066749 Ga0105251_100667492 118
274 3300009036 Ga0105244_10002352 Ga0105244_100023525 118
275 3300009036 Ga0105244_10072502 Ga0105244_100725021 118
276 3300009092 Ga0105250_10061463 Ga0105250_100614632 118
277 3300011119 Ga0105246_10013835 Ga0105246_100138357 118
278 3300011119 Ga0105246_10659116 Ga0105246_106591161 118
279 3300012498 Ga0157345_1000071 Ga0157345_100007113 118
280 3300013100 Ga0157373_10002465 Ga0157373_100024653 118
281 3300013100 Ga0157373_10533349 Ga0157373_105333492 118
282 3300013100 Ga0157373_10993131 Ga0157373_109931311 118
283 3300013102 Ga0157371_10308979 Ga0157371_103089792 118
284 3300013104 Ga0157370_10155828 Ga0157370_101558282 118
285 3300013306 Ga0163162_11787093 Ga0163162_117870932 118
286 3300013308 Ga0157375_10161927 Ga0157375_101619272 118
287 3300013308 Ga0157375_11018481 Ga0157375_110184812 118
288 3300014497 Ga0182008_10017337 Ga0182008_100173375 118
289 3300014497 Ga0182008_10019002 Ga0182008_100190025 118
290 3300014497 Ga0182008_10035532 Ga0182008_100355324 118
291 3300014497 Ga0182008_10420676 Ga0182008_104206761 118
292 3300015261 Ga0182006_1000969 Ga0182006_100096919 118
293 3300015261 Ga0182006_1084504 Ga0182006_10845042 118
294 3300015262 Ga0182007_10000713 Ga0182007_1000071318 118
295 3300015265 Ga0182005_1000562 Ga0182005_10005626 118
296 3300015265 Ga0182005_1001332 Ga0182005_10013328 118
297 3300015265 Ga0182005_1275957 Ga0182005_12759571 118
298 3300017792 Ga0163161_10004750 Ga0163161_1000475014 118
299 3300017792 Ga0163161_10017430 Ga0163161_100174308 118
300 3300017792 Ga0163161_10091277 Ga0163161_100912771 118
301 3300017792 Ga0163161_10127447 Ga0163161_101274474 118
302 3300025230 Ga0209563_100231 Ga0209563_10023110 118
303 3300025711 Ga0207696_1034399 Ga0207696_10343992 118
304 3300025728 Ga0207655_1000085 Ga0207655_100008516 118
305 3300025728 Ga0207655_1000141 Ga0207655_10001416 118
306 3300025728 Ga0207655_1015180 Ga0207655_10151802 118
307 3300025728 Ga0207655_1098158 Ga0207655_10981581 118
308 3300025735 Ga0207713_1057644 Ga0207713_10576441 118
309 3300025935 Ga0207709_10000089 Ga0207709_1000008998 118
310 3300027907 Ga0207428_10059153 Ga0207428_100591535 118
311 3300027907 Ga0207428_10206479 Ga0207428_102064792 118
312 3300027907 Ga0207428_11299668 Ga0207428_112996681 118
313 3300032005 Ga0307411_10085840 Ga0307411_100858401 118
314 3300033180 Ga0307510_10003652 Ga0307510_1000365216 118
315 3300033180 Ga0307510_10607664 Ga0307510_106076641 118
316 3300038705 Ga0237819_01044 Ga0237819_01044_5144_5512 118
317 3300041405 Ga0439438_006274 Ga0439438_006274_2955_3311 118
318 3300041405 Ga0439438_006738 Ga0439438_006738_1404_1760 118
319 3300041405 Ga0439438_072252 Ga0439438_072252_169_525 118
320 3300041407 Ga0439447_003238 Ga0439447_003238_3907_4263 118
321 3300041407 Ga0439447_008853 Ga0439447_008853_1465_1821 118
322 3300041407 Ga0439447_010917 Ga0439447_010917_1000_1356 118
323 3300041407 Ga0439447_068649 Ga0439447_068649_337_693 118
324 3300041411 Ga0439466_0000438 Ga0439466_0000438_3862_4218 118
325 3300041411 Ga0439466_0001566 Ga0439466_0001566_6732_7088 118
326 3300041411 Ga0439466_0009010 Ga0439466_0009010_2703_3059 118
327 3300041411 Ga0439466_0013948 Ga0439466_0013948_145_510 118
328 3300041411 Ga0439466_0041857 Ga0439466_0041857_703_1059 118
329 3300041411 Ga0439466_0068267 Ga0439466_0068267_696_1052 118
330 3300042006 Ga0439432_001390 Ga0439432_001390_6018_6374 118
331 3300042006 Ga0439432_012947 Ga0439432_012947_2402_2767 118
332 3300042006 Ga0439432_106695 Ga0439432_106695_246_602 118
333 3300042009 Ga0439451_003459 Ga0439451_003459_2597_2962 118
334 3300042010 Ga0439452_000565 Ga0439452_000565_11289_11645 118
335 3300042010 Ga0439452_002595 Ga0439452_002595_2769_3125 118
336 3300042010 Ga0439452_009290 Ga0439452_009290_111_476 118
337 3300042010 Ga0439452_031549 Ga0439452_031549_825_1181 118
338 3300042013 Ga0439456_002521 Ga0439456_002521_2037_2393 118
339 3300042013 Ga0439456_047832 Ga0439456_047832_558_914 118
340 3300042013 Ga0439456_065132 Ga0439456_065132_20_376 118
341 3300042016 Ga0439463_017917 Ga0439463_017917_58_414 118
342 3300042016 Ga0439463_029947 Ga0439463_029947_852_1208 118
343 3300042121 Ga0450919_005108 Ga0450919_005108_163_519 118
344 3300042127 Ga0450890_000686 Ga0450890_000686_3796_4152 118
345 3300042130 Ga0450892_040175 Ga0450892_040175_45_401 118
346 3300042136 Ga0450900_040221 Ga0450900_040221_143_499 118
347 3300042137 Ga0450902_005769 Ga0450902_005769_1160_1516 118
348 3300042137 Ga0450902_017266 Ga0450902_017266_767_1123 118
349 3300042138 Ga0450903_004501 Ga0450903_004501_1797_2153 118
350 3300042138 Ga0450903_019360 Ga0450903_019360_85_441 118
351 3300042139 Ga0450904_001613 Ga0450904_001613_321_686 118
352 3300042139 Ga0450904_004983 Ga0450904_004983_745_1101 118
353 3300042139 Ga0450904_026792 Ga0450904_026792_64_420 118
354 3300042142 Ga0450905_007493 Ga0450905_007493_311_706 118
355 3300042145 Ga0450906_000932 Ga0450906_000932_1425_1781 118
356 3300042146 Ga0450907_000936 Ga0450907_000936_2766_3122 118
357 3300042156 Ga0439446_0001054 Ga0439446_0001054_1848_2204 118
358 3300042184 Ga0450908_008146 Ga0450908_008146_17_373 118
359 3300042184 Ga0450908_038835 Ga0450908_038835_449_805 118
360 3300042185 Ga0450909_025603 Ga0450909_025603_439_795 118
361 3300042435 Ga0439434_0006785 Ga0439434_0006785_2882_3238 118
362 3300042461 Ga0439460_0002461 Ga0439460_0002461_1340_1696 118
363 3300042532 Ga0450893_0004246 Ga0450893_0004246_416_772 118
364 3300042533 Ga0450901_002451 Ga0450901_002451_597_953 118
365 3300042993 Ga0439440_0000659 Ga0439440_0000659_3837_4193 118
366 3300046452 Ga0495617_016819 Ga0495617_016819_573_941 118
367 3300046452 Ga0495617_024799 Ga0495617_024799_498_854 118
368 3300046452 Ga0495617_040856 Ga0495617_040856_984_1352 118
369 3300046453 Ga0495627_000818 Ga0495627_000818_9457_9825 118
370 3300046453 Ga0495627_001538 Ga0495627_001538_12612_12980 118
371 3300046453 Ga0495627_035046 Ga0495627_035046_72_440 118
372 3300046453 Ga0495627_140243 Ga0495627_140243_144_503 118
373 3300046453 Ga0495627_146014 Ga0495627_146014_184_540 118
374 3300046455 Ga0495603_0402451 Ga0495603_0402451_193_549 118
375 3300046455 Ga0495603_0769462 Ga0495603_0769462_73_429 118
376 3300046457 Ga0495590_0109481 Ga0495590_0109481_529_897 118
377 3300046458 Ga0495591_001682 Ga0495591_001682_12631_12999 118
378 3300046458 Ga0495591_002008 Ga0495591_002008_11082_11450 118
379 3300046458 Ga0495591_011740 Ga0495591_011740_2571_2939 118
380 3300046458 Ga0495591_040022 Ga0495591_040022_768_1136 118
381 3300046458 Ga0495591_044675 Ga0495591_044675_441_797 118
382 3300046460 Ga0495638_0050420 Ga0495638_0050420_2132_2488 118
383 3300046460 Ga0495638_0070553 Ga0495638_0070553_1330_1686 118
384 3300046460 Ga0495638_0107441 Ga0495638_0107441_230_598 118
385 3300046460 Ga0495638_0181555 Ga0495638_0181555_235_591 118
386 3300046460 Ga0495638_0347182 Ga0495638_0347182_65_421 118
387 3300046471 Ga0495650_0009065 Ga0495650_0009065_220_576 118
388 3300046471 Ga0495650_0022700 Ga0495650_0022700_1853_2221 118
389 3300046471 Ga0495650_0072852 Ga0495650_0072852_640_996 118
390 3300046471 Ga0495650_0080893 Ga0495650_0080893_195_563 118
391 3300046472 Ga0495580_0291742 Ga0495580_0291742_366_722 118
392 3300046473 Ga0495582_0915274 Ga0495582_0915274_23_379 118
393 3300046474 Ga0495605_0001458 Ga0495605_0001458_2486_2854 118
394 3300046474 Ga0495605_0024411 Ga0495605_0024411_363_719 118
395 3300046474 Ga0495605_0041318 Ga0495605_0041318_1675_2031 118
396 3300046474 Ga0495605_0178961 Ga0495605_0178961_458_814 118
397 3300046475 Ga0495639_0000032 Ga0495639_0000032_60311_60667 118
398 3300046491 Ga0495584_0000732 Ga0495584_0000732_19674_20030 118
399 3300046491 Ga0495584_0025901 Ga0495584_0025901_2252_2608 118
400 3300046491 Ga0495584_0068670 Ga0495584_0068670_1258_1614 118
401 3300046491 Ga0495584_0072912 Ga0495584_0072912_101_469 118
402 3300046491 Ga0495584_0091016 Ga0495584_0091016_244_612 118
403 3300046491 Ga0495584_0321643 Ga0495584_0321643_263_619 118
404 3300046492 Ga0495585_0001070 Ga0495585_0001070_9661_10026 118
405 3300046492 Ga0495585_0058339 Ga0495585_0058339_215_583 118
406 3300046492 Ga0495585_0111108 Ga0495585_0111108_56_424 118
407 3300046492 Ga0495585_0133415 Ga0495585_0133415_754_1122 118
408 3300046492 Ga0495585_0615381 Ga0495585_0615381_15_383 118
409 3300046499 Ga0495594_0122640 Ga0495594_0122640_1001_1357 118
410 3300046500 Ga0495596_0010404 Ga0495596_0010404_1227_1595 118
411 3300046500 Ga0495596_0062411 Ga0495596_0062411_41_409 118
412 3300046501 Ga0495607_0007020 Ga0495607_0007020_1822_2178 118
413 3300046501 Ga0495607_0008932 Ga0495607_0008932_5572_5940 118
414 3300046501 Ga0495607_0019597 Ga0495607_0019597_1692_2048 118
415 3300046501 Ga0495607_0044171 Ga0495607_0044171_1843_2199 118
416 3300046501 Ga0495607_0062123 Ga0495607_0062123_119_487 118
417 3300046501 Ga0495607_0066785 Ga0495607_0066785_36_392 118
418 3300046506 Ga0495583_0002630 Ga0495583_0002630_12890_13258 118
419 3300046506 Ga0495583_0003057 Ga0495583_0003057_9037_9393 118
420 3300046506 Ga0495583_0009696 Ga0495583_0009696_3625_3981 118
421 3300046507 Ga0495606_0005384 Ga0495606_0005384_305_661 118
422 3300046507 Ga0495606_0106205 Ga0495606_0106205_72_440 118
423 3300046507 Ga0495606_0115186 Ga0495606_0115186_1143_1508 118
424 3300046512 Ga0495610_0003088 Ga0495610_0003088_12704_13072 118
425 3300046512 Ga0495610_0038080 Ga0495610_0038080_1624_1992 118
426 3300046512 Ga0495610_0045966 Ga0495610_0045966_1551_1907 118
427 3300046513 Ga0495616_0001762 Ga0495616_0001762_1751_2119 118
428 3300046513 Ga0495616_0022207 Ga0495616_0022207_2629_2997 118
429 3300046513 Ga0495616_0034101 Ga0495616_0034101_1906_2262 118
430 3300046513 Ga0495616_0096518 Ga0495616_0096518_263_631 118
431 3300046515 Ga0495620_0009335 Ga0495620_0009335_4576_4932 118
432 3300046515 Ga0495620_0096249 Ga0495620_0096249_122_490 118
433 3300046518 Ga0495631_0000738 Ga0495631_0000738_8057_8425 118
434 3300046518 Ga0495631_0070388 Ga0495631_0070388_915_1271 118
435 3300046519 Ga0495632_0001580 Ga0495632_0001580_4871_5227 118
436 3300046519 Ga0495632_0002160 Ga0495632_0002160_8379_8747 118
437 3300046519 Ga0495632_0009081 Ga0495632_0009081_5510_5878 118
438 3300046519 Ga0495632_0024798 Ga0495632_0024798_1463_1828 118
439 3300046520 Ga0495637_0001933 Ga0495637_0001933_10513_10869 118
440 3300046520 Ga0495637_0002081 Ga0495637_0002081_4373_4729 118
441 3300046520 Ga0495637_0007978 Ga0495637_0007978_3287_3655 118
442 3300046520 Ga0495637_0047309 Ga0495637_0047309_124_492 118
443 3300046522 Ga0495643_0010756 Ga0495643_0010756_743_1111 118
444 3300046522 Ga0495643_0022780 Ga0495643_0022780_843_1199 118
445 3300046522 Ga0495643_0039477 Ga0495643_0039477_2028_2396 118
446 3300046522 Ga0495643_0234865 Ga0495643_0234865_163_519 118
447 3300046523 Ga0495644_0084787 Ga0495644_0084787_215_583 118
448 3300046523 Ga0495644_0114212 Ga0495644_0114212_185_541 118
449 3300046524 Ga0495648_0000074 Ga0495648_0000074_11636_11992 118
450 3300046524 Ga0495648_0002613 Ga0495648_0002613_6261_6629 118
451 3300046524 Ga0495648_0007728 Ga0495648_0007728_1870_2238 118
452 3300046524 Ga0495648_0031588 Ga0495648_0031588_2837_3193 118
453 3300046524 Ga0495648_0337750 Ga0495648_0337750_223_591 118
454 3300046526 Ga0495666_0035969 Ga0495666_0035969_1865_2221 118
455 3300046530 Ga0495654_0002011 Ga0495654_0002011_12797_13165 118
456 3300046530 Ga0495654_0011542 Ga0495654_0011542_1624_1980 118
457 3300046530 Ga0495654_0073799 Ga0495654_0073799_165_521 118
458 3300046530 Ga0495654_0078885 Ga0495654_0078885_798_1154 118
459 3300046530 Ga0495654_0083923 Ga0495654_0083923_571_939 118
460 3300046530 Ga0495654_0139076 Ga0495654_0139076_443_799 118
461 3300046538 Ga0495609_0002470 Ga0495609_0002470_9037_9393 118
462 3300046538 Ga0495609_0045918 Ga0495609_0045918_142_510 118
463 3300046538 Ga0495609_0063010 Ga0495609_0063010_123_491 118
464 3300046542 Ga0495597_0000602 Ga0495597_0000602_15459_15827 118
465 3300046542 Ga0495597_0008470 Ga0495597_0008470_4292_4648 118
466 3300046542 Ga0495597_0021180 Ga0495597_0021180_1055_1411 118
467 3300046557 Ga0495622_0000657 Ga0495622_0000657_16422_16778 118
468 3300046558 Ga0495633_0467667 Ga0495633_0467667_93_449 118
469 3300046616 Ga0495668_0311910 Ga0495668_0311910_220_588 118
470 3300046616 Ga0495668_0375439 Ga0495668_0375439_65_421 118
471 3300046616 Ga0495668_0577838 Ga0495668_0577838_54_422 118
472 3300046648 Ga0495611_0000391 Ga0495611_0000391_14747_15115 118
473 3300046648 Ga0495611_0056781 Ga0495611_0056781_1283_1651 118
474 3300046660 Ga0495625_0001906 Ga0495625_0001906_11882_12250 118
475 3300046660 Ga0495625_0002566 Ga0495625_0002566_6549_6917 118
476 3300046660 Ga0495625_0147772 Ga0495625_0147772_924_1280 118
477 3300046660 Ga0495625_0477863 Ga0495625_0477863_108_464 118
478 3300046664 Ga0495659_0000227 Ga0495659_0000227_7810_8166 118
479 3300046664 Ga0495659_0048766 Ga0495659_0048766_934_1290 118
480 3300046664 Ga0495659_0355647 Ga0495659_0355647_233_589 118
481 3300046665 Ga0495661_0008772 Ga0495661_0008772_1608_1964 118
482 3300046665 Ga0495661_0141650 Ga0495661_0141650_221_589 118
483 3300046691 Ga0495670_0000329 Ga0495670_0000329_9390_9758 118
484 3300046691 Ga0495670_0000721 Ga0495670_0000721_14223_14579 118
485 3300046691 Ga0495670_0016605 Ga0495670_0016605_270_626 118
486 3300046691 Ga0495670_0505629 Ga0495670_0505629_272_628 118
487 3300046692 Ga0495671_0000996 Ga0495671_0000996_13549_13905 118
488 3300046692 Ga0495671_0010143 Ga0495671_0010143_624_992 118
489 3300046692 Ga0495671_0043093 Ga0495671_0043093_292_648 118
490 3300046692 Ga0495671_0050798 Ga0495671_0050798_489_857 118
491 3300046694 Ga0495649_0002056 Ga0495649_0002056_9466_9822 118
492 3300046694 Ga0495649_0002115 Ga0495649_0002115_223_591 118
493 3300046694 Ga0495649_0110394 Ga0495649_0110394_214_570 118
494 3300046794 Ga0495589_0022786 Ga0495589_0022786_2816_3172 118
495 3300046794 Ga0495589_0378694 Ga0495589_0378694_136_504 118
496 3300046810 Ga0495660_0022275 Ga0495660_0022275_3108_3476 118
497 3300046810 Ga0495660_0039618 Ga0495660_0039618_1519_1875 118
498 3300046810 Ga0495660_0043072 Ga0495660_0043072_1893_2249 118
499 3300046810 Ga0495660_0086946 Ga0495660_0086946_94_462 118
500 3300046810 Ga0495660_0098582 Ga0495660_0098582_958_1323 118
501 3300046810 Ga0495660_0141122 Ga0495660_0141122_136_504 118
502 3300047315 Ga0495581_0521296 Ga0495581_0521296_256_612 118
503 3300047318 Ga0495636_0143496 Ga0495636_0143496_444_800 118
504 3300047320 Ga0495672_0017035 Ga0495672_0017035_30_386 118
505 3300047320 Ga0495672_0186764 Ga0495672_0186764_455_823 118
506 3300047320 Ga0495672_0195795 Ga0495672_0195795_607_975 118
507 3300047320 Ga0495672_0199845 Ga0495672_0199845_300_656 118
508 3300047323 Ga0495683_0003781 Ga0495683_0003781_4303_4659 118
509 3300047443 Ga0495687_003224 Ga0495687_003224_7613_7969 118
510 3300047446 Ga0495679_000856 Ga0495679_000856_6263_6631 118
511 3300047446 Ga0495679_042146 Ga0495679_042146_887_1243 118
512 3300047447 Ga0495685_202828 Ga0495685_202828_138_494 118
513 3300047469 Ga0495673_0002401 Ga0495673_0002401_12614_12982 118
514 3300047469 Ga0495673_0002697 Ga0495673_0002697_253_609 118
515 3300047469 Ga0495673_0276215 Ga0495673_0276215_52_408 118
516 3300047470 Ga0495681_0002606 Ga0495681_0002606_10981_11337 118
517 3300047470 Ga0495681_0005270 Ga0495681_0005270_271_627 118
518 3300047470 Ga0495681_0018824 Ga0495681_0018824_3287_3655 118
519 3300047470 Ga0495681_0046781 Ga0495681_0046781_166_534 118
520 3300047470 Ga0495681_0089546 Ga0495681_0089546_166_531 118
521 3300047470 Ga0495681_0125090 Ga0495681_0125090_442_798 118
522 3300047472 Ga0495686_0001725 Ga0495686_0001725_13646_14014 118
523 3300047472 Ga0495686_0168592 Ga0495686_0168592_214_582 118
524 3300047472 Ga0495686_0642175 Ga0495686_0642175_112_468 118
525 3300047673 Ga0495593_0008370 Ga0495593_0008370_4609_4965 118
526 3300048091 Ga0495626_0002064 Ga0495626_0002064_11484_11840 118
527 3300048091 Ga0495626_0002224 Ga0495626_0002224_13508_13864 118
528 3300048091 Ga0495626_0002369 Ga0495626_0002369_12610_12978 118
529 3300048091 Ga0495626_0002605 Ga0495626_0002605_295_651 118
530 3300048091 Ga0495626_0236595 Ga0495626_0236595_43_399 118
531 3300048909 Ga0496106_0017426 Ga0496106_0017426_4364_4720 118
532 3300048910 Ga0496107_0143443 Ga0496107_0143443_628_984 118
533 3300048913 Ga0496110_0200844 Ga0496110_0200844_1330_1695 118
534 3300048919 Ga0496116_0002857 Ga0496116_0002857_2824_3180 118
535 3300048919 Ga0496116_0003192 Ga0496116_0003192_3433_3801 118
536 3300048919 Ga0496116_0009288 Ga0496116_0009288_7152_7520 118
537 3300048920 Ga0496117_0044303 Ga0496117_0044303_267_635 118
538 3300048920 Ga0496117_0088766 Ga0496117_0088766_383_739 118
539 3300048921 Ga0496118_0034444 Ga0496118_0034444_66_455 118
540 3300048921 Ga0496118_0050621 Ga0496118_0050621_2620_2988 118
541 3300048922 Ga0496119_0082451 Ga0496119_0082451_66_455 118
542 3300048923 Ga0496120_0074809 Ga0496120_0074809_66_455 118
543 3300048924 Ga0496121_0004635 Ga0496121_0004635_7805_8161 118
544 3300048925 Ga0496122_0003890 Ga0496122_0003890_3223_3579 118
545 3300048925 Ga0496122_0176144 Ga0496122_0176144_240_608 118
546 3300048926 Ga0496123_0024286 Ga0496123_0024286_2581_2949 118
547 3300048926 Ga0496123_0054121 Ga0496123_0054121_724_1080 118
548 3300048927 Ga0496124_0140317 Ga0496124_0140317_1403_1771 118
549 3300048927 Ga0496124_0427392 Ga0496124_0427392_117_482 118
550 3300048927 Ga0496124_0677074 Ga0496124_0677074_213_569 118
551 3300048929 Ga0496126_0692165 Ga0496126_0692165_31_387 118
552 3300049459 Ga0495678_000886 Ga0495678_000886_23947_24303 118
553 3300049459 Ga0495678_002299 Ga0495678_002299_12612_12980 118
554 3300049459 Ga0495678_044207 Ga0495678_044207_1273_1641 118
555 3300049459 Ga0495678_058972 Ga0495678_058972_206_562 118
556 3300049460 Ga0495682_0041450 Ga0495682_0041450_153_521 118
557 3300049460 Ga0495682_0133997 Ga0495682_0133997_139_495 118
558 3300050491 nmdc:mga00v17_301814_c1 nmdc:mga00v17_301814_c1_454_822 118

Structural Annotation

Top 5 Hits

ID Description Score Start End
6duz-assembly1.cif.gz_Y structure of the periplasmic domains of prgh and prgk from the assembled salmonella type iii secretion injectisome needle complex 0.7137 46 103
1yj7-assembly1.cif.gz_A crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.7055 42 105
1x60-assembly1.cif.gz_A solution structure of the peptidoglycan binding domain of b. subtilis cell wall lytic enzyme cwlc 0.6958 36 115
6khp-assembly1.cif.gz_B crystal structure of oryza sativa tdc with plp and tryptamine 0.6927 50 102
6khp-assembly1.cif.gz_A-2 crystal structure of oryza sativa tdc with plp and tryptamine 0.6759 50 102
ID Description Score Start End Superfamily
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8017 44 79 3.10.180.10
af_Q9VF83_326_394_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.7755 48 79 3.30.1370.50
af_Q54M41_391_464_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.7687 41 81 3.30.1370.50
af_Q96D70_188_248_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.7565 42 80 3.30.1370.50
af_Q4DK43_58_134_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.7432 41 79 3.30.1370.50
ID Description Score Start End GO Terms
AF-F3FUT7-F1-model_v4 SPOR domain-containing protein 0.89 30 114 GO:0042834
AF-F3FUT7-F1-model_v4 SPOR domain-containing protein 0.8595 30 114 GO:0042834
AF-A0A7Y2LEV7-F1-model_v4 deleted 0.833 38 115
AF-A0A371YQL1-F1-model_v4 SPOR domain-containing protein 0.829 36 115 GO:0042834
AF-A0A0L0BA84-F1-model_v4 Sporulation protein 0.8254 37 117 GO:0042834

Feature Viewer

pLDDT pTM Quality
73.03 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map