F463434

General Info

Members Datasets Scaffolds Average Seq Length
558 203 556 245

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10105183|Ga0105242_101051832
Length 267
Sequence MHLQRAQPRRCAIEDPPVREAPMPELEKPDSPLTTTVKWRFPSVHPEGRKYAVIAAAATFLAYVLISHFLGWLLAAVTIWIAAFFRDPVRTTPKGDKFIVAPADGLITMITKVPPPPELRGPEGLTDAEYVRVSIFMSVFDVHINRSPIAGRVKRIAYVPGKFINADLDKASEDNERQHLLIEGADGLRIGFTQIAGLVARRILSFVREGDAVLAGQRVGLIRFGSRVDVYLPPTAAPRVLLGQRAIAGETILGIVGLDIPVTGTSQ

Samples

Sample ID Description Type Environment
1 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
2 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
195 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
196 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
197 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.18
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 1.25
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003982 3300001977 Bacteria 2335
2 JGI24740J21852_10005517 3300001979 Bacteria 5337
3 JGI24737J22298_10010598 3300001990 Bacteria 3038
4 JGI24748J21848_1004790 3300002074 Bacteria 1557
5 JGI24749J21850_1000797 3300002076 Bacteria 4523
6 JGI24034J26672_10003049 3300002239 Bacteria 2323
7 Ga0065704_10001524 3300005289 Bacteria 8833
8 Ga0065712_10096552 3300005290 Bacteria 2136
9 Ga0065712_10178722 3300005290 Bacteria 1204
10 Ga0065715_10000437 3300005293 Bacteria 11946
11 Ga0065715_10019777 3300005293 Bacteria 1884
12 Ga0070658_10000652 3300005327 Bacteria 29975
13 Ga0070658_10052428 3300005327 Bacteria 3309
14 Ga0070658_10178663 3300005327 Bacteria 1786
15 Ga0070658_10527963 3300005327 Bacteria 1021
16 Ga0070676_10010394 3300005328 Bacteria 5049
17 Ga0070676_10163194 3300005328 Bacteria 1436
18 Ga0070683_100066368 3300005329 Bacteria 3361
19 Ga0070683_100498925 3300005329 Bacteria 1163
20 Ga0070670_100010306 3300005331 Bacteria 7977
21 Ga0070670_100024986 3300005331 Bacteria 5140
22 Ga0070670_100053167 3300005331 Bacteria 3478
23 Ga0070670_100059536 3300005331 Bacteria 3278
24 Ga0070670_100091611 3300005331 Bacteria 2613
25 Ga0070670_100173460 3300005331 Bacteria 1871
26 Ga0070670_100278448 3300005331 Bacteria 1461
27 Ga0070670_100483758 3300005331 Bacteria 1099
28 Ga0070677_10000216 3300005333 Bacteria 19901
29 Ga0070677_10008975 3300005333 Bacteria 3380
30 Ga0068869_100040743 3300005334 Bacteria 3323
31 Ga0070666_10000338 3300005335 Bacteria 29533
32 Ga0070666_10029136 3300005335 Bacteria 3628
33 Ga0070666_10089154 3300005335 Bacteria 2116
34 Ga0070680_100000206 3300005336 Bacteria 38666
35 Ga0070680_100000443 3300005336 Bacteria 28219
36 Ga0070680_100006448 3300005336 Bacteria 8919
37 Ga0070680_100050303 3300005336 Bacteria 3399
38 Ga0070680_100147071 3300005336 Bacteria 1977
39 Ga0070682_100044095 3300005337 Bacteria 2761
40 Ga0068868_100000078 3300005338 Bacteria 57930
41 Ga0070660_100021766 3300005339 Bacteria 4732
42 Ga0070660_100525695 3300005339 Bacteria 986
43 Ga0070691_10024768 3300005341 Bacteria 2791
44 Ga0070661_100041512 3300005344 Bacteria 3357
45 Ga0070661_100101408 3300005344 Bacteria 2141
46 Ga0070692_10035801 3300005345 Bacteria 2515
47 Ga0070692_10143720 3300005345 Bacteria 1353
48 Ga0070668_100000111 3300005347 Bacteria 50557
49 Ga0070668_100003513 3300005347 Bacteria 11554
50 Ga0070668_100084813 3300005347 Bacteria 2489
51 Ga0070669_100000008 3300005353 Bacteria 226764
52 Ga0070669_100007340 3300005353 Bacteria 7905
53 Ga0070669_100008619 3300005353 Bacteria 7275
54 Ga0070675_100000755 3300005354 Bacteria 22567
55 Ga0070671_100000010 3300005355 Bacteria 202799
56 Ga0070671_100000130 3300005355 Bacteria 48553
57 Ga0070671_100004083 3300005355 Bacteria 11521
58 Ga0070671_100035934 3300005355 Bacteria 4106
59 Ga0070671_100113014 3300005355 Bacteria 2282
60 Ga0070671_100257278 3300005355 Bacteria 1483
61 Ga0070671_100318661 3300005355 Bacteria 1325
62 Ga0070674_100001314 3300005356 Bacteria 13067
63 Ga0070673_100003762 3300005364 Bacteria 9515
64 Ga0070673_100191963 3300005364 Bacteria 1755
65 Ga0070659_100036861 3300005366 Bacteria 3812
66 Ga0070659_100080345 3300005366 Bacteria 2603
67 Ga0070659_100130197 3300005366 Bacteria 2043
68 Ga0070659_100544969 3300005366 Bacteria 993
69 Ga0070667_100005131 3300005367 Bacteria 10962
70 Ga0070667_100010168 3300005367 Bacteria 7776
71 Ga0070667_100068425 3300005367 Bacteria 3021
72 Ga0070663_100031740 3300005455 Bacteria 3634
73 Ga0070663_100037789 3300005455 Bacteria 3363
74 Ga0070663_100053019 3300005455 Bacteria 2894
75 Ga0070663_100130998 3300005455 Bacteria 1904
76 Ga0070678_100048185 3300005456 Bacteria 3067
77 Ga0070678_100048233 3300005456 Bacteria 3066
78 Ga0070678_100086082 3300005456 Bacteria 2396
79 Ga0070678_100151620 3300005456 Bacteria 1868
80 Ga0070662_100006332 3300005457 Bacteria 7623
81 Ga0070662_100054403 3300005457 Bacteria 2900
82 Ga0070662_100059163 3300005457 Bacteria 2791
83 Ga0070662_100101076 3300005457 Bacteria 2182
84 Ga0070662_100355685 3300005457 Bacteria 1201
85 Ga0070681_10043310 3300005458 Bacteria 4510
86 Ga0068867_100037133 3300005459 Bacteria 3540
87 Ga0068867_100566758 3300005459 Bacteria 986
88 Ga0070685_10347684 3300005466 Bacteria 1013
89 Ga0070679_100000005 3300005530 Bacteria 263201
90 Ga0070679_100092537 3300005530 Bacteria 3011
91 Ga0070679_100139726 3300005530 Bacteria 2402
92 Ga0070679_100200127 3300005530 Bacteria 1964
93 Ga0070684_100220511 3300005535 Bacteria 1730
94 Ga0070684_100554229 3300005535 Bacteria 1067
95 Ga0068853_100114524 3300005539 Bacteria 2399
96 Ga0068853_100436009 3300005539 Bacteria 1231
97 Ga0070672_100004800 3300005543 Bacteria 8875
98 Ga0070686_100000143 3300005544 Bacteria 49208
99 Ga0070686_100097065 3300005544 Bacteria 1983
100 Ga0070686_100247776 3300005544 Bacteria 1300
101 Ga0070696_100088525 3300005546 Bacteria 2201
102 Ga0070696_100351172 3300005546 Bacteria 1142
103 Ga0070693_100050156 3300005547 Bacteria 2384
104 Ga0070693_100096906 3300005547 Bacteria 1789
105 Ga0070665_100039876 3300005548 Bacteria 4721
106 Ga0070665_100327274 3300005548 Bacteria 1537
107 Ga0070665_100400299 3300005548 Bacteria 1381
108 Ga0070665_100481420 3300005548 Bacteria 1252
109 Ga0068855_100089477 3300005563 Bacteria 3554
110 Ga0068855_100125690 3300005563 Bacteria 2932
111 Ga0068855_100209145 3300005563 Bacteria 2193
112 Ga0068855_100237759 3300005563 Bacteria 2036
113 Ga0068855_100318273 3300005563 Bacteria 1720
114 Ga0070664_100098885 3300005564 Bacteria 2535
115 Ga0070664_100115107 3300005564 Bacteria 2350
116 Ga0070664_100135935 3300005564 Bacteria 2161
117 Ga0070664_100138247 3300005564 Bacteria 2143
118 Ga0070664_100182346 3300005564 Bacteria 1866
119 Ga0070664_100472075 3300005564 Bacteria 1154
120 Ga0068857_100044744 3300005577 Bacteria 3928
121 Ga0068857_100072385 3300005577 Bacteria 3071
122 Ga0068854_100000407 3300005578 Bacteria 27035
123 Ga0068854_100062250 3300005578 Bacteria 2704
124 Ga0068854_100081774 3300005578 Bacteria 2387
125 Ga0068854_100099376 3300005578 Bacteria 2179
126 Ga0068854_100540715 3300005578 Bacteria 987
127 Ga0068856_100008811 3300005614 Bacteria 9818
128 Ga0068856_100055279 3300005614 Bacteria 3917
129 Ga0068856_100098758 3300005614 Bacteria 2910
130 Ga0068856_100109127 3300005614 Bacteria 2763
131 Ga0068856_100170969 3300005614 Bacteria 2185
132 Ga0068856_100786154 3300005614 Bacteria 972
133 Ga0068852_100001310 3300005616 Bacteria 16644
134 Ga0068852_100003599 3300005616 Bacteria 10847
135 Ga0068852_100009866 3300005616 Bacteria 7105
136 Ga0068852_100011050 3300005616 Bacteria 6777
137 Ga0068852_100057090 3300005616 Bacteria 3376
138 Ga0068852_100288373 3300005616 Bacteria 1585
139 Ga0068852_100293860 3300005616 Bacteria 1571
140 Ga0068859_100000562 3300005617 Bacteria 36863
141 Ga0068859_100015342 3300005617 Bacteria 7696
142 Ga0068859_100074470 3300005617 Bacteria 3434
143 Ga0068859_100081517 3300005617 Bacteria 3278
144 Ga0068859_100083074 3300005617 Bacteria 3245
145 Ga0068859_100189535 3300005617 Bacteria 2141
146 Ga0068859_100317948 3300005617 Bacteria 1650
147 Ga0068859_101056253 3300005617 Bacteria 893
148 Ga0068864_100001750 3300005618 Bacteria 17852
149 Ga0068864_100010130 3300005618 Bacteria 7783
150 Ga0068864_100074785 3300005618 Bacteria 2956
151 Ga0068864_100079753 3300005618 Bacteria 2867
152 Ga0068861_100001591 3300005719 Bacteria 14449
153 Ga0068861_100013697 3300005719 Bacteria 5680
154 Ga0068851_10069449 3300005834 Bacteria 1820
155 Ga0068870_10085945 3300005840 Bacteria 1749
156 Ga0068863_100000171 3300005841 Bacteria 69589
157 Ga0068863_100014860 3300005841 Bacteria 7480
158 Ga0068863_100024086 3300005841 Bacteria 5807
159 Ga0068863_100066699 3300005841 Bacteria 3404
160 Ga0068863_100167862 3300005841 Bacteria 2105
161 Ga0068858_100001921 3300005842 Bacteria 21183
162 Ga0068858_100007570 3300005842 Bacteria 10490
163 Ga0068860_100002096 3300005843 Bacteria 21013
164 Ga0068860_100031382 3300005843 Bacteria 5108
165 Ga0068860_100079749 3300005843 Bacteria 3113
166 Ga0068860_100128568 3300005843 Bacteria 2429
167 Ga0068860_100156337 3300005843 Bacteria 2197
168 Ga0068862_100000620 3300005844 Bacteria 36954
169 Ga0068862_100004314 3300005844 Bacteria 12034
170 Ga0068862_100106142 3300005844 Bacteria 2462
171 Ga0068862_100122632 3300005844 Bacteria 2292
172 Ga0068862_100155733 3300005844 Bacteria 2037
173 Ga0068862_100217513 3300005844 Bacteria 1728
174 Ga0068862_100245162 3300005844 Bacteria 1631
175 Ga0075367_10001737 3300006178 Bacteria 9548
176 Ga0075370_10017935 3300006353 Bacteria 3832
177 Ga0075431_100046866 3300006847 Bacteria 4457
178 Ga0075433_10023045 3300006852 Bacteria 5236
179 Ga0075434_100616830 3300006871 Bacteria 1104
180 Ga0097620_100000562 3300006931 Bacteria 36863
181 Ga0097620_100015342 3300006931 Bacteria 7696
182 Ga0097620_100074472 3300006931 Bacteria 3434
183 Ga0097620_100081514 3300006931 Bacteria 3278
184 Ga0097620_100083077 3300006931 Bacteria 3245
185 Ga0097620_100189540 3300006931 Bacteria 2141
186 Ga0097620_100317929 3300006931 Bacteria 1650
187 Ga0097620_101056107 3300006931 Bacteria 893
188 Ga0105240_10011412 3300009093 Bacteria 12375
189 Ga0111539_10010144 3300009094 Bacteria 11870
190 Ga0111539_10398852 3300009094 Bacteria 1602
191 Ga0105247_10000486 3300009101 Bacteria 33045
192 Ga0105243_10195492 3300009148 Bacteria 1770
193 Ga0105241_10304448 3300009174 Bacteria 1369
194 Ga0105242_10105183 3300009176 Bacteria 2397
195 Ga0105248_10031307 3300009177 Bacteria 5945
196 Ga0105248_10099824 3300009177 Bacteria 3271
197 Ga0105248_10191394 3300009177 Bacteria 2305
198 Ga0105248_10315643 3300009177 Bacteria 1760
199 Ga0105248_10425105 3300009177 Bacteria 1496
200 Ga0105238_10053738 3300009551 Bacteria 4047
201 Ga0105249_10001853 3300009553 Bacteria 18366
202 Ga0105249_10002126 3300009553 Bacteria 17188
203 Ga0105249_10036893 3300009553 Bacteria 4435
204 Ga0105249_10039993 3300009553 Bacteria 4259
205 Ga0105148_100234 3300009978 Bacteria 7690
206 Ga0105239_10452877 3300010375 Bacteria 1456
207 Ga0157373_10076395 3300013100 Bacteria 2363
208 Ga0157373_10330299 3300013100 Bacteria 1086
209 Ga0157371_10047007 3300013102 Bacteria 3068
210 Ga0157371_10122645 3300013102 Bacteria 1848
211 Ga0157371_10122790 3300013102 Bacteria 1847
212 Ga0157370_10043485 3300013104 Bacteria 4322
213 Ga0157370_10078894 3300013104 Bacteria 3100
214 Ga0157369_10098903 3300013105 Bacteria 3110
215 Ga0157369_10161115 3300013105 Bacteria 2368
216 Ga0157369_10183728 3300013105 Bacteria 2199
217 Ga0157369_10205702 3300013105 Bacteria 2065
218 Ga0157369_10663089 3300013105 Bacteria 1075
219 Ga0157374_10123659 3300013296 Bacteria 2499
220 Ga0157374_10178406 3300013296 Bacteria 2074
221 Ga0163162_10026695 3300013306 Bacteria 5709
222 Ga0163162_10166754 3300013306 Bacteria 2326
223 Ga0163162_10475690 3300013306 Bacteria 1381
224 Ga0157372_10014759 3300013307 Bacteria 8362
225 Ga0157372_10398898 3300013307 Bacteria 1603
226 Ga0157375_10093355 3300013308 Bacteria 3075
227 Ga0157375_10157501 3300013308 Bacteria 2411
228 Ga0163163_10435778 3300014325 Bacteria 1370
229 Ga0157380_10002515 3300014326 Bacteria 12358
230 Ga0157380_10089802 3300014326 Bacteria 2533
231 Ga0157379_10125378 3300014968 Bacteria 2311
232 Ga0157379_10390499 3300014968 Bacteria 1278
233 Ga0163161_10005767 3300017792 Bacteria 8584
234 Ga0163161_10014287 3300017792 Bacteria 5528
235 Ga0206353_10352708 3300020082 Bacteria 1334
236 Ga0213875_10000504 3300021388 Bacteria 32687
237 Ga0207682_10000099 3300025893 Bacteria 38985
238 Ga0207682_10015144 3300025893 Bacteria 3003
239 Ga0207710_10003617 3300025900 Bacteria 6852
240 Ga0207680_10000126 3300025903 Bacteria 35872
241 Ga0207680_10027110 3300025903 Bacteria 3185
242 Ga0207647_10014595 3300025904 Bacteria 5411
243 Ga0207647_10024337 3300025904 Bacteria 3993
244 Ga0207647_10058259 3300025904 Bacteria 2366
245 Ga0207647_10115974 3300025904 Bacteria 1581
246 Ga0207645_10128399 3300025907 Bacteria 1649
247 Ga0207705_10000023 3300025909 Bacteria 301755
248 Ga0207705_10023872 3300025909 Bacteria 4363
249 Ga0207705_10040741 3300025909 Bacteria 3333
250 Ga0207705_10071712 3300025909 Bacteria 2511
251 Ga0207707_10033630 3300025912 Bacteria 4486
252 Ga0207695_10010937 3300025913 Bacteria 11036
253 Ga0207695_10014430 3300025913 Bacteria 9360
254 Ga0207660_10000407 3300025917 Bacteria 28319
255 Ga0207660_10000409 3300025917 Bacteria 28305
256 Ga0207660_10001926 3300025917 Bacteria 13848
257 Ga0207660_10028139 3300025917 Bacteria 3843
258 Ga0207657_10049515 3300025919 Bacteria 3660
259 Ga0207657_10106227 3300025919 Bacteria 2323
260 Ga0207649_10030482 3300025920 Bacteria 3195
261 Ga0207649_10070423 3300025920 Bacteria 2230
262 Ga0207649_10147075 3300025920 Bacteria 1618
263 Ga0207652_10000036 3300025921 Bacteria 134949
264 Ga0207652_10357104 3300025921 Bacteria 1319
265 Ga0207681_10000002 3300025923 Bacteria 985597
266 Ga0207681_10005028 3300025923 Bacteria 8128
267 Ga0207681_10238113 3300025923 Bacteria 1415
268 Ga0207694_10033375 3300025924 Bacteria 3942
269 Ga0207694_10082864 3300025924 Bacteria 2521
270 Ga0207650_10000824 3300025925 Bacteria 23774
271 Ga0207650_10009044 3300025925 Bacteria 6811
272 Ga0207650_10045422 3300025925 Bacteria 3232
273 Ga0207650_10079035 3300025925 Bacteria 2490
274 Ga0207650_10134084 3300025925 Bacteria 1941
275 Ga0207650_10193257 3300025925 Bacteria 1627
276 Ga0207650_10260471 3300025925 Bacteria 1407
277 Ga0207650_10798834 3300025925 Bacteria 800
278 Ga0207659_10003416 3300025926 Bacteria 9513
279 Ga0207659_10096492 3300025926 Bacteria 2219
280 Ga0207659_10628426 3300025926 Bacteria 917
281 Ga0207644_10000002 3300025931 Bacteria 942221
282 Ga0207644_10000046 3300025931 Bacteria 103962
283 Ga0207644_10002778 3300025931 Bacteria 11274
284 Ga0207644_10010447 3300025931 Bacteria 6118
285 Ga0207644_10143452 3300025931 Bacteria 1841
286 Ga0207644_10226775 3300025931 Bacteria 1483
287 Ga0207644_10363167 3300025931 Bacteria 1178
288 Ga0207644_10413396 3300025931 Bacteria 1104
289 Ga0207690_10118720 3300025932 Bacteria 1917
290 Ga0207690_10150086 3300025932 Bacteria 1727
291 Ga0207706_10001246 3300025933 Bacteria 25642
292 Ga0207706_10080539 3300025933 Bacteria 2863
293 Ga0207706_10104322 3300025933 Bacteria 2494
294 Ga0207706_10154968 3300025933 Bacteria 2015
295 Ga0207686_10024204 3300025934 Bacteria 3516
296 Ga0207686_10152888 3300025934 Bacteria 1608
297 Ga0207669_10001195 3300025937 Bacteria 11037
298 Ga0207691_10000098 3300025940 Bacteria 76191
299 Ga0207691_10007701 3300025940 Bacteria 10365
300 Ga0207691_10051249 3300025940 Bacteria 3775
301 Ga0207691_10228204 3300025940 Bacteria 1613
302 Ga0207711_10032303 3300025941 Bacteria 4425
303 Ga0207711_10080955 3300025941 Bacteria 2837
304 Ga0207711_10124567 3300025941 Bacteria 2304
305 Ga0207711_10229899 3300025941 Bacteria 1698
306 Ga0207689_10051153 3300025942 Bacteria 3405
307 Ga0207661_10052495 3300025944 Bacteria 3257
308 Ga0207679_10020172 3300025945 Bacteria 4494
309 Ga0207679_10034283 3300025945 Bacteria 3580
310 Ga0207679_10055548 3300025945 Bacteria 2919
311 Ga0207679_10380928 3300025945 Bacteria 1237
312 Ga0207679_10880954 3300025945 Bacteria 818
313 Ga0207667_10016540 3300025949 Bacteria 8332
314 Ga0207667_10047573 3300025949 Bacteria 4540
315 Ga0207667_10295344 3300025949 Bacteria 1655
316 Ga0207651_10003690 3300025960 Bacteria 7568
317 Ga0207651_10406475 3300025960 Bacteria 1159
318 Ga0207712_10001275 3300025961 Bacteria 17341
319 Ga0207712_10008486 3300025961 Bacteria 6496
320 Ga0207712_10012437 3300025961 Bacteria 5437
321 Ga0207712_10512929 3300025961 Bacteria 1026
322 Ga0207668_10000136 3300025972 Bacteria 50579
323 Ga0207668_10001158 3300025972 Bacteria 15670
324 Ga0207668_10001850 3300025972 Bacteria 12352
325 Ga0207668_10259160 3300025972 Bacteria 1416
326 Ga0207668_10336166 3300025972 Bacteria 1258
327 Ga0207640_10000597 3300025981 Bacteria 21470
328 Ga0207640_10058593 3300025981 Bacteria 2538
329 Ga0207640_10202889 3300025981 Bacteria 1504
330 Ga0207658_10002815 3300025986 Bacteria 12508
331 Ga0207658_10018003 3300025986 Bacteria 4870
332 Ga0207658_10021873 3300025986 Bacteria 4446
333 Ga0207658_10039944 3300025986 Bacteria 3388
334 Ga0207677_10000137 3300026023 Bacteria 59866
335 Ga0207703_10010717 3300026035 Bacteria 7155
336 Ga0207703_10352519 3300026035 Bacteria 1355
337 Ga0207639_10003931 3300026041 Bacteria 10031
338 Ga0207639_10071355 3300026041 Bacteria 2716
339 Ga0207639_10659463 3300026041 Bacteria 968
340 Ga0207639_10868294 3300026041 Bacteria 843
341 Ga0207678_10065608 3300026067 Bacteria 3117
342 Ga0207678_10075172 3300026067 Bacteria 2894
343 Ga0207678_10078730 3300026067 Bacteria 2823
344 Ga0207678_10127897 3300026067 Bacteria 2167
345 Ga0207702_10014114 3300026078 Bacteria 6634
346 Ga0207702_10031575 3300026078 Bacteria 4414
347 Ga0207702_10067800 3300026078 Bacteria 3063
348 Ga0207702_10102610 3300026078 Bacteria 2528
349 Ga0207641_10000001 3300026088 Bacteria 1180841
350 Ga0207641_10005028 3300026088 Bacteria 11332
351 Ga0207648_10025267 3300026089 Bacteria 5292
352 Ga0207648_10060176 3300026089 Bacteria 3312
353 Ga0207676_10000713 3300026095 Bacteria 26068
354 Ga0207676_10005640 3300026095 Bacteria 8859
355 Ga0207676_10039032 3300026095 Bacteria 3629
356 Ga0207676_10255547 3300026095 Bacteria 1579
357 Ga0207676_10329146 3300026095 Bacteria 1405
358 Ga0207674_10092586 3300026116 Bacteria 3012
359 Ga0207674_10098882 3300026116 Bacteria 2901
360 Ga0207674_10427570 3300026116 Bacteria 1280
361 Ga0207674_10575565 3300026116 Bacteria 1088
362 Ga0207674_10765583 3300026116 Bacteria 932
363 Ga0207675_100001412 3300026118 Bacteria 24028
364 Ga0207675_100020294 3300026118 Bacteria 6196
365 Ga0207675_100111370 3300026118 Bacteria 2583
366 Ga0207683_10046605 3300026121 Bacteria 3794
367 Ga0207683_10068070 3300026121 Bacteria 3142
368 Ga0207683_10183931 3300026121 Bacteria 1895
369 Ga0207683_10343144 3300026121 Bacteria 1370
370 Ga0207698_10000141 3300026142 Bacteria 45510
371 Ga0207698_10001346 3300026142 Bacteria 14319
372 Ga0207698_10011831 3300026142 Bacteria 5679
373 Ga0207698_10026323 3300026142 Bacteria 4113
374 Ga0207698_10430979 3300026142 Bacteria 1268
375 Ga0207698_10520580 3300026142 Bacteria 1161
376 Ga0209813_10000100 3300027866 Bacteria 32041
377 Ga0207428_10077873 3300027907 Bacteria 2595
378 Ga0268266_10000430 3300028379 Bacteria 63064
379 Ga0268266_10020971 3300028379 Bacteria 5570
380 Ga0268265_10000226 3300028380 Bacteria 65384
381 Ga0268265_10011093 3300028380 Bacteria 6088
382 Ga0268265_10022206 3300028380 Bacteria 4455
383 Ga0268265_10058717 3300028380 Bacteria 2939
384 Ga0268265_10159362 3300028380 Bacteria 1914
385 Ga0268264_10000010 3300028381 Bacteria 596543
386 Ga0268264_10004011 3300028381 Bacteria 12605
387 Ga0268264_10007396 3300028381 Bacteria 9168
388 Ga0268264_10013332 3300028381 Bacteria 6766
389 Ga0268264_10018716 3300028381 Bacteria 5663
390 Ga0268264_10093144 3300028381 Bacteria 2602
391 Ga0268264_10271115 3300028381 Bacteria 1585
392 Ga0307408_100003317 3300031548 Bacteria 11066
393 Ga0307408_100078959 3300031548 Bacteria 2454
394 Ga0307408_100178840 3300031548 Bacteria 1700
395 Ga0307408_100274602 3300031548 Bacteria 1401
396 Ga0307408_100294751 3300031548 Bacteria 1356
397 Ga0307408_100489316 3300031548 Bacteria 1075
398 Ga0307405_10047211 3300031731 Bacteria 2650
399 Ga0307405_10078251 3300031731 Bacteria 2151
400 Ga0307405_10174535 3300031731 Bacteria 1537
401 Ga0307413_10033118 3300031824 Bacteria 2938
402 Ga0307413_10074001 3300031824 Bacteria 2156
403 Ga0307413_10085509 3300031824 Bacteria 2036
404 Ga0307413_10124942 3300031824 Bacteria 1750
405 Ga0307413_10222642 3300031824 Bacteria 1379
406 Ga0307413_10596283 3300031824 Bacteria 903
407 Ga0307410_10022130 3300031852 Bacteria 3923
408 Ga0307410_10027327 3300031852 Bacteria 3605
409 Ga0307410_10123936 3300031852 Bacteria 1888
410 Ga0307410_10451680 3300031852 Bacteria 1048
411 Ga0307406_10020485 3300031901 Bacteria 3895
412 Ga0307406_10037771 3300031901 Bacteria 2985
413 Ga0307406_10269652 3300031901 Bacteria 1292
414 Ga0307406_10424296 3300031901 Bacteria 1060
415 Ga0307407_10033890 3300031903 Bacteria 2790
416 Ga0307407_10070344 3300031903 Bacteria 2080
417 Ga0307407_10076196 3300031903 Bacteria 2013
418 Ga0307407_10096304 3300031903 Bacteria 1826
419 Ga0307407_10207697 3300031903 Bacteria 1316
420 Ga0307412_10016179 3300031911 Bacteria 4436
421 Ga0307412_10069764 3300031911 Bacteria 2393
422 Ga0307412_10158992 3300031911 Bacteria 1676
423 Ga0307412_10214597 3300031911 Bacteria 1471
424 Ga0307412_10215463 3300031911 Bacteria 1468
425 Ga0307412_10579093 3300031911 Bacteria 947
426 Ga0307412_10642244 3300031911 Bacteria 904
427 Ga0307409_100014216 3300031995 Bacteria 5164
428 Ga0307409_100067986 3300031995 Bacteria 2816
429 Ga0307409_100190937 3300031995 Bacteria 1823
430 Ga0307409_100198339 3300031995 Bacteria 1793
431 Ga0307409_100285264 3300031995 Bacteria 1528
432 Ga0307409_100330504 3300031995 Bacteria 1430
433 Ga0307409_100383987 3300031995 Bacteria 1336
434 Ga0307409_100385858 3300031995 Bacteria 1333
435 Ga0307409_100692501 3300031995 Bacteria 1017
436 Ga0307416_100043264 3300032002 Bacteria 3525
437 Ga0307416_100091591 3300032002 Bacteria 2612
438 Ga0307416_100093120 3300032002 Bacteria 2594
439 Ga0307416_100098409 3300032002 Bacteria 2537
440 Ga0307416_100126182 3300032002 Bacteria 2292
441 Ga0307416_100482217 3300032002 Bacteria 1300
442 Ga0307416_100639843 3300032002 Bacteria 1147
443 Ga0307416_100915326 3300032002 Bacteria 977
444 Ga0307416_101191541 3300032002 Bacteria 867
445 Ga0307414_10008125 3300032004 Bacteria 5929
446 Ga0307414_10013953 3300032004 Bacteria 4799
447 Ga0307414_10023821 3300032004 Bacteria 3890
448 Ga0307414_10060947 3300032004 Bacteria 2671
449 Ga0307414_10090031 3300032004 Bacteria 2276
450 Ga0307414_10103167 3300032004 Bacteria 2151
451 Ga0307414_10645849 3300032004 Bacteria 953
452 Ga0307411_10002973 3300032005 Bacteria 7704
453 Ga0307411_10020154 3300032005 Bacteria 3871
454 Ga0307411_10023102 3300032005 Bacteria 3676
455 Ga0307411_10026005 3300032005 Bacteria 3516
456 Ga0307411_10045181 3300032005 Bacteria 2832
457 Ga0307411_10049173 3300032005 Bacteria 2738
458 Ga0307411_10055016 3300032005 Bacteria 2616
459 Ga0307411_10371473 3300032005 Bacteria 1173
460 Ga0307411_10633672 3300032005 Bacteria 923
461 Ga0307415_100004605 3300032126 Bacteria 7194
462 Ga0307415_100024065 3300032126 Bacteria 3795
463 Ga0307415_100051970 3300032126 Bacteria 2784
464 Ga0307415_100230009 3300032126 Bacteria 1492
465 Ga0307415_100248999 3300032126 Bacteria 1442
466 Ga0373943_0001858 3300035170 Bacteria 9543
467 Ga0316584_0031883 3300036712 Bacteria 3898
468 Ga0395899_0021750 3300037312 Bacteria 4865
469 Ga0395900_0005637 3300037418 Bacteria 13095
470 Ga0395900_0050934 3300037418 Bacteria 4265
471 Ga0395900_0087516 3300037418 Bacteria 3202
472 Ga0395900_0142181 3300037418 Bacteria 2456
473 Ga0395898_0044273 3300037466 Bacteria 4383
474 Ga0395898_0288496 3300037466 Bacteria 1565
475 Ga0395905_0000694 3300037471 Bacteria 44659
476 Ga0395905_0003338 3300037471 Bacteria 17223
477 Ga0395905_0022461 3300037471 Bacteria 5966
478 Ga0395905_0039410 3300037471 Bacteria 4433
479 Ga0395905_0072687 3300037471 Bacteria 3224
480 Ga0395905_0091469 3300037471 Bacteria 2853
481 Ga0395905_0093910 3300037471 Bacteria 2813
482 Ga0395905_0125793 3300037471 Bacteria 2410
483 Ga0395905_0654215 3300037471 Bacteria 953
484 Ga0395905_0832609 3300037471 Bacteria 826
485 Ga0436364_0139430 3300037853 Bacteria 61613
486 Ga0395901_0006994 3300038443 Bacteria 11404
487 Ga0395901_0148542 3300038443 Bacteria 2463
488 Ga0395901_0202665 3300038443 Bacteria 2079
489 Ga0395901_0295957 3300038443 Bacteria 1678
490 Ga0395901_0342812 3300038443 Bacteria 1543
491 Ga0395901_0365363 3300038443 Bacteria 1487
492 Ga0436365_0162678 3300039437 Bacteria 1724
493 Ga0439445_0002839 3300042004 Bacteria 3870
494 Ga0439445_0006593 3300042004 Bacteria 2671
495 Ga0439458_0000168 3300042157 Bacteria 14753
496 Ga0439464_0000182 3300042439 Bacteria 10839
497 Ga0466969_0197175 3300044656 Bacteria 919
498 Ga0466963_0026225 3300044694 Bacteria 3726
499 Ga0466963_0106085 3300044694 Bacteria 1926
500 Ga0466957_0252324 3300044842 Bacteria 1173
501 Ga0466960_0209351 3300044901 Bacteria 1069
502 Ga0466958_0093756 3300045836 Bacteria 1859
503 Ga0466967_0065146 3300045976 Bacteria 3242
504 Ga0466967_0146428 3300045976 Bacteria 2203
505 Ga0466967_0156169 3300045976 Bacteria 2137
506 Ga0466967_0221391 3300045976 Bacteria 1798
507 Ga0466967_0288441 3300045976 Bacteria 1576
508 Ga0466967_0715347 3300045976 Bacteria 992
509 Ga0495585_0087969 3300046492 Bacteria 1676
510 Ga0495585_0097660 3300046492 Bacteria 1575
511 Ga0495632_0000609 3300046519 Bacteria 33106
512 Ga0495637_0020742 3300046520 Bacteria 3017
513 Ga0495643_0000146 3300046522 Bacteria 114508
514 Ga0495663_0000006 3300046525 Bacteria 306938
515 Ga0495663_0003888 3300046525 Bacteria 4257
516 Ga0495663_0025537 3300046525 Bacteria 1723
517 Ga0495665_0199556 3300046531 Bacteria 1037
518 Ga0495598_0000247 3300046537 Bacteria 9702
519 Ga0495598_0005868 3300046537 Bacteria 2746
520 Ga0495621_0000535 3300046539 Bacteria 9412
521 Ga0495621_0000962 3300046539 Bacteria 7337
522 Ga0495621_0001223 3300046539 Bacteria 6621
523 Ga0495621_0008299 3300046539 Bacteria 3108
524 Ga0495633_0000227 3300046558 Bacteria 69862
525 Ga0495633_0000410 3300046558 Bacteria 44691
526 Ga0495633_0000803 3300046558 Bacteria 28051
527 Ga0495633_0036651 3300046558 Bacteria 2349
528 Ga0495633_0065992 3300046558 Bacteria 1690
529 Ga0495668_0005266 3300046616 Bacteria 8849
530 Ga0495669_0001337 3300046684 Bacteria 10208
531 Ga0495669_0034581 3300046684 Bacteria 2228
532 Ga0495670_0011570 3300046691 Bacteria 4340
533 Ga0495670_0019682 3300046691 Bacteria 3326
534 Ga0495670_0025068 3300046691 Bacteria 2950
535 Ga0495671_0000100 3300046692 Bacteria 78876
536 Ga0495677_0016297 3300047445 Bacteria 2696
537 Ga0495677_0020050 3300047445 Bacteria 2423
538 Ga0495681_0027902 3300047470 Bacteria 2915
539 Ga0496101_0184881 3300048904 Bacteria 1606
540 Ga0496105_0192985 3300048908 Bacteria 1665
541 Ga0496107_0020537 3300048910 Bacteria 4667
542 Ga0496109_0109861 3300048912 Bacteria 2563
543 Ga0496112_0104937 3300048915 Bacteria 2796
544 Ga0496112_0286854 3300048915 Bacteria 1592
545 Ga0496115_0000526 3300048918 Bacteria 29746
546 Ga0501223_000036 3300049663 Bacteria 46823
547 Ga0501246_007251 3300049676 Bacteria 964
548 Ga0501225_0000037 3300049705 Bacteria 46276
549 Ga0501204_002530 3300049850 Bacteria 1865
550 nmdc:mga06z11_222_c1 3300050494 Bacteria 22704
551 nmdc:mga04h51_11758_c1 3300050495 Bacteria 2439
552 nmdc:mga06r32_109169_c1 3300050510 Bacteria 2721
553 nmdc:mga08y16_151085_c1 3300050511 Bacteria 2414
554 nmdc:mga08y16_557033_c1 3300050511 Bacteria 1159
555 nmdc:mga0a205_24049_c1 3300050515 Bacteria 5785
556 Ga0500643_000273 3300053087 Bacteria 45054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_10039032 Ga0207676_100390325 198
2 3300035170 Ga0373943_0001858 Ga0373943_0001858_54_701 214
3 3300037471 Ga0395905_0832609 Ga0395905_0832609_18_665 214
4 3300044656 Ga0466969_0197175 Ga0466969_0197175_245_892 214
5 3300044694 Ga0466963_0106085 Ga0466963_0106085_23_670 214
6 3300044842 Ga0466957_0252324 Ga0466957_0252324_479_1129 215
7 3300032004 Ga0307414_10023821 Ga0307414_100238213 224
8 3300032005 Ga0307411_10026005 Ga0307411_100260053 224
9 3300005338 Ga0068868_100000078 Ga0068868_10000007847 225
10 3300026023 Ga0207677_10000137 Ga0207677_100001374 225
11 3300005327 Ga0070658_10000652 Ga0070658_100006526 226
12 3300005563 Ga0068855_100089477 Ga0068855_1000894775 226
13 3300005614 Ga0068856_100008811 Ga0068856_1000088114 226
14 3300005616 Ga0068852_100003599 Ga0068852_1000035992 226
15 3300009093 Ga0105240_10011412 Ga0105240_100114124 226
16 3300009551 Ga0105238_10053738 Ga0105238_100537382 226
17 3300025904 Ga0207647_10014595 Ga0207647_100145956 226
18 3300025909 Ga0207705_10000023 Ga0207705_10000023200 226
19 3300025913 Ga0207695_10010937 Ga0207695_100109372 226
20 3300025924 Ga0207694_10082864 Ga0207694_100828642 226
21 3300025949 Ga0207667_10016540 Ga0207667_100165407 226
22 3300026041 Ga0207639_10659463 Ga0207639_106594631 226
23 3300026078 Ga0207702_10014114 Ga0207702_100141142 226
24 3300026142 Ga0207698_10000141 Ga0207698_100001412 226
25 3300031911 Ga0307412_10642244 Ga0307412_106422441 228
26 3300049850 Ga0501204_002530 Ga0501204_002530_447_1133 228
27 3300005344 Ga0070661_100041512 Ga0070661_1000415124 229
28 3300005366 Ga0070659_100080345 Ga0070659_1000803453 229
29 3300005457 Ga0070662_100355685 Ga0070662_1003556852 229
30 3300005578 Ga0068854_100540715 Ga0068854_1005407152 229
31 3300005616 Ga0068852_100011050 Ga0068852_1000110502 229
32 3300005616 Ga0068852_100293860 Ga0068852_1002938601 229
33 3300005834 Ga0068851_10069449 Ga0068851_100694492 229
34 3300013102 Ga0157371_10122645 Ga0157371_101226452 229
35 3300013307 Ga0157372_10398898 Ga0157372_103988981 229
36 3300025920 Ga0207649_10147075 Ga0207649_101470752 229
37 3300025933 Ga0207706_10154968 Ga0207706_101549682 229
38 3300026116 Ga0207674_10427570 Ga0207674_104275702 229
39 3300028379 Ga0268266_10000430 Ga0268266_1000043062 229
40 3300005544 Ga0070686_100000143 Ga0070686_10000014322 231
41 3300005335 Ga0070666_10000338 Ga0070666_1000033810 232
42 3300005353 Ga0070669_100000008 Ga0070669_100000008221 232
43 3300005355 Ga0070671_100000010 Ga0070671_10000001051 232
44 3300005544 Ga0070686_100097065 Ga0070686_1000970652 232
45 3300005617 Ga0068859_100000562 Ga0068859_10000056211 232
46 3300005618 Ga0068864_100001750 Ga0068864_1000017502 232
47 3300005719 Ga0068861_100001591 Ga0068861_10000159111 232
48 3300005841 Ga0068863_100014860 Ga0068863_1000148605 232
49 3300005842 Ga0068858_100001921 Ga0068858_1000019212 232
50 3300005843 Ga0068860_100002096 Ga0068860_1000020963 232
51 3300005844 Ga0068862_100000620 Ga0068862_1000006202 232
52 3300006931 Ga0097620_100000562 Ga0097620_10000056211 232
53 3300009101 Ga0105247_10000486 Ga0105247_100004866 232
54 3300009177 Ga0105248_10425105 Ga0105248_104251051 232
55 3300009553 Ga0105249_10002126 Ga0105249_100021266 232
56 3300010375 Ga0105239_10452877 Ga0105239_104528772 232
57 3300013306 Ga0163162_10026695 Ga0163162_100266952 232
58 3300025900 Ga0207710_10003617 Ga0207710_100036178 232
59 3300025903 Ga0207680_10000126 Ga0207680_100001269 232
60 3300025923 Ga0207681_10000002 Ga0207681_10000002315 232
61 3300025925 Ga0207650_10000824 Ga0207650_100008247 232
62 3300025931 Ga0207644_10000002 Ga0207644_10000002313 232
63 3300025941 Ga0207711_10124567 Ga0207711_101245672 232
64 3300025961 Ga0207712_10001275 Ga0207712_1000127512 232
65 3300025972 Ga0207668_10001158 Ga0207668_1000115812 232
66 3300025986 Ga0207658_10002815 Ga0207658_100028157 232
67 3300026035 Ga0207703_10352519 Ga0207703_103525192 232
68 3300026088 Ga0207641_10005028 Ga0207641_100050283 232
69 3300026095 Ga0207676_10000713 Ga0207676_1000071328 232
70 3300026118 Ga0207675_100001412 Ga0207675_10000141212 232
71 3300028379 Ga0268266_10020971 Ga0268266_100209712 232
72 3300028380 Ga0268265_10000226 Ga0268265_1000022650 232
73 3300028381 Ga0268264_10000010 Ga0268264_10000010529 232
74 3300031852 Ga0307410_10022130 Ga0307410_100221304 232
75 3300031901 Ga0307406_10269652 Ga0307406_102696522 232
76 3300031903 Ga0307407_10070344 Ga0307407_100703442 232
77 3300046539 Ga0495621_0008299 Ga0495621_0008299_679_1419 232
78 3300046684 Ga0495669_0034581 Ga0495669_0034581_1395_2135 232
79 3300046691 Ga0495670_0019682 Ga0495670_0019682_1012_1752 232
80 3300032004 Ga0307414_10013953 Ga0307414_100139531 233
81 3300037471 Ga0395905_0654215 Ga0395905_0654215_161_871 233
82 3300037471 Ga0395905_0125793 Ga0395905_0125793_1374_2126 236
83 iso_pu_bacteria 2848297114 2848298521 236
84 3300005289 Ga0065704_10001524 Ga0065704_100015244 237
85 3300009978 Ga0105148_100234 Ga0105148_1002345 237
86 3300026089 Ga0207648_10060176 Ga0207648_100601762 237
87 3300046519 Ga0495632_0000609 Ga0495632_0000609_942_1676 237
88 3300046520 Ga0495637_0020742 Ga0495637_0020742_1585_2319 237
89 3300046522 Ga0495643_0000146 Ga0495643_0000146_28734_29468 237
90 3300046525 Ga0495663_0000006 Ga0495663_0000006_205189_205923 237
91 3300046558 Ga0495633_0000227 Ga0495633_0000227_9032_9766 237
92 3300046558 Ga0495633_0000410 Ga0495633_0000410_13394_14128 237
93 3300046558 Ga0495633_0065992 Ga0495633_0065992_902_1636 237
94 3300046692 Ga0495671_0000100 Ga0495671_0000100_23352_24086 237
95 3300047470 Ga0495681_0027902 Ga0495681_0027902_2003_2737 237
96 3300049663 Ga0501223_000036 Ga0501223_000036_45147_45881 237
97 3300049676 Ga0501246_007251 Ga0501246_007251_48_782 237
98 3300049705 Ga0501225_0000037 Ga0501225_0000037_44636_45370 237
99 3300050494 nmdc:mga06z11_222_c1 nmdc:mga06z11_222_c1_20416_21156 237
100 3300050495 nmdc:mga04h51_11758_c1 nmdc:mga04h51_11758_c1_819_1559 237
101 3300005335 Ga0070666_10089154 Ga0070666_100891542 238
102 3300005578 Ga0068854_100000407 Ga0068854_10000040725 238
103 3300025940 Ga0207691_10228204 Ga0207691_102282042 238
104 3300025981 Ga0207640_10000597 Ga0207640_100005975 238
105 3300031852 Ga0307410_10123936 Ga0307410_101239363 238
106 3300031903 Ga0307407_10207697 Ga0307407_102076972 238
107 3300031911 Ga0307412_10158992 Ga0307412_101589922 238
108 3300031911 Ga0307412_10579093 Ga0307412_105790931 238
109 3300031995 Ga0307409_100067986 Ga0307409_1000679862 238
110 3300032002 Ga0307416_100126182 Ga0307416_1001261824 238
111 3300036712 Ga0316584_0031883 Ga0316584_0031883_1431_2192 238
112 iso_pu_bacteria 2896429255 2896430386 239
113 3300005539 Ga0068853_100436009 Ga0068853_1004360092 240
114 3300006178 Ga0075367_10001737 Ga0075367_100017374 240
115 3300006353 Ga0075370_10017935 Ga0075370_100179352 240
116 3300021388 Ga0213875_10000504 Ga0213875_1000050429 240
117 3300027866 Ga0209813_10000100 Ga0209813_100001002 240
118 3300037853 Ga0436364_0139430 Ga0436364_0139430_12749_13480 240
119 3300005331 Ga0070670_100173460 Ga0070670_1001734602 241
120 3300005336 Ga0070680_100000443 Ga0070680_10000044323 241
121 3300005347 Ga0070668_100000111 Ga0070668_10000011113 241
122 3300005355 Ga0070671_100000130 Ga0070671_1000001302 241
123 3300005366 Ga0070659_100544969 Ga0070659_1005449692 241
124 3300005530 Ga0070679_100000005 Ga0070679_10000000588 241
125 3300005548 Ga0070665_100400299 Ga0070665_1004002992 241
126 3300005614 Ga0068856_100109127 Ga0068856_1001091274 241
127 3300005617 Ga0068859_100081517 Ga0068859_1000815172 241
128 3300005617 Ga0068859_101056253 Ga0068859_1010562532 241
129 3300005841 Ga0068863_100000171 Ga0068863_10000017138 241
130 3300005843 Ga0068860_100156337 Ga0068860_1001563372 241
131 3300005844 Ga0068862_100122632 Ga0068862_1001226322 241
132 3300006871 Ga0075434_100616830 Ga0075434_1006168301 241
133 3300006931 Ga0097620_100081514 Ga0097620_1000815142 241
134 3300006931 Ga0097620_101056107 Ga0097620_1010561071 241
135 3300009553 Ga0105249_10039993 Ga0105249_100399932 241
136 3300013104 Ga0157370_10078894 Ga0157370_100788942 241
137 3300013105 Ga0157369_10098903 Ga0157369_100989032 241
138 3300013105 Ga0157369_10161115 Ga0157369_101611152 241
139 3300025917 Ga0207660_10000407 Ga0207660_1000040723 241
140 3300025921 Ga0207652_10000036 Ga0207652_1000003687 241
141 3300025925 Ga0207650_10193257 Ga0207650_101932572 241
142 3300025931 Ga0207644_10000046 Ga0207644_100000467 241
143 3300025961 Ga0207712_10012437 Ga0207712_100124372 241
144 3300025972 Ga0207668_10000136 Ga0207668_1000013613 241
145 3300026078 Ga0207702_10102610 Ga0207702_101026102 241
146 3300026088 Ga0207641_10000001 Ga0207641_10000001307 241
147 3300028380 Ga0268265_10058717 Ga0268265_100587173 241
148 3300028381 Ga0268264_10093144 Ga0268264_100931442 241
149 3300031911 Ga0307412_10069764 Ga0307412_100697644 241
150 3300037418 Ga0395900_0050934 Ga0395900_0050934_455_1189 241
151 3300037471 Ga0395905_0039410 Ga0395905_0039410_1232_1966 241
152 3300039437 Ga0436365_0162678 Ga0436365_0162678_144_881 241
153 3300042004 Ga0439445_0002839 Ga0439445_0002839_484_1218 241
154 3300005459 Ga0068867_100566758 Ga0068867_1005667581 242
155 3300037418 Ga0395900_0142181 Ga0395900_0142181_449_1186 242
156 3300037471 Ga0395905_0093910 Ga0395905_0093910_673_1410 242
157 3300038443 Ga0395901_0365363 Ga0395901_0365363_731_1468 242
158 3300044901 Ga0466960_0209351 Ga0466960_0209351_130_858 242
159 3300001977 JGI24746J21847_1003982 JGI24746J21847_10039824 243
160 3300001979 JGI24740J21852_10005517 JGI24740J21852_100055173 243
161 3300001990 JGI24737J22298_10010598 JGI24737J22298_100105982 243
162 3300002074 JGI24748J21848_1004790 JGI24748J21848_10047902 243
163 3300002076 JGI24749J21850_1000797 JGI24749J21850_10007974 243
164 3300002239 JGI24034J26672_10003049 JGI24034J26672_100030492 243
165 3300005290 Ga0065712_10096552 Ga0065712_100965522 243
166 3300005290 Ga0065712_10178722 Ga0065712_101787221 243
167 3300005293 Ga0065715_10000437 Ga0065715_100004379 243
168 3300005293 Ga0065715_10019777 Ga0065715_100197772 243
169 3300005327 Ga0070658_10052428 Ga0070658_100524283 243
170 3300005327 Ga0070658_10178663 Ga0070658_101786633 243
171 3300005327 Ga0070658_10527963 Ga0070658_105279631 243
172 3300005328 Ga0070676_10010394 Ga0070676_100103947 243
173 3300005328 Ga0070676_10163194 Ga0070676_101631941 243
174 3300005329 Ga0070683_100066368 Ga0070683_1000663684 243
175 3300005329 Ga0070683_100498925 Ga0070683_1004989252 243
176 3300005331 Ga0070670_100010306 Ga0070670_1000103066 243
177 3300005331 Ga0070670_100024986 Ga0070670_1000249863 243
178 3300005331 Ga0070670_100053167 Ga0070670_1000531672 243
179 3300005331 Ga0070670_100059536 Ga0070670_1000595362 243
180 3300005331 Ga0070670_100091611 Ga0070670_1000916112 243
181 3300005331 Ga0070670_100278448 Ga0070670_1002784481 243
182 3300005331 Ga0070670_100483758 Ga0070670_1004837581 243
183 3300005333 Ga0070677_10000216 Ga0070677_100002168 243
184 3300005333 Ga0070677_10008975 Ga0070677_100089753 243
185 3300005334 Ga0068869_100040743 Ga0068869_1000407433 243
186 3300005335 Ga0070666_10029136 Ga0070666_100291364 243
187 3300005336 Ga0070680_100000206 Ga0070680_1000002062 243
188 3300005336 Ga0070680_100006448 Ga0070680_1000064482 243
189 3300005336 Ga0070680_100050303 Ga0070680_1000503034 243
190 3300005336 Ga0070680_100147071 Ga0070680_1001470712 243
191 3300005337 Ga0070682_100044095 Ga0070682_1000440952 243
192 3300005339 Ga0070660_100021766 Ga0070660_1000217664 243
193 3300005339 Ga0070660_100525695 Ga0070660_1005256951 243
194 3300005341 Ga0070691_10024768 Ga0070691_100247682 243
195 3300005344 Ga0070661_100101408 Ga0070661_1001014082 243
196 3300005345 Ga0070692_10035801 Ga0070692_100358014 243
197 3300005345 Ga0070692_10143720 Ga0070692_101437202 243
198 3300005347 Ga0070668_100003513 Ga0070668_1000035137 243
199 3300005347 Ga0070668_100084813 Ga0070668_1000848132 243
200 3300005353 Ga0070669_100007340 Ga0070669_1000073403 243
201 3300005353 Ga0070669_100008619 Ga0070669_1000086196 243
202 3300005354 Ga0070675_100000755 Ga0070675_10000075519 243
203 3300005355 Ga0070671_100004083 Ga0070671_1000040839 243
204 3300005355 Ga0070671_100035934 Ga0070671_1000359344 243
205 3300005355 Ga0070671_100113014 Ga0070671_1001130142 243
206 3300005355 Ga0070671_100257278 Ga0070671_1002572782 243
207 3300005355 Ga0070671_100318661 Ga0070671_1003186612 243
208 3300005356 Ga0070674_100001314 Ga0070674_1000013146 243
209 3300005364 Ga0070673_100003762 Ga0070673_1000037628 243
210 3300005364 Ga0070673_100191963 Ga0070673_1001919632 243
211 3300005366 Ga0070659_100036861 Ga0070659_1000368614 243
212 3300005366 Ga0070659_100130197 Ga0070659_1001301971 243
213 3300005367 Ga0070667_100005131 Ga0070667_1000051316 243
214 3300005367 Ga0070667_100010168 Ga0070667_1000101686 243
215 3300005367 Ga0070667_100068425 Ga0070667_1000684252 243
216 3300005455 Ga0070663_100031740 Ga0070663_1000317404 243
217 3300005455 Ga0070663_100037789 Ga0070663_1000377892 243
218 3300005455 Ga0070663_100053019 Ga0070663_1000530192 243
219 3300005455 Ga0070663_100130998 Ga0070663_1001309982 243
220 3300005456 Ga0070678_100048185 Ga0070678_1000481851 243
221 3300005456 Ga0070678_100048233 Ga0070678_1000482332 243
222 3300005456 Ga0070678_100086082 Ga0070678_1000860822 243
223 3300005456 Ga0070678_100151620 Ga0070678_1001516201 243
224 3300005457 Ga0070662_100006332 Ga0070662_1000063322 243
225 3300005457 Ga0070662_100054403 Ga0070662_1000544032 243
226 3300005457 Ga0070662_100059163 Ga0070662_1000591632 243
227 3300005457 Ga0070662_100101076 Ga0070662_1001010763 243
228 3300005458 Ga0070681_10043310 Ga0070681_100433106 243
229 3300005459 Ga0068867_100037133 Ga0068867_1000371333 243
230 3300005466 Ga0070685_10347684 Ga0070685_103476842 243
231 3300005530 Ga0070679_100092537 Ga0070679_1000925372 243
232 3300005530 Ga0070679_100139726 Ga0070679_1001397262 243
233 3300005530 Ga0070679_100200127 Ga0070679_1002001273 243
234 3300005535 Ga0070684_100220511 Ga0070684_1002205112 243
235 3300005535 Ga0070684_100554229 Ga0070684_1005542292 243
236 3300005539 Ga0068853_100114524 Ga0068853_1001145242 243
237 3300005543 Ga0070672_100004800 Ga0070672_1000048006 243
238 3300005544 Ga0070686_100247776 Ga0070686_1002477762 243
239 3300005546 Ga0070696_100088525 Ga0070696_1000885252 243
240 3300005546 Ga0070696_100351172 Ga0070696_1003511722 243
241 3300005547 Ga0070693_100050156 Ga0070693_1000501564 243
242 3300005547 Ga0070693_100096906 Ga0070693_1000969061 243
243 3300005548 Ga0070665_100039876 Ga0070665_1000398762 243
244 3300005548 Ga0070665_100327274 Ga0070665_1003272742 243
245 3300005548 Ga0070665_100481420 Ga0070665_1004814202 243
246 3300005563 Ga0068855_100125690 Ga0068855_1001256902 243
247 3300005563 Ga0068855_100209145 Ga0068855_1002091454 243
248 3300005563 Ga0068855_100237759 Ga0068855_1002377592 243
249 3300005563 Ga0068855_100318273 Ga0068855_1003182732 243
250 3300005564 Ga0070664_100098885 Ga0070664_1000988852 243
251 3300005564 Ga0070664_100115107 Ga0070664_1001151072 243
252 3300005564 Ga0070664_100135935 Ga0070664_1001359354 243
253 3300005564 Ga0070664_100138247 Ga0070664_1001382472 243
254 3300005564 Ga0070664_100182346 Ga0070664_1001823462 243
255 3300005564 Ga0070664_100472075 Ga0070664_1004720752 243
256 3300005577 Ga0068857_100044744 Ga0068857_1000447444 243
257 3300005577 Ga0068857_100072385 Ga0068857_1000723852 243
258 3300005578 Ga0068854_100062250 Ga0068854_1000622504 243
259 3300005578 Ga0068854_100081774 Ga0068854_1000817742 243
260 3300005578 Ga0068854_100099376 Ga0068854_1000993762 243
261 3300005614 Ga0068856_100055279 Ga0068856_1000552792 243
262 3300005614 Ga0068856_100098758 Ga0068856_1000987582 243
263 3300005614 Ga0068856_100170969 Ga0068856_1001709692 243
264 3300005614 Ga0068856_100786154 Ga0068856_1007861542 243
265 3300005616 Ga0068852_100001310 Ga0068852_10000131017 243
266 3300005616 Ga0068852_100009866 Ga0068852_1000098666 243
267 3300005616 Ga0068852_100057090 Ga0068852_1000570902 243
268 3300005616 Ga0068852_100288373 Ga0068852_1002883732 243
269 3300005617 Ga0068859_100015342 Ga0068859_1000153426 243
270 3300005617 Ga0068859_100074470 Ga0068859_1000744702 243
271 3300005617 Ga0068859_100083074 Ga0068859_1000830744 243
272 3300005617 Ga0068859_100189535 Ga0068859_1001895352 243
273 3300005617 Ga0068859_100317948 Ga0068859_1003179482 243
274 3300005618 Ga0068864_100010130 Ga0068864_1000101302 243
275 3300005618 Ga0068864_100074785 Ga0068864_1000747853 243
276 3300005618 Ga0068864_100079753 Ga0068864_1000797533 243
277 3300005719 Ga0068861_100013697 Ga0068861_1000136974 243
278 3300005840 Ga0068870_10085945 Ga0068870_100859452 243
279 3300005841 Ga0068863_100024086 Ga0068863_1000240867 243
280 3300005841 Ga0068863_100066699 Ga0068863_1000666993 243
281 3300005841 Ga0068863_100167862 Ga0068863_1001678622 243
282 3300005842 Ga0068858_100007570 Ga0068858_1000075706 243
283 3300005843 Ga0068860_100031382 Ga0068860_1000313826 243
284 3300005843 Ga0068860_100079749 Ga0068860_1000797493 243
285 3300005843 Ga0068860_100128568 Ga0068860_1001285683 243
286 3300005844 Ga0068862_100004314 Ga0068862_1000043146 243
287 3300005844 Ga0068862_100106142 Ga0068862_1001061422 243
288 3300005844 Ga0068862_100155733 Ga0068862_1001557331 243
289 3300005844 Ga0068862_100217513 Ga0068862_1002175132 243
290 3300005844 Ga0068862_100245162 Ga0068862_1002451622 243
291 3300006847 Ga0075431_100046866 Ga0075431_1000468662 243
292 3300006852 Ga0075433_10023045 Ga0075433_100230454 243
293 3300006931 Ga0097620_100015342 Ga0097620_1000153426 243
294 3300006931 Ga0097620_100074472 Ga0097620_1000744722 243
295 3300006931 Ga0097620_100083077 Ga0097620_1000830774 243
296 3300006931 Ga0097620_100189540 Ga0097620_1001895402 243
297 3300006931 Ga0097620_100317929 Ga0097620_1003179292 243
298 3300009094 Ga0111539_10010144 Ga0111539_100101446 243
299 3300009094 Ga0111539_10398852 Ga0111539_103988522 243
300 3300009148 Ga0105243_10195492 Ga0105243_101954922 243
301 3300009174 Ga0105241_10304448 Ga0105241_103044482 243
302 3300009176 Ga0105242_10105183 Ga0105242_101051832 243
303 3300009177 Ga0105248_10031307 Ga0105248_100313074 243
304 3300009177 Ga0105248_10099824 Ga0105248_100998245 243
305 3300009177 Ga0105248_10191394 Ga0105248_101913942 243
306 3300009177 Ga0105248_10315643 Ga0105248_103156432 243
307 3300009553 Ga0105249_10001853 Ga0105249_1000185318 243
308 3300009553 Ga0105249_10036893 Ga0105249_100368932 243
309 3300013100 Ga0157373_10076395 Ga0157373_100763953 243
310 3300013100 Ga0157373_10330299 Ga0157373_103302992 243
311 3300013102 Ga0157371_10047007 Ga0157371_100470072 243
312 3300013102 Ga0157371_10122790 Ga0157371_101227902 243
313 3300013104 Ga0157370_10043485 Ga0157370_100434853 243
314 3300013105 Ga0157369_10183728 Ga0157369_101837282 243
315 3300013105 Ga0157369_10205702 Ga0157369_102057022 243
316 3300013105 Ga0157369_10663089 Ga0157369_106630892 243
317 3300013296 Ga0157374_10123659 Ga0157374_101236593 243
318 3300013296 Ga0157374_10178406 Ga0157374_101784061 243
319 3300013306 Ga0163162_10166754 Ga0163162_101667542 243
320 3300013306 Ga0163162_10475690 Ga0163162_104756902 243
321 3300013307 Ga0157372_10014759 Ga0157372_100147596 243
322 3300013308 Ga0157375_10093355 Ga0157375_100933552 243
323 3300013308 Ga0157375_10157501 Ga0157375_101575013 243
324 3300014325 Ga0163163_10435778 Ga0163163_104357782 243
325 3300014326 Ga0157380_10002515 Ga0157380_100025156 243
326 3300014326 Ga0157380_10089802 Ga0157380_100898022 243
327 3300014968 Ga0157379_10125378 Ga0157379_101253782 243
328 3300014968 Ga0157379_10390499 Ga0157379_103904992 243
329 3300017792 Ga0163161_10005767 Ga0163161_100057676 243
330 3300017792 Ga0163161_10014287 Ga0163161_100142877 243
331 3300020082 Ga0206353_10352708 Ga0206353_103527082 243
332 3300025893 Ga0207682_10000099 Ga0207682_1000009917 243
333 3300025893 Ga0207682_10015144 Ga0207682_100151442 243
334 3300025903 Ga0207680_10027110 Ga0207680_100271104 243
335 3300025904 Ga0207647_10024337 Ga0207647_100243372 243
336 3300025904 Ga0207647_10058259 Ga0207647_100582594 243
337 3300025904 Ga0207647_10115974 Ga0207647_101159742 243
338 3300025907 Ga0207645_10128399 Ga0207645_101283992 243
339 3300025909 Ga0207705_10023872 Ga0207705_100238722 243
340 3300025909 Ga0207705_10040741 Ga0207705_100407413 243
341 3300025909 Ga0207705_10071712 Ga0207705_100717123 243
342 3300025912 Ga0207707_10033630 Ga0207707_100336301 243
343 3300025913 Ga0207695_10014430 Ga0207695_1001443010 243
344 3300025917 Ga0207660_10000409 Ga0207660_1000040912 243
345 3300025917 Ga0207660_10001926 Ga0207660_1000192613 243
346 3300025917 Ga0207660_10028139 Ga0207660_100281393 243
347 3300025919 Ga0207657_10049515 Ga0207657_100495153 243
348 3300025919 Ga0207657_10106227 Ga0207657_101062273 243
349 3300025920 Ga0207649_10030482 Ga0207649_100304822 243
350 3300025920 Ga0207649_10070423 Ga0207649_100704234 243
351 3300025921 Ga0207652_10357104 Ga0207652_103571042 243
352 3300025923 Ga0207681_10005028 Ga0207681_100050284 243
353 3300025923 Ga0207681_10238113 Ga0207681_102381132 243
354 3300025924 Ga0207694_10033375 Ga0207694_100333752 243
355 3300025925 Ga0207650_10009044 Ga0207650_100090442 243
356 3300025925 Ga0207650_10045422 Ga0207650_100454222 243
357 3300025925 Ga0207650_10079035 Ga0207650_100790354 243
358 3300025925 Ga0207650_10134084 Ga0207650_101340842 243
359 3300025925 Ga0207650_10260471 Ga0207650_102604711 243
360 3300025925 Ga0207650_10798834 Ga0207650_107988341 243
361 3300025926 Ga0207659_10003416 Ga0207659_100034164 243
362 3300025926 Ga0207659_10096492 Ga0207659_100964922 243
363 3300025926 Ga0207659_10628426 Ga0207659_106284261 243
364 3300025931 Ga0207644_10002778 Ga0207644_100027787 243
365 3300025931 Ga0207644_10010447 Ga0207644_100104477 243
366 3300025931 Ga0207644_10143452 Ga0207644_101434522 243
367 3300025931 Ga0207644_10226775 Ga0207644_102267752 243
368 3300025931 Ga0207644_10363167 Ga0207644_103631672 243
369 3300025931 Ga0207644_10413396 Ga0207644_104133962 243
370 3300025932 Ga0207690_10118720 Ga0207690_101187201 243
371 3300025932 Ga0207690_10150086 Ga0207690_101500862 243
372 3300025933 Ga0207706_10001246 Ga0207706_1000124623 243
373 3300025933 Ga0207706_10080539 Ga0207706_100805394 243
374 3300025933 Ga0207706_10104322 Ga0207706_101043222 243
375 3300025934 Ga0207686_10024204 Ga0207686_100242042 243
376 3300025934 Ga0207686_10152888 Ga0207686_101528882 243
377 3300025937 Ga0207669_10001195 Ga0207669_100011958 243
378 3300025940 Ga0207691_10000098 Ga0207691_1000009811 243
379 3300025940 Ga0207691_10007701 Ga0207691_100077018 243
380 3300025940 Ga0207691_10051249 Ga0207691_100512492 243
381 3300025941 Ga0207711_10032303 Ga0207711_100323033 243
382 3300025941 Ga0207711_10080955 Ga0207711_100809552 243
383 3300025941 Ga0207711_10229899 Ga0207711_102298992 243
384 3300025942 Ga0207689_10051153 Ga0207689_100511533 243
385 3300025944 Ga0207661_10052495 Ga0207661_100524954 243
386 3300025945 Ga0207679_10020172 Ga0207679_100201724 243
387 3300025945 Ga0207679_10034283 Ga0207679_100342833 243
388 3300025945 Ga0207679_10055548 Ga0207679_100555481 243
389 3300025945 Ga0207679_10380928 Ga0207679_103809282 243
390 3300025945 Ga0207679_10880954 Ga0207679_108809541 243
391 3300025949 Ga0207667_10047573 Ga0207667_100475734 243
392 3300025949 Ga0207667_10295344 Ga0207667_102953442 243
393 3300025960 Ga0207651_10003690 Ga0207651_100036908 243
394 3300025960 Ga0207651_10406475 Ga0207651_104064751 243
395 3300025961 Ga0207712_10008486 Ga0207712_100084868 243
396 3300025961 Ga0207712_10512929 Ga0207712_105129292 243
397 3300025972 Ga0207668_10001850 Ga0207668_100018508 243
398 3300025972 Ga0207668_10259160 Ga0207668_102591602 243
399 3300025972 Ga0207668_10336166 Ga0207668_103361661 243
400 3300025981 Ga0207640_10058593 Ga0207640_100585932 243
401 3300025981 Ga0207640_10202889 Ga0207640_102028892 243
402 3300025986 Ga0207658_10018003 Ga0207658_100180032 243
403 3300025986 Ga0207658_10021873 Ga0207658_100218734 243
404 3300025986 Ga0207658_10039944 Ga0207658_100399442 243
405 3300026035 Ga0207703_10010717 Ga0207703_100107175 243
406 3300026041 Ga0207639_10003931 Ga0207639_100039316 243
407 3300026041 Ga0207639_10071355 Ga0207639_100713553 243
408 3300026041 Ga0207639_10868294 Ga0207639_108682941 243
409 3300026067 Ga0207678_10065608 Ga0207678_100656083 243
410 3300026067 Ga0207678_10075172 Ga0207678_100751722 243
411 3300026067 Ga0207678_10078730 Ga0207678_100787302 243
412 3300026067 Ga0207678_10127897 Ga0207678_101278974 243
413 3300026078 Ga0207702_10031575 Ga0207702_100315753 243
414 3300026078 Ga0207702_10067800 Ga0207702_100678003 243
415 3300026089 Ga0207648_10025267 Ga0207648_100252673 243
416 3300026095 Ga0207676_10005640 Ga0207676_100056406 243
417 3300026095 Ga0207676_10255547 Ga0207676_102555472 243
418 3300026095 Ga0207676_10329146 Ga0207676_103291462 243
419 3300026116 Ga0207674_10092586 Ga0207674_100925862 243
420 3300026116 Ga0207674_10098882 Ga0207674_100988822 243
421 3300026116 Ga0207674_10575565 Ga0207674_105755652 243
422 3300026116 Ga0207674_10765583 Ga0207674_107655831 243
423 3300026118 Ga0207675_100020294 Ga0207675_1000202944 243
424 3300026118 Ga0207675_100111370 Ga0207675_1001113702 243
425 3300026121 Ga0207683_10046605 Ga0207683_100466052 243
426 3300026121 Ga0207683_10068070 Ga0207683_100680702 243
427 3300026121 Ga0207683_10183931 Ga0207683_101839312 243
428 3300026121 Ga0207683_10343144 Ga0207683_103431441 243
429 3300026142 Ga0207698_10001346 Ga0207698_1000134611 243
430 3300026142 Ga0207698_10011831 Ga0207698_100118313 243
431 3300026142 Ga0207698_10026323 Ga0207698_100263233 243
432 3300026142 Ga0207698_10430979 Ga0207698_104309791 243
433 3300026142 Ga0207698_10520580 Ga0207698_105205802 243
434 3300027907 Ga0207428_10077873 Ga0207428_100778734 243
435 3300028380 Ga0268265_10011093 Ga0268265_100110933 243
436 3300028380 Ga0268265_10022206 Ga0268265_100222062 243
437 3300028380 Ga0268265_10159362 Ga0268265_101593622 243
438 3300028381 Ga0268264_10004011 Ga0268264_100040119 243
439 3300028381 Ga0268264_10007396 Ga0268264_100073966 243
440 3300028381 Ga0268264_10013332 Ga0268264_100133326 243
441 3300028381 Ga0268264_10018716 Ga0268264_100187163 243
442 3300028381 Ga0268264_10271115 Ga0268264_102711151 243
443 3300031548 Ga0307408_100003317 Ga0307408_1000033171 243
444 3300031548 Ga0307408_100078959 Ga0307408_1000789593 243
445 3300031548 Ga0307408_100178840 Ga0307408_1001788402 243
446 3300031548 Ga0307408_100274602 Ga0307408_1002746022 243
447 3300031548 Ga0307408_100294751 Ga0307408_1002947512 243
448 3300031548 Ga0307408_100489316 Ga0307408_1004893162 243
449 3300031731 Ga0307405_10047211 Ga0307405_100472113 243
450 3300031731 Ga0307405_10078251 Ga0307405_100782513 243
451 3300031731 Ga0307405_10174535 Ga0307405_101745352 243
452 3300031824 Ga0307413_10033118 Ga0307413_100331182 243
453 3300031824 Ga0307413_10074001 Ga0307413_100740013 243
454 3300031824 Ga0307413_10085509 Ga0307413_100855093 243
455 3300031824 Ga0307413_10124942 Ga0307413_101249422 243
456 3300031824 Ga0307413_10222642 Ga0307413_102226421 243
457 3300031824 Ga0307413_10596283 Ga0307413_105962831 243
458 3300031852 Ga0307410_10027327 Ga0307410_100273274 243
459 3300031852 Ga0307410_10451680 Ga0307410_104516801 243
460 3300031901 Ga0307406_10020485 Ga0307406_100204852 243
461 3300031901 Ga0307406_10037771 Ga0307406_100377713 243
462 3300031901 Ga0307406_10424296 Ga0307406_104242962 243
463 3300031903 Ga0307407_10033890 Ga0307407_100338902 243
464 3300031903 Ga0307407_10076196 Ga0307407_100761962 243
465 3300031903 Ga0307407_10096304 Ga0307407_100963042 243
466 3300031911 Ga0307412_10016179 Ga0307412_100161792 243
467 3300031911 Ga0307412_10214597 Ga0307412_102145972 243
468 3300031911 Ga0307412_10215463 Ga0307412_102154632 243
469 3300031995 Ga0307409_100014216 Ga0307409_1000142165 243
470 3300031995 Ga0307409_100190937 Ga0307409_1001909372 243
471 3300031995 Ga0307409_100198339 Ga0307409_1001983393 243
472 3300031995 Ga0307409_100285264 Ga0307409_1002852642 243
473 3300031995 Ga0307409_100330504 Ga0307409_1003305042 243
474 3300031995 Ga0307409_100383987 Ga0307409_1003839871 243
475 3300031995 Ga0307409_100385858 Ga0307409_1003858582 243
476 3300031995 Ga0307409_100692501 Ga0307409_1006925012 243
477 3300032002 Ga0307416_100043264 Ga0307416_1000432643 243
478 3300032002 Ga0307416_100091591 Ga0307416_1000915913 243
479 3300032002 Ga0307416_100093120 Ga0307416_1000931204 243
480 3300032002 Ga0307416_100098409 Ga0307416_1000984092 243
481 3300032002 Ga0307416_100482217 Ga0307416_1004822172 243
482 3300032002 Ga0307416_100639843 Ga0307416_1006398432 243
483 3300032002 Ga0307416_100915326 Ga0307416_1009153261 243
484 3300032002 Ga0307416_101191541 Ga0307416_1011915411 243
485 3300032004 Ga0307414_10008125 Ga0307414_100081255 243
486 3300032004 Ga0307414_10060947 Ga0307414_100609471 243
487 3300032004 Ga0307414_10090031 Ga0307414_100900312 243
488 3300032004 Ga0307414_10103167 Ga0307414_101031672 243
489 3300032004 Ga0307414_10645849 Ga0307414_106458492 243
490 3300032005 Ga0307411_10002973 Ga0307411_100029735 243
491 3300032005 Ga0307411_10020154 Ga0307411_100201541 243
492 3300032005 Ga0307411_10023102 Ga0307411_100231023 243
493 3300032005 Ga0307411_10045181 Ga0307411_100451814 243
494 3300032005 Ga0307411_10049173 Ga0307411_100491732 243
495 3300032005 Ga0307411_10055016 Ga0307411_100550162 243
496 3300032005 Ga0307411_10371473 Ga0307411_103714732 243
497 3300032005 Ga0307411_10633672 Ga0307411_106336721 243
498 3300032126 Ga0307415_100004605 Ga0307415_1000046054 243
499 3300032126 Ga0307415_100024065 Ga0307415_1000240652 243
500 3300032126 Ga0307415_100051970 Ga0307415_1000519701 243
501 3300032126 Ga0307415_100230009 Ga0307415_1002300092 243
502 3300032126 Ga0307415_100248999 Ga0307415_1002489992 243
503 3300037312 Ga0395899_0021750 Ga0395899_0021750_2250_3002 243
504 3300037418 Ga0395900_0005637 Ga0395900_0005637_8147_8899 243
505 3300037418 Ga0395900_0087516 Ga0395900_0087516_2360_3136 243
506 3300037466 Ga0395898_0044273 Ga0395898_0044273_2067_2819 243
507 3300037466 Ga0395898_0288496 Ga0395898_0288496_121_873 243
508 3300037471 Ga0395905_0000694 Ga0395905_0000694_42654_43406 243
509 3300037471 Ga0395905_0003338 Ga0395905_0003338_15534_16310 243
510 3300037471 Ga0395905_0022461 Ga0395905_0022461_1446_2198 243
511 3300037471 Ga0395905_0072687 Ga0395905_0072687_1180_1932 243
512 3300037471 Ga0395905_0091469 Ga0395905_0091469_876_1616 243
513 3300038443 Ga0395901_0006994 Ga0395901_0006994_5865_6617 243
514 3300038443 Ga0395901_0148542 Ga0395901_0148542_624_1364 243
515 3300038443 Ga0395901_0202665 Ga0395901_0202665_856_1596 243
516 3300038443 Ga0395901_0295957 Ga0395901_0295957_249_1001 243
517 3300038443 Ga0395901_0342812 Ga0395901_0342812_548_1354 243
518 3300042004 Ga0439445_0006593 Ga0439445_0006593_960_1691 243
519 3300042157 Ga0439458_0000168 Ga0439458_0000168_7602_8354 243
520 3300042439 Ga0439464_0000182 Ga0439464_0000182_5883_6620 243
521 3300044694 Ga0466963_0026225 Ga0466963_0026225_2200_2940 243
522 3300045836 Ga0466958_0093756 Ga0466958_0093756_284_1024 243
523 3300045976 Ga0466967_0065146 Ga0466967_0065146_1281_2018 243
524 3300045976 Ga0466967_0146428 Ga0466967_0146428_202_939 243
525 3300045976 Ga0466967_0156169 Ga0466967_0156169_1221_1961 243
526 3300045976 Ga0466967_0221391 Ga0466967_0221391_221_958 243
527 3300045976 Ga0466967_0288441 Ga0466967_0288441_308_1048 243
528 3300045976 Ga0466967_0715347 Ga0466967_0715347_156_896 243
529 3300046492 Ga0495585_0087969 Ga0495585_0087969_16_753 243
530 3300046492 Ga0495585_0097660 Ga0495585_0097660_656_1387 243
531 3300046525 Ga0495663_0003888 Ga0495663_0003888_848_1579 243
532 3300046525 Ga0495663_0025537 Ga0495663_0025537_822_1559 243
533 3300046531 Ga0495665_0199556 Ga0495665_0199556_229_969 243
534 3300046537 Ga0495598_0000247 Ga0495598_0000247_3280_4017 243
535 3300046537 Ga0495598_0005868 Ga0495598_0005868_1995_2726 243
536 3300046539 Ga0495621_0000535 Ga0495621_0000535_5348_6085 243
537 3300046539 Ga0495621_0000962 Ga0495621_0000962_5476_6207 243
538 3300046539 Ga0495621_0001223 Ga0495621_0001223_4727_5458 243
539 3300046558 Ga0495633_0000803 Ga0495633_0000803_3496_4233 243
540 3300046558 Ga0495633_0036651 Ga0495633_0036651_416_1147 243
541 3300046616 Ga0495668_0005266 Ga0495668_0005266_3214_3951 243
542 3300046684 Ga0495669_0001337 Ga0495669_0001337_3780_4517 243
543 3300046691 Ga0495670_0011570 Ga0495670_0011570_2787_3524 243
544 3300046691 Ga0495670_0025068 Ga0495670_0025068_1137_1868 243
545 3300047445 Ga0495677_0016297 Ga0495677_0016297_1380_2111 243
546 3300047445 Ga0495677_0020050 Ga0495677_0020050_561_1298 243
547 3300048904 Ga0496101_0184881 Ga0496101_0184881_95_835 243
548 3300048908 Ga0496105_0192985 Ga0496105_0192985_202_942 243
549 3300048910 Ga0496107_0020537 Ga0496107_0020537_3142_3873 243
550 3300048912 Ga0496109_0109861 Ga0496109_0109861_1542_2279 243
551 3300048915 Ga0496112_0104937 Ga0496112_0104937_1110_1850 243
552 3300048915 Ga0496112_0286854 Ga0496112_0286854_254_991 243
553 3300048918 Ga0496115_0000526 Ga0496115_0000526_1047_1787 243
554 3300050510 nmdc:mga06r32_109169_c1 nmdc:mga06r32_109169_c1_1343_2086 243
555 3300050511 nmdc:mga08y16_151085_c1 nmdc:mga08y16_151085_c1_192_923 243
556 3300050511 nmdc:mga08y16_557033_c1 nmdc:mga08y16_557033_c1_82_825 243
557 3300050515 nmdc:mga0a205_24049_c1 nmdc:mga0a205_24049_c1_3206_4009 243
558 3300053087 Ga0500643_000273 Ga0500643_000273_42627_43367 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

77

254

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwq-assembly1.cif.gz_D crystal structure of the a-subunit of the ab5 toxin from e. coli with neu5gc-2,3gal-1,3glcnac 0.8832 128 172
6p4p-assembly1.cif.gz_B salmonella typhi pltb homopentamer n29k mutant 0.6675 110 172
5xd8-assembly1.cif.gz_A crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase 0.5624 128 173
2ps2-assembly1.cif.gz_A crystal structure of putative mandelate racemase/muconate lactonizing enzyme from aspergillus oryzae 0.5614 128 172
7zvw-assembly1.cif.gz_A nua4 histone acetyltransferase complex 0.5326 116 170
ID Description Score Start End Superfamily
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9128 56 229 2.70.70.10
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8928 56 229 2.70.70.10
af_Q58227_16_200_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8442 56 229 2.70.70.10
af_Q58227_16_200_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.792 56 229 2.70.70.10
af_I1KUF4_411_621_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.7786 60 230 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A2E4E7K8-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9323 13 243 GO:0004609
GO:0005886
GO:0006646
AF-A0A3A0C129-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9268 20 231 GO:0004609
GO:0005886
GO:0006646
AF-A0A1Q7N0I3-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9247 21 232 GO:0004609
GO:0005886
GO:0006646
AF-A0A7C3C8W1-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9242 21 232 GO:0004609
GO:0005886
GO:0006646
AF-A0A7X3S369-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9234 20 231 GO:0004609
GO:0005886
GO:0006646

Feature Viewer

pLDDT pTM Quality
87.1 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map