F463414

General Info

Members Datasets Scaffolds Average Seq Length
558 211 1116 224

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100329366|Ga0070704_1003293662
Length 253
Sequence MDSARSRAESISVPSRSRARITSVDHIRMTTLVLLSGGLDSAVLAAHEAQDARVLPVYVSVGLAWEDAEVAMVERLLASPSYAGTVDPLSRVSFTMRDVYSPTHWAIRGVPPAYDTPDEDVYLAGRNLVLLTKAGVVASKAKAHRIALGPLAGNPFPDARPAFFYAMEQALSLGLDHRIEIATPFLTWEKEHVIKRGVELGVPFEFTLSCMNPVIASGLPRHCGLCSKCRERRDAFAAAGVSDPSTYASKSPR

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
205 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 1.43
Rhizosphere 97.67
Stem 0
Stem Tuber 0
Unclassified 25.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100329366 3300005549 Unclassified 1282
2 JGI25406J46586_10000195 3300003203 Bacteria 26897
3 JGI25406J46586_10004794 3300003203 Bacteria 6291
4 Ga0065714_10102158 3300005288 Bacteria 1628
5 Ga0065704_10097272 3300005289 Bacteria 2402
6 Ga0065712_10000742 3300005290 Bacteria 11169
7 Ga0065712_10002679 3300005290 Bacteria 9203
8 Ga0065712_10102157 3300005290 Bacteria 2016
9 Ga0065712_10282256 3300005290 Unclassified 892
10 Ga0065715_10002758 3300005293 Bacteria 5893
11 Ga0065715_10151277 3300005293 Unclassified 1726
12 Ga0065715_10178075 3300005293 Unclassified 1488
13 Ga0065707_10097679 3300005295 Unclassified 3152
14 Ga0065707_10114011 3300005295 Bacteria 2309
15 Ga0070676_10015787 3300005328 Bacteria 4166
16 Ga0070676_10223957 3300005328 Unclassified 1244
17 Ga0070690_100059947 3300005330 Unclassified 2448
18 Ga0070690_100126133 3300005330 Bacteria 1723
19 Ga0070670_100001976 3300005331 Bacteria 16769
20 Ga0070670_100005174 3300005331 Bacteria 10982
21 Ga0070670_100018406 3300005331 Bacteria 5992
22 Ga0070670_100031707 3300005331 Unclassified 4552
23 Ga0070670_100540254 3300005331 Unclassified 1039
24 Ga0070670_100707289 3300005331 Unclassified 906
25 Ga0070677_10051808 3300005333 Bacteria 1663
26 Ga0070677_10123726 3300005333 Bacteria 1171
27 Ga0068869_100001793 3300005334 Bacteria 12873
28 Ga0070666_10281234 3300005335 Bacteria 1183
29 Ga0070680_100337227 3300005336 Bacteria 1281
30 Ga0070680_100460696 3300005336 Bacteria 1086
31 Ga0070660_100415080 3300005339 Bacteria 1114
32 Ga0070689_100023910 3300005340 Bacteria 4580
33 Ga0070689_100029886 3300005340 Unclassified 4131
34 Ga0070689_100051052 3300005340 Unclassified 3196
35 Ga0070689_100561243 3300005340 Bacteria 985
36 Ga0070689_100586028 3300005340 Unclassified 964
37 Ga0070691_10322711 3300005341 Bacteria 850
38 Ga0070687_100065675 3300005343 Bacteria 1931
39 Ga0070687_100085840 3300005343 Unclassified 1729
40 Ga0070661_100099409 3300005344 Bacteria 2162
41 Ga0070692_10047237 3300005345 Unclassified 2228
42 Ga0070669_100001446 3300005353 Bacteria 17198
43 Ga0070669_100031237 3300005353 Unclassified 3847
44 Ga0070669_100480763 3300005353 Bacteria 1028
45 Ga0070675_100002668 3300005354 Bacteria 13418
46 Ga0070675_100005827 3300005354 Bacteria 9436
47 Ga0070675_100012455 3300005354 Bacteria 6661
48 Ga0070675_100015971 3300005354 Bacteria 5949
49 Ga0070675_100053423 3300005354 Bacteria 3323
50 Ga0070675_100055566 3300005354 Bacteria 3259
51 Ga0070675_100086430 3300005354 Bacteria 2621
52 Ga0070675_100441820 3300005354 Unclassified 1165
53 Ga0070671_100008273 3300005355 Bacteria 8327
54 Ga0070671_100239735 3300005355 Bacteria 1539
55 Ga0070671_100241651 3300005355 Bacteria 1533
56 Ga0070671_100390509 3300005355 Unclassified 1190
57 Ga0070674_100008366 3300005356 Bacteria 6159
58 Ga0070674_100073136 3300005356 Unclassified 2429
59 Ga0070674_100311909 3300005356 Unclassified 1258
60 Ga0070674_100353027 3300005356 Unclassified 1188
61 Ga0070673_100032017 3300005364 Bacteria 3954
62 Ga0070673_100105189 3300005364 Bacteria 2331
63 Ga0070673_100121622 3300005364 Bacteria 2179
64 Ga0070673_100151366 3300005364 Bacteria 1965
65 Ga0070673_100177109 3300005364 Bacteria 1823
66 Ga0070673_100267669 3300005364 Unclassified 1495
67 Ga0070673_100393735 3300005364 Bacteria 1237
68 Ga0070688_100007910 3300005365 Bacteria 5748
69 Ga0070688_100061128 3300005365 Bacteria 2381
70 Ga0070688_100070380 3300005365 Unclassified 2236
71 Ga0070688_100277569 3300005365 Bacteria 1203
72 Ga0070688_100645624 3300005365 Bacteria 814
73 Ga0070701_10001972 3300005438 Bacteria 7776
74 Ga0070701_10039802 3300005438 Unclassified 2387
75 Ga0070701_10073080 3300005438 Bacteria 1838
76 Ga0070705_100001442 3300005440 Bacteria 12554
77 Ga0070705_100180914 3300005440 Unclassified 1428
78 Ga0070700_100022038 3300005441 Bacteria 3710
79 Ga0070700_100132119 3300005441 Bacteria 1686
80 Ga0070700_100197251 3300005441 Bacteria 1411
81 Ga0070700_100430803 3300005441 Unclassified 999
82 Ga0070694_100001411 3300005444 Bacteria 14061
83 Ga0070694_100001915 3300005444 Bacteria 12311
84 Ga0070694_100011676 3300005444 Bacteria 5442
85 Ga0070694_100022299 3300005444 Bacteria 4056
86 Ga0070694_100118143 3300005444 Bacteria 1899
87 Ga0070694_100301126 3300005444 Bacteria 1229
88 Ga0070694_100636398 3300005444 Bacteria 862
89 Ga0070678_100012652 3300005456 Bacteria 5258
90 Ga0070678_100111495 3300005456 Bacteria 2141
91 Ga0070678_100133695 3300005456 Bacteria 1975
92 Ga0070678_100228236 3300005456 Bacteria 1551
93 Ga0070662_100121321 3300005457 Bacteria 2004
94 Ga0070662_100280521 3300005457 Unclassified 1348
95 Ga0070662_100416961 3300005457 Bacteria 1110
96 Ga0070681_10004721 3300005458 Bacteria 13045
97 Ga0070681_10054837 3300005458 Bacteria 3972
98 Ga0068867_100001781 3300005459 Bacteria 14979
99 Ga0070685_10042835 3300005466 Bacteria 2585
100 Ga0070685_10242357 3300005466 Unclassified 1191
101 Ga0070685_10266311 3300005466 Bacteria 1142
102 Ga0070685_10562221 3300005466 Bacteria 816
103 Ga0070706_100338851 3300005467 Unclassified 1402
104 Ga0070706_100457277 3300005467 Unclassified 1188
105 Ga0070707_100146246 3300005468 Unclassified 2300
106 Ga0070707_100156263 3300005468 Bacteria 2222
107 Ga0070698_100001632 3300005471 Bacteria 24972
108 Ga0070698_100012258 3300005471 Bacteria 9079
109 Ga0070699_100000172 3300005518 Bacteria 62043
110 Ga0070699_100008376 3300005518 Bacteria 8959
111 Ga0070699_100013510 3300005518 Bacteria 7031
112 Ga0070699_100048405 3300005518 Bacteria 3679
113 Ga0070679_100148810 3300005530 Bacteria 2319
114 Ga0070672_100015294 3300005543 Bacteria 5460
115 Ga0070672_100025684 3300005543 Bacteria 4373
116 Ga0070672_100037361 3300005543 Unclassified 3705
117 Ga0070672_100065993 3300005543 Bacteria 2864
118 Ga0070672_100109519 3300005543 Bacteria 2250
119 Ga0070695_100000002 3300005545 Bacteria 128335
120 Ga0070695_100000811 3300005545 Bacteria 16822
121 Ga0070695_100050519 3300005545 Unclassified 2665
122 Ga0070696_100001429 3300005546 Bacteria 15613
123 Ga0070696_100039455 3300005546 Bacteria 3260
124 Ga0070696_100157741 3300005546 Bacteria 1670
125 Ga0070704_100000294 3300005549 Bacteria 21966
126 Ga0070704_100002934 3300005549 Bacteria 9690
127 Ga0070704_100032618 3300005549 Unclassified 3515
128 Ga0070704_100919445 3300005549 Bacteria 788
129 Ga0070704_101040699 3300005549 Bacteria 742
130 Ga0070664_100041169 3300005564 Bacteria 3897
131 Ga0070664_100189120 3300005564 Unclassified 1834
132 Ga0068857_100153169 3300005577 Bacteria 2089
133 Ga0068857_100282455 3300005577 Bacteria 1527
134 Ga0068857_100299433 3300005577 Unclassified 1482
135 Ga0068854_100379683 3300005578 Bacteria 1164
136 Ga0070702_100375011 3300005615 Bacteria 1010
137 Ga0070702_100391958 3300005615 Bacteria 991
138 Ga0068859_100006650 3300005617 Bacteria 11743
139 Ga0068859_100040915 3300005617 Unclassified 4655
140 Ga0068859_100060272 3300005617 Bacteria 3824
141 Ga0068859_100062483 3300005617 Bacteria 3754
142 Ga0068859_100402627 3300005617 Unclassified 1465
143 Ga0068859_100888539 3300005617 Bacteria 976
144 Ga0068859_101177293 3300005617 Bacteria 844
145 Ga0068864_100057493 3300005618 Bacteria 3360
146 Ga0068864_100081409 3300005618 Bacteria 2838
147 Ga0068864_100217109 3300005618 Bacteria 1763
148 Ga0068864_100310684 3300005618 Unclassified 1478
149 Ga0068866_10094772 3300005718 Bacteria 1634
150 Ga0068866_10151810 3300005718 Bacteria 1342
151 Ga0068866_10416149 3300005718 Bacteria 871
152 Ga0068861_100019863 3300005719 Unclassified 4802
153 Ga0068861_100155837 3300005719 Bacteria 1879
154 Ga0068861_100159184 3300005719 Bacteria 1861
155 Ga0068861_100414462 3300005719 Bacteria 1199
156 Ga0068861_100422005 3300005719 Unclassified 1189
157 Ga0068851_10024781 3300005834 Unclassified 2939
158 Ga0068870_10005876 3300005840 Bacteria 5389
159 Ga0068870_10027885 3300005840 Bacteria 2829
160 Ga0068870_10152888 3300005840 Bacteria 1361
161 Ga0068863_100386657 3300005841 Bacteria 1367
162 Ga0068863_100530853 3300005841 Unclassified 1161
163 Ga0068863_100530875 3300005841 Unclassified 1161
164 Ga0068858_100018327 3300005842 Bacteria 6556
165 Ga0068858_100158718 3300005842 Bacteria 2129
166 Ga0068858_100234027 3300005842 Unclassified 1742
167 Ga0068858_100722199 3300005842 Unclassified 970
168 Ga0068860_100045085 3300005843 Bacteria 4204
169 Ga0068860_100193363 3300005843 Bacteria 1969
170 Ga0068862_100021497 3300005844 Bacteria 5392
171 Ga0068862_100056969 3300005844 Bacteria 3350
172 Ga0068862_100211105 3300005844 Unclassified 1754
173 Ga0068862_100443351 3300005844 Bacteria 1222
174 Ga0081539_10000024 3300005985 Bacteria 354702
175 Ga0081539_10000096 3300005985 Bacteria 204059
176 Ga0081539_10005511 3300005985 Bacteria 12854
177 Ga0097621_100062610 3300006237 Unclassified 3055
178 Ga0097621_100073417 3300006237 Bacteria 2832
179 Ga0097621_100103369 3300006237 Bacteria 2399
180 Ga0097621_100114609 3300006237 Bacteria 2281
181 Ga0097621_100646779 3300006237 Unclassified 970
182 Ga0068871_100122775 3300006358 Bacteria 2196
183 Ga0068871_100134247 3300006358 Bacteria 2101
184 Ga0068871_100193280 3300006358 Bacteria 1754
185 Ga0075428_100009166 3300006844 Bacteria 10979
186 Ga0075428_100015658 3300006844 Bacteria 8403
187 Ga0075428_100043182 3300006844 Bacteria 4957
188 Ga0075428_100266218 3300006844 Unclassified 1845
189 Ga0075428_100283042 3300006844 Bacteria 1784
190 Ga0075428_100624642 3300006844 Unclassified 1150
191 Ga0075431_100315906 3300006847 Bacteria 1576
192 Ga0075431_100967829 3300006847 Bacteria 819
193 Ga0075433_10000366 3300006852 Bacteria 28421
194 Ga0075434_100005175 3300006871 Bacteria 11841
195 Ga0075434_100108265 3300006871 Bacteria 2789
196 Ga0075434_100111874 3300006871 Bacteria 2742
197 Ga0075434_100189624 3300006871 Bacteria 2076
198 Ga0075434_100327700 3300006871 Bacteria 1552
199 Ga0075429_100052743 3300006880 Bacteria 3538
200 Ga0075429_100133382 3300006880 Bacteria 2173
201 Ga0075429_100368411 3300006880 Unclassified 1258
202 Ga0075429_100471030 3300006880 Bacteria 1100
203 Ga0068865_100029033 3300006881 Bacteria 3665
204 Ga0068865_100296869 3300006881 Unclassified 1292
205 Ga0097620_100006650 3300006931 Bacteria 11743
206 Ga0097620_100040914 3300006931 Unclassified 4655
207 Ga0097620_100060271 3300006931 Bacteria 3824
208 Ga0097620_100062483 3300006931 Bacteria 3754
209 Ga0097620_100402644 3300006931 Unclassified 1465
210 Ga0097620_100888746 3300006931 Bacteria 976
211 Ga0097620_101177042 3300006931 Bacteria 844
212 Ga0075435_100011172 3300007076 Bacteria 6588
213 Ga0075435_100398038 3300007076 Bacteria 1184
214 Ga0111539_10011424 3300009094 Bacteria 11146
215 Ga0111539_10015925 3300009094 Bacteria 9340
216 Ga0111539_10024410 3300009094 Bacteria 7420
217 Ga0111539_10030231 3300009094 Bacteria 6587
218 Ga0111539_10071491 3300009094 Bacteria 4094
219 Ga0111539_10120187 3300009094 Bacteria 3078
220 Ga0111539_10131666 3300009094 Unclassified 2929
221 Ga0111539_10145024 3300009094 Unclassified 2780
222 Ga0111539_10175970 3300009094 Unclassified 2500
223 Ga0111539_10239415 3300009094 Bacteria 2112
224 Ga0111539_10442171 3300009094 Bacteria 1514
225 Ga0111539_10693039 3300009094 Bacteria 1186
226 Ga0111539_10919532 3300009094 Bacteria 1017
227 Ga0105247_10361194 3300009101 Unclassified 1024
228 Ga0114129_10006192 3300009147 Bacteria 16978
229 Ga0114129_10007639 3300009147 Bacteria 15386
230 Ga0114129_10009128 3300009147 Bacteria 14135
231 Ga0114129_10016116 3300009147 Bacteria 10632
232 Ga0114129_10022259 3300009147 Bacteria 8998
233 Ga0114129_10045771 3300009147 Bacteria 6149
234 Ga0114129_10066953 3300009147 Bacteria 5009
235 Ga0114129_10119000 3300009147 Bacteria 3638
236 Ga0114129_10361695 3300009147 Unclassified 1920
237 Ga0105243_10004580 3300009148 Bacteria 10903
238 Ga0105243_10124205 3300009148 Bacteria 2181
239 Ga0105243_11066598 3300009148 Unclassified 814
240 Ga0105242_10023664 3300009176 Bacteria 4842
241 Ga0105242_10140517 3300009176 Bacteria 2095
242 Ga0105242_11145077 3300009176 Unclassified 794
243 Ga0105248_10012430 3300009177 Bacteria 9389
244 Ga0105248_10030063 3300009177 Bacteria 6062
245 Ga0105248_10347904 3300009177 Bacteria 1669
246 Ga0105248_10348881 3300009177 Unclassified 1666
247 Ga0105248_10498373 3300009177 Bacteria 1373
248 Ga0105249_10019826 3300009553 Bacteria 6003
249 Ga0105249_10148236 3300009553 Bacteria 2256
250 Ga0105249_10154468 3300009553 Bacteria 2212
251 Ga0105246_10273209 3300011119 Bacteria 1352
252 Ga0105246_10354521 3300011119 Bacteria 1203
253 Ga0157374_10064129 3300013296 Bacteria 3447
254 Ga0157374_10071421 3300013296 Bacteria 3273
255 Ga0157374_10814177 3300013296 Bacteria 950
256 Ga0157378_10204760 3300013297 Bacteria 1868
257 Ga0157378_10983120 3300013297 Bacteria 878
258 Ga0163162_10167477 3300013306 Bacteria 2321
259 Ga0163162_10213405 3300013306 Unclassified 2060
260 Ga0157375_10015742 3300013308 Bacteria 6776
261 Ga0163163_10027406 3300014325 Bacteria 5458
262 Ga0163163_10059180 3300014325 Bacteria 3789
263 Ga0163163_10069546 3300014325 Unclassified 3505
264 Ga0163163_10111107 3300014325 Bacteria 2770
265 Ga0163163_10254334 3300014325 Bacteria 1807
266 Ga0163163_10292530 3300014325 Unclassified 1681
267 Ga0157380_10003694 3300014326 Bacteria 10527
268 Ga0157380_10008404 3300014326 Bacteria 7367
269 Ga0157380_10012213 3300014326 Bacteria 6222
270 Ga0157380_10119468 3300014326 Unclassified 2230
271 Ga0157380_10122982 3300014326 Bacteria 2201
272 Ga0157380_10142562 3300014326 Unclassified 2060
273 Ga0157380_10358002 3300014326 Bacteria 1368
274 Ga0157380_10473677 3300014326 Bacteria 1209
275 Ga0157380_10587540 3300014326 Bacteria 1099
276 Ga0157380_11142868 3300014326 Bacteria 820
277 Ga0157377_10133341 3300014745 Unclassified 1520
278 Ga0157377_10147285 3300014745 Bacteria 1453
279 Ga0157377_10151868 3300014745 Bacteria 1432
280 Ga0157377_10160625 3300014745 Bacteria 1397
281 Ga0157377_10170002 3300014745 Bacteria 1363
282 Ga0157379_10969109 3300014968 Unclassified 810
283 Ga0157376_10049638 3300014969 Unclassified 3477
284 Ga0157376_10101508 3300014969 Bacteria 2514
285 Ga0157376_10536827 3300014969 Unclassified 1155
286 Ga0163161_10345640 3300017792 Unclassified 1181
287 Ga0207697_10148934 3300025315 Bacteria 1017
288 Ga0207682_10076945 3300025893 Bacteria 1423
289 Ga0207642_10068283 3300025899 Bacteria 1681
290 Ga0207688_10179350 3300025901 Bacteria 1263
291 Ga0207680_10122430 3300025903 Bacteria 1703
292 Ga0207680_10161223 3300025903 Bacteria 1504
293 Ga0207680_10203342 3300025903 Unclassified 1351
294 Ga0207645_10015914 3300025907 Unclassified 4984
295 Ga0207645_10282707 3300025907 Unclassified 1102
296 Ga0207643_10009297 3300025908 Bacteria 5282
297 Ga0207643_10027348 3300025908 Bacteria 3161
298 Ga0207643_10094901 3300025908 Unclassified 1743
299 Ga0207684_10328002 3300025910 Bacteria 1319
300 Ga0207707_10101625 3300025912 Bacteria 2513
301 Ga0207660_10240594 3300025917 Bacteria 1426
302 Ga0207660_10274814 3300025917 Bacteria 1335
303 Ga0207660_10432462 3300025917 Bacteria 1063
304 Ga0207662_10010247 3300025918 Bacteria 5171
305 Ga0207662_10075720 3300025918 Bacteria 2045
306 Ga0207662_10083958 3300025918 Unclassified 1948
307 Ga0207662_10290163 3300025918 Bacteria 1085
308 Ga0207657_10054439 3300025919 Bacteria 3460
309 Ga0207657_10468573 3300025919 Bacteria 988
310 Ga0207649_10042447 3300025920 Bacteria 2775
311 Ga0207649_10144066 3300025920 Unclassified 1634
312 Ga0207652_10394173 3300025921 Bacteria 1249
313 Ga0207646_10129906 3300025922 Bacteria 2267
314 Ga0207646_10162787 3300025922 Unclassified 2014
315 Ga0207681_10028363 3300025923 Unclassified 3625
316 Ga0207681_10044090 3300025923 Unclassified 2988
317 Ga0207681_10286705 3300025923 Bacteria 1298
318 Ga0207650_10010310 3300025925 Bacteria 6405
319 Ga0207650_10049784 3300025925 Bacteria 3095
320 Ga0207650_10374198 3300025925 Unclassified 1175
321 Ga0207659_10004608 3300025926 Bacteria 8343
322 Ga0207659_10008009 3300025926 Bacteria 6535
323 Ga0207659_10008078 3300025926 Bacteria 6514
324 Ga0207659_10100238 3300025926 Unclassified 2182
325 Ga0207659_10145666 3300025926 Unclassified 1844
326 Ga0207659_10314179 3300025926 Bacteria 1291
327 Ga0207659_10577164 3300025926 Unclassified 957
328 Ga0207700_10162836 3300025928 Unclassified 1854
329 Ga0207644_10011636 3300025931 Bacteria 5826
330 Ga0207644_10029863 3300025931 Bacteria 3784
331 Ga0207644_10087082 3300025931 Bacteria 2321
332 Ga0207644_10164515 3300025931 Unclassified 1727
333 Ga0207644_10389716 3300025931 Bacteria 1137
334 Ga0207644_10436872 3300025931 Bacteria 1074
335 Ga0207706_10319326 3300025933 Unclassified 1352
336 Ga0207686_10013964 3300025934 Bacteria 4458
337 Ga0207709_10004075 3300025935 Bacteria 8506
338 Ga0207709_10075326 3300025935 Unclassified 2156
339 Ga0207670_10011157 3300025936 Bacteria 5204
340 Ga0207670_10112650 3300025936 Bacteria 1963
341 Ga0207670_10121009 3300025936 Bacteria 1903
342 Ga0207670_10170991 3300025936 Unclassified 1629
343 Ga0207669_10014873 3300025937 Bacteria 3912
344 Ga0207704_10002296 3300025938 Bacteria 8602
345 Ga0207704_10492654 3300025938 Unclassified 986
346 Ga0207691_10006272 3300025940 Bacteria 11478
347 Ga0207691_10027293 3300025940 Bacteria 5354
348 Ga0207691_10057651 3300025940 Bacteria 3534
349 Ga0207691_10064067 3300025940 Bacteria 3331
350 Ga0207691_10251096 3300025940 Bacteria 1527
351 Ga0207711_10156077 3300025941 Bacteria 2062
352 Ga0207711_10202324 3300025941 Unclassified 1812
353 Ga0207711_10399672 3300025941 Bacteria 1277
354 Ga0207689_10000643 3300025942 Bacteria 33304
355 Ga0207689_10640172 3300025942 Bacteria 895
356 Ga0207689_10695931 3300025942 Unclassified 857
357 Ga0207661_10103806 3300025944 Bacteria 2393
358 Ga0207679_10008413 3300025945 Bacteria 6572
359 Ga0207679_10009773 3300025945 Bacteria 6154
360 Ga0207679_10240097 3300025945 Bacteria 1535
361 Ga0207679_10377003 3300025945 Bacteria 1243
362 Ga0207679_10592444 3300025945 Bacteria 998
363 Ga0207651_10007877 3300025960 Bacteria 5705
364 Ga0207651_10050296 3300025960 Unclassified 2829
365 Ga0207651_10142300 3300025960 Bacteria 1854
366 Ga0207651_10202462 3300025960 Unclassified 1592
367 Ga0207712_10033762 3300025961 Bacteria 3461
368 Ga0207712_11065349 3300025961 Unclassified 719
369 Ga0207668_10501425 3300025972 Bacteria 1044
370 Ga0207668_10969520 3300025972 Bacteria 759
371 Ga0207640_10125988 3300025981 Bacteria 1844
372 Ga0207640_10190788 3300025981 Bacteria 1545
373 Ga0207658_10586181 3300025986 Bacteria 1001
374 Ga0207677_10253855 3300026023 Unclassified 1430
375 Ga0207703_10039807 3300026035 Bacteria 3759
376 Ga0207703_10049146 3300026035 Bacteria 3409
377 Ga0207703_10192978 3300026035 Unclassified 1805
378 Ga0207703_10198628 3300026035 Bacteria 1781
379 Ga0207703_10226609 3300026035 Unclassified 1674
380 Ga0207703_10669030 3300026035 Unclassified 986
381 Ga0207678_10189390 3300026067 Bacteria 1758
382 Ga0207678_10447499 3300026067 Unclassified 1122
383 Ga0207708_10006092 3300026075 Bacteria 8943
384 Ga0207708_10006872 3300026075 Bacteria 8417
385 Ga0207708_10061069 3300026075 Bacteria 2877
386 Ga0207708_10081081 3300026075 Bacteria 2493
387 Ga0207708_10521054 3300026075 Unclassified 999
388 Ga0207708_10656538 3300026075 Bacteria 893
389 Ga0207641_10026606 3300026088 Bacteria 4776
390 Ga0207641_10473503 3300026088 Unclassified 1213
391 Ga0207641_10600621 3300026088 Unclassified 1077
392 Ga0207641_10949153 3300026088 Unclassified 855
393 Ga0207648_10002125 3300026089 Bacteria 21549
394 Ga0207648_10009276 3300026089 Bacteria 9448
395 Ga0207648_10056695 3300026089 Bacteria 3418
396 Ga0207648_10105644 3300026089 Unclassified 2470
397 Ga0207648_10145193 3300026089 Bacteria 2093
398 Ga0207676_10029017 3300026095 Bacteria 4138
399 Ga0207676_10099170 3300026095 Bacteria 2410
400 Ga0207676_10237821 3300026095 Unclassified 1632
401 Ga0207674_10109921 3300026116 Bacteria 2732
402 Ga0207674_10133717 3300026116 Bacteria 2443
403 Ga0207675_100026370 3300026118 Bacteria 5409
404 Ga0207675_100075959 3300026118 Unclassified 3145
405 Ga0207675_100198568 3300026118 Bacteria 1926
406 Ga0207675_100248217 3300026118 Bacteria 1722
407 Ga0207683_10024926 3300026121 Bacteria 5156
408 Ga0207683_10123722 3300026121 Bacteria 2323
409 Ga0207683_10240063 3300026121 Bacteria 1653
410 Ga0207683_10561235 3300026121 Bacteria 1056
411 Ga0207683_10894591 3300026121 Unclassified 824
412 Ga0207698_10164242 3300026142 Bacteria 1946
413 Ga0207428_10002752 3300027907 Bacteria 17480
414 Ga0207428_10007895 3300027907 Bacteria 9673
415 Ga0207428_10059655 3300027907 Bacteria 3024
416 Ga0207428_10423306 3300027907 Bacteria 973
417 Ga0268265_10014801 3300028380 Bacteria 5325
418 Ga0268265_10018194 3300028380 Bacteria 4866
419 Ga0268265_10123486 3300028380 Bacteria 2138
420 Ga0268265_10184182 3300028380 Unclassified 1797
421 Ga0268265_10536856 3300028380 Bacteria 1108
422 Ga0268264_10006095 3300028381 Bacteria 10187
423 Ga0268264_10172354 3300028381 Unclassified 1958
424 Ga0268264_10352721 3300028381 Unclassified 1401
425 Ga0307408_100301948 3300031548 Unclassified 1341
426 Ga0307405_10001687 3300031731 Bacteria 9419
427 Ga0307405_10112924 3300031731 Bacteria 1844
428 Ga0307413_10098517 3300031824 Unclassified 1925
429 Ga0307410_10032109 3300031852 Bacteria 3375
430 Ga0307410_10446191 3300031852 Bacteria 1054
431 Ga0307406_10096590 3300031901 Unclassified 2002
432 Ga0307407_10004256 3300031903 Bacteria 6042
433 Ga0307412_10028351 3300031911 Unclassified 3501
434 Ga0307412_10139973 3300031911 Bacteria 1771
435 Ga0307412_10567245 3300031911 Unclassified 956
436 Ga0307409_100023913 3300031995 Unclassified 4246
437 Ga0307409_100227573 3300031995 Bacteria 1688
438 Ga0307416_100002805 3300032002 Bacteria 10124
439 Ga0307416_101412494 3300032002 Bacteria 802
440 Ga0307414_10239196 3300032004 Unclassified 1502
441 Ga0307411_10206942 3300032005 Bacteria 1512
442 Ga0307411_10517196 3300032005 Unclassified 1012
443 Ga0307415_100067586 3300032126 Unclassified 2498
444 Ga0373940_0115397 3300035088 Unclassified 828
445 Ga0373939_0017225 3300035114 Bacteria 1917
446 Ga0451853_2909224 3300041512 Bacteria 769
447 Ga0451853_3107687 3300041512 Unclassified 1606
448 Ga0450923_007686 3300042125 Bacteria 1832
449 Ga0439435_0013157 3300042436 Bacteria 2018
450 Ga0439460_0005471 3300042461 Bacteria 3117
451 Ga0450916_009106 3300042530 Unclassified 1220
452 Ga0450918_047848 3300042531 Unclassified 775
453 Ga0451576_0005505 3300045051 Bacteria 15818
454 Ga0451576_0046438 3300045051 Bacteria 4572
455 Ga0451576_0049151 3300045051 Bacteria 4426
456 Ga0451576_0091162 3300045051 Unclassified 3170
457 Ga0451576_0267193 3300045051 Bacteria 1788
458 Ga0451576_0636454 3300045051 Bacteria 1121
459 Ga0495603_0014577 3300046455 Bacteria 4754
460 Ga0495603_0306752 3300046455 Bacteria 912
461 Ga0495580_0094830 3300046472 Bacteria 2076
462 Ga0495584_0294003 3300046491 Unclassified 825
463 Ga0495643_0009719 3300046522 Bacteria 5950
464 Ga0495663_0051581 3300046525 Bacteria 1275
465 Ga0495663_0064023 3300046525 Unclassified 1160
466 Ga0495665_0166140 3300046531 Unclassified 1150
467 Ga0495598_0114704 3300046537 Unclassified 907
468 Ga0495621_0000944 3300046539 Bacteria 7400
469 Ga0495656_0042635 3300046615 Unclassified 1901
470 Ga0495659_0004844 3300046664 Bacteria 4237
471 Ga0495659_0028328 3300046664 Bacteria 1938
472 Ga0495659_0041800 3300046664 Bacteria 1639
473 Ga0495659_0053135 3300046664 Bacteria 1480
474 Ga0495647_0074561 3300046681 Bacteria 1364
475 Ga0495658_0178801 3300046683 Unclassified 1316
476 Ga0495669_0005387 3300046684 Bacteria 5336
477 Ga0495669_0068518 3300046684 Bacteria 1614
478 Ga0495670_0055574 3300046691 Bacteria 1985
479 Ga0495677_0061547 3300047445 Bacteria 1392
480 Ga0496102_0918946 3300048905 Bacteria 797
481 Ga0496104_0002662 3300048907 Bacteria 15373
482 Ga0496105_0033702 3300048908 Bacteria 4208
483 Ga0496106_0191235 3300048909 Unclassified 1627
484 Ga0496107_0643130 3300048910 Bacteria 782
485 Ga0496108_0079391 3300048911 Bacteria 2778
486 Ga0496111_0113155 3300048914 Bacteria 2000
487 Ga0496112_0021088 3300048915 Bacteria 6190
488 Ga0501031_0262002 3300049568 Bacteria 1123
489 Ga0501033_0293437 3300049570 Bacteria 1146
490 Ga0501036_0070381 3300049572 Bacteria 2958
491 Ga0501036_0891809 3300049572 Bacteria 730
492 Ga0501038_0534988 3300049574 Bacteria 893
493 Ga0501040_0281499 3300049576 Bacteria 1188
494 Ga0501040_0444566 3300049576 Bacteria 933
495 Ga0501041_0063192 3300049577 Bacteria 2267
496 Ga0501042_0084169 3300049578 Bacteria 2280
497 Ga0501042_0171120 3300049578 Bacteria 1567
498 Ga0501042_0419439 3300049578 Bacteria 970
499 Ga0501046_0090543 3300049580 Bacteria 2354
500 Ga0501048_0258558 3300049582 Bacteria 1237
501 Ga0501048_0298864 3300049582 Bacteria 1145
502 Ga0501067_0101600 3300049583 Bacteria 1598
503 Ga0501071_0017623 3300049587 Bacteria 4930
504 Ga0501073_0012257 3300049589 Bacteria 6256
505 Ga0501073_0149965 3300049589 Unclassified 1616
506 Ga0501074_0044835 3300049590 Bacteria 3200
507 Ga0501074_0232635 3300049590 Bacteria 1312
508 Ga0501076_0075923 3300049592 Bacteria 2694
509 Ga0501076_0111085 3300049592 Bacteria 2215
510 Ga0501076_0123599 3300049592 Bacteria 2096
511 Ga0501081_0039028 3300049743 Bacteria 3248
512 nmdc:mga05p37_1594_c1 3300050507 Bacteria 26335
513 nmdc:mga05p37_177523_c1 3300050507 Bacteria 2594
514 nmdc:mga05p37_181862_c1 3300050507 Bacteria 2131
515 nmdc:mga05p37_34881_c1 3300050507 Bacteria 6165
516 nmdc:mga05p37_5255_c1 3300050507 Bacteria 15196
517 nmdc:mga05p37_73276_c1 3300050507 Bacteria 4214
518 nmdc:mga09592_142488_c1 3300050508 Unclassified 2066
519 nmdc:mga09592_183823_c1 3300050508 Bacteria 1808
520 nmdc:mga09592_475198_c1 3300050508 Bacteria 1077
521 nmdc:mga09592_520150_c1 3300050508 Unclassified 1023
522 nmdc:mga09592_6960_c1 3300050508 Bacteria 9197
523 nmdc:mga09592_92094_c1 3300050508 Bacteria 2591
524 nmdc:mga06r32_109745_c1 3300050510 Bacteria 2713
525 nmdc:mga06r32_293510_c1 3300050510 Bacteria 1612
526 nmdc:mga08y16_13902_c1 3300050511 Bacteria 8471
527 nmdc:mga08y16_20109_c1 3300050511 Bacteria 7045
528 nmdc:mga08y16_286747_c1 3300050511 Bacteria 1698
529 nmdc:mga08y16_3647_c1 3300050511 Bacteria 16008
530 nmdc:mga08y16_40551_c1 3300050511 Bacteria 4879
531 nmdc:mga08y16_408210_c1 3300050511 Bacteria 1389
532 nmdc:mga08y16_460869_c1 3300050511 Bacteria 1295
533 nmdc:mga08y16_79465_c1 3300050511 Bacteria 3418
534 nmdc:mga08y16_821217_c1 3300050511 Bacteria 921
535 nmdc:mga0n895_298725_c1 3300050512 Unclassified 1632
536 nmdc:mga0n895_4404_c1 3300050512 Bacteria 11565
537 nmdc:mga0n895_459390_c1 3300050512 Bacteria 1285
538 nmdc:mga0n895_47935_c1 3300050512 Bacteria 2789
539 nmdc:mga0n895_577128_c1 3300050512 Bacteria 1129
540 nmdc:mga0rr50_130414_c1 3300050513 Bacteria 2012
541 nmdc:mga0rr50_407253_c1 3300050513 Bacteria 1149
542 nmdc:mga0rr50_530199_c1 3300050513 Bacteria 1002
543 nmdc:mga0rr50_580792_c1 3300050513 Bacteria 955
544 nmdc:mga0a205_1038_c1 3300050515 Bacteria 23124
545 nmdc:mga0a205_149862_c1 3300050515 Bacteria 2233
546 Ga0500646_0008489 3300053090 Bacteria 2627
547 Ga0500555_011459 3300053103 Unclassified 2548
548 Ga0500628_015279 3300053129 Unclassified 1465
549 Ga0501084_0297082 3300054114 Bacteria 1364
550 Ga0501084_0420135 3300054114 Bacteria 1130
551 Ga0590071_000383 3300059421 Bacteria 12985
552 Ga0590075_001130 3300059424 Bacteria 6804
553 Ga0590075_006947 3300059424 Bacteria 2683
554 Ga0590077_000447 3300059426 Bacteria 11582
555 Ga0590077_011058 3300059426 Bacteria 1861
556 Ga0501082_0132113 3300060353 Bacteria 2166
557 Ga0501082_0207105 3300060353 Bacteria 1706
558 Ga0530510_0017603 3300061734 Bacteria 5064
559 Ga0070704_100329366
560 JGI25406J46586_10000195
561 JGI25406J46586_10004794
562 Ga0065714_10102158
563 Ga0065704_10097272
564 Ga0065712_10000742
565 Ga0065712_10002679
566 Ga0065712_10102157
567 Ga0065712_10282256
568 Ga0065715_10002758
569 Ga0065715_10151277
570 Ga0065715_10178075
571 Ga0065707_10097679
572 Ga0065707_10114011
573 Ga0070676_10015787
574 Ga0070676_10223957
575 Ga0070690_100059947
576 Ga0070690_100126133
577 Ga0070670_100001976
578 Ga0070670_100005174
579 Ga0070670_100018406
580 Ga0070670_100031707
581 Ga0070670_100540254
582 Ga0070670_100707289
583 Ga0070677_10051808
584 Ga0070677_10123726
585 Ga0068869_100001793
586 Ga0070666_10281234
587 Ga0070680_100337227
588 Ga0070680_100460696
589 Ga0070660_100415080
590 Ga0070689_100023910
591 Ga0070689_100029886
592 Ga0070689_100051052
593 Ga0070689_100561243
594 Ga0070689_100586028
595 Ga0070691_10322711
596 Ga0070687_100065675
597 Ga0070687_100085840
598 Ga0070661_100099409
599 Ga0070692_10047237
600 Ga0070669_100001446
601 Ga0070669_100031237
602 Ga0070669_100480763
603 Ga0070675_100002668
604 Ga0070675_100005827
605 Ga0070675_100012455
606 Ga0070675_100015971
607 Ga0070675_100053423
608 Ga0070675_100055566
609 Ga0070675_100086430
610 Ga0070675_100441820
611 Ga0070671_100008273
612 Ga0070671_100239735
613 Ga0070671_100241651
614 Ga0070671_100390509
615 Ga0070674_100008366
616 Ga0070674_100073136
617 Ga0070674_100311909
618 Ga0070674_100353027
619 Ga0070673_100032017
620 Ga0070673_100105189
621 Ga0070673_100121622
622 Ga0070673_100151366
623 Ga0070673_100177109
624 Ga0070673_100267669
625 Ga0070673_100393735
626 Ga0070688_100007910
627 Ga0070688_100061128
628 Ga0070688_100070380
629 Ga0070688_100277569
630 Ga0070688_100645624
631 Ga0070701_10001972
632 Ga0070701_10039802
633 Ga0070701_10073080
634 Ga0070705_100001442
635 Ga0070705_100180914
636 Ga0070700_100022038
637 Ga0070700_100132119
638 Ga0070700_100197251
639 Ga0070700_100430803
640 Ga0070694_100001411
641 Ga0070694_100001915
642 Ga0070694_100011676
643 Ga0070694_100022299
644 Ga0070694_100118143
645 Ga0070694_100301126
646 Ga0070694_100636398
647 Ga0070678_100012652
648 Ga0070678_100111495
649 Ga0070678_100133695
650 Ga0070678_100228236
651 Ga0070662_100121321
652 Ga0070662_100280521
653 Ga0070662_100416961
654 Ga0070681_10004721
655 Ga0070681_10054837
656 Ga0068867_100001781
657 Ga0070685_10042835
658 Ga0070685_10242357
659 Ga0070685_10266311
660 Ga0070685_10562221
661 Ga0070706_100338851
662 Ga0070706_100457277
663 Ga0070707_100146246
664 Ga0070707_100156263
665 Ga0070698_100001632
666 Ga0070698_100012258
667 Ga0070699_100000172
668 Ga0070699_100008376
669 Ga0070699_100013510
670 Ga0070699_100048405
671 Ga0070679_100148810
672 Ga0070672_100015294
673 Ga0070672_100025684
674 Ga0070672_100037361
675 Ga0070672_100065993
676 Ga0070672_100109519
677 Ga0070695_100000002
678 Ga0070695_100000811
679 Ga0070695_100050519
680 Ga0070696_100001429
681 Ga0070696_100039455
682 Ga0070696_100157741
683 Ga0070704_100000294
684 Ga0070704_100002934
685 Ga0070704_100032618
686 Ga0070704_100919445
687 Ga0070704_101040699
688 Ga0070664_100041169
689 Ga0070664_100189120
690 Ga0068857_100153169
691 Ga0068857_100282455
692 Ga0068857_100299433
693 Ga0068854_100379683
694 Ga0070702_100375011
695 Ga0070702_100391958
696 Ga0068859_100006650
697 Ga0068859_100040915
698 Ga0068859_100060272
699 Ga0068859_100062483
700 Ga0068859_100402627
701 Ga0068859_100888539
702 Ga0068859_101177293
703 Ga0068864_100057493
704 Ga0068864_100081409
705 Ga0068864_100217109
706 Ga0068864_100310684
707 Ga0068866_10094772
708 Ga0068866_10151810
709 Ga0068866_10416149
710 Ga0068861_100019863
711 Ga0068861_100155837
712 Ga0068861_100159184
713 Ga0068861_100414462
714 Ga0068861_100422005
715 Ga0068851_10024781
716 Ga0068870_10005876
717 Ga0068870_10027885
718 Ga0068870_10152888
719 Ga0068863_100386657
720 Ga0068863_100530853
721 Ga0068863_100530875
722 Ga0068858_100018327
723 Ga0068858_100158718
724 Ga0068858_100234027
725 Ga0068858_100722199
726 Ga0068860_100045085
727 Ga0068860_100193363
728 Ga0068862_100021497
729 Ga0068862_100056969
730 Ga0068862_100211105
731 Ga0068862_100443351
732 Ga0081539_10000024
733 Ga0081539_10000096
734 Ga0081539_10005511
735 Ga0097621_100062610
736 Ga0097621_100073417
737 Ga0097621_100103369
738 Ga0097621_100114609
739 Ga0097621_100646779
740 Ga0068871_100122775
741 Ga0068871_100134247
742 Ga0068871_100193280
743 Ga0075428_100009166
744 Ga0075428_100015658
745 Ga0075428_100043182
746 Ga0075428_100266218
747 Ga0075428_100283042
748 Ga0075428_100624642
749 Ga0075431_100315906
750 Ga0075431_100967829
751 Ga0075433_10000366
752 Ga0075434_100005175
753 Ga0075434_100108265
754 Ga0075434_100111874
755 Ga0075434_100189624
756 Ga0075434_100327700
757 Ga0075429_100052743
758 Ga0075429_100133382
759 Ga0075429_100368411
760 Ga0075429_100471030
761 Ga0068865_100029033
762 Ga0068865_100296869
763 Ga0097620_100006650
764 Ga0097620_100040914
765 Ga0097620_100060271
766 Ga0097620_100062483
767 Ga0097620_100402644
768 Ga0097620_100888746
769 Ga0097620_101177042
770 Ga0075435_100011172
771 Ga0075435_100398038
772 Ga0111539_10011424
773 Ga0111539_10015925
774 Ga0111539_10024410
775 Ga0111539_10030231
776 Ga0111539_10071491
777 Ga0111539_10120187
778 Ga0111539_10131666
779 Ga0111539_10145024
780 Ga0111539_10175970
781 Ga0111539_10239415
782 Ga0111539_10442171
783 Ga0111539_10693039
784 Ga0111539_10919532
785 Ga0105247_10361194
786 Ga0114129_10006192
787 Ga0114129_10007639
788 Ga0114129_10009128
789 Ga0114129_10016116
790 Ga0114129_10022259
791 Ga0114129_10045771
792 Ga0114129_10066953
793 Ga0114129_10119000
794 Ga0114129_10361695
795 Ga0105243_10004580
796 Ga0105243_10124205
797 Ga0105243_11066598
798 Ga0105242_10023664
799 Ga0105242_10140517
800 Ga0105242_11145077
801 Ga0105248_10012430
802 Ga0105248_10030063
803 Ga0105248_10347904
804 Ga0105248_10348881
805 Ga0105248_10498373
806 Ga0105249_10019826
807 Ga0105249_10148236
808 Ga0105249_10154468
809 Ga0105246_10273209
810 Ga0105246_10354521
811 Ga0157374_10064129
812 Ga0157374_10071421
813 Ga0157374_10814177
814 Ga0157378_10204760
815 Ga0157378_10983120
816 Ga0163162_10167477
817 Ga0163162_10213405
818 Ga0157375_10015742
819 Ga0163163_10027406
820 Ga0163163_10059180
821 Ga0163163_10069546
822 Ga0163163_10111107
823 Ga0163163_10254334
824 Ga0163163_10292530
825 Ga0157380_10003694
826 Ga0157380_10008404
827 Ga0157380_10012213
828 Ga0157380_10119468
829 Ga0157380_10122982
830 Ga0157380_10142562
831 Ga0157380_10358002
832 Ga0157380_10473677
833 Ga0157380_10587540
834 Ga0157380_11142868
835 Ga0157377_10133341
836 Ga0157377_10147285
837 Ga0157377_10151868
838 Ga0157377_10160625
839 Ga0157377_10170002
840 Ga0157379_10969109
841 Ga0157376_10049638
842 Ga0157376_10101508
843 Ga0157376_10536827
844 Ga0163161_10345640
845 Ga0207697_10148934
846 Ga0207682_10076945
847 Ga0207642_10068283
848 Ga0207688_10179350
849 Ga0207680_10122430
850 Ga0207680_10161223
851 Ga0207680_10203342
852 Ga0207645_10015914
853 Ga0207645_10282707
854 Ga0207643_10009297
855 Ga0207643_10027348
856 Ga0207643_10094901
857 Ga0207684_10328002
858 Ga0207707_10101625
859 Ga0207660_10240594
860 Ga0207660_10274814
861 Ga0207660_10432462
862 Ga0207662_10010247
863 Ga0207662_10075720
864 Ga0207662_10083958
865 Ga0207662_10290163
866 Ga0207657_10054439
867 Ga0207657_10468573
868 Ga0207649_10042447
869 Ga0207649_10144066
870 Ga0207652_10394173
871 Ga0207646_10129906
872 Ga0207646_10162787
873 Ga0207681_10028363
874 Ga0207681_10044090
875 Ga0207681_10286705
876 Ga0207650_10010310
877 Ga0207650_10049784
878 Ga0207650_10374198
879 Ga0207659_10004608
880 Ga0207659_10008009
881 Ga0207659_10008078
882 Ga0207659_10100238
883 Ga0207659_10145666
884 Ga0207659_10314179
885 Ga0207659_10577164
886 Ga0207700_10162836
887 Ga0207644_10011636
888 Ga0207644_10029863
889 Ga0207644_10087082
890 Ga0207644_10164515
891 Ga0207644_10389716
892 Ga0207644_10436872
893 Ga0207706_10319326
894 Ga0207686_10013964
895 Ga0207709_10004075
896 Ga0207709_10075326
897 Ga0207670_10011157
898 Ga0207670_10112650
899 Ga0207670_10121009
900 Ga0207670_10170991
901 Ga0207669_10014873
902 Ga0207704_10002296
903 Ga0207704_10492654
904 Ga0207691_10006272
905 Ga0207691_10027293
906 Ga0207691_10057651
907 Ga0207691_10064067
908 Ga0207691_10251096
909 Ga0207711_10156077
910 Ga0207711_10202324
911 Ga0207711_10399672
912 Ga0207689_10000643
913 Ga0207689_10640172
914 Ga0207689_10695931
915 Ga0207661_10103806
916 Ga0207679_10008413
917 Ga0207679_10009773
918 Ga0207679_10240097
919 Ga0207679_10377003
920 Ga0207679_10592444
921 Ga0207651_10007877
922 Ga0207651_10050296
923 Ga0207651_10142300
924 Ga0207651_10202462
925 Ga0207712_10033762
926 Ga0207712_11065349
927 Ga0207668_10501425
928 Ga0207668_10969520
929 Ga0207640_10125988
930 Ga0207640_10190788
931 Ga0207658_10586181
932 Ga0207677_10253855
933 Ga0207703_10039807
934 Ga0207703_10049146
935 Ga0207703_10192978
936 Ga0207703_10198628
937 Ga0207703_10226609
938 Ga0207703_10669030
939 Ga0207678_10189390
940 Ga0207678_10447499
941 Ga0207708_10006092
942 Ga0207708_10006872
943 Ga0207708_10061069
944 Ga0207708_10081081
945 Ga0207708_10521054
946 Ga0207708_10656538
947 Ga0207641_10026606
948 Ga0207641_10473503
949 Ga0207641_10600621
950 Ga0207641_10949153
951 Ga0207648_10002125
952 Ga0207648_10009276
953 Ga0207648_10056695
954 Ga0207648_10105644
955 Ga0207648_10145193
956 Ga0207676_10029017
957 Ga0207676_10099170
958 Ga0207676_10237821
959 Ga0207674_10109921
960 Ga0207674_10133717
961 Ga0207675_100026370
962 Ga0207675_100075959
963 Ga0207675_100198568
964 Ga0207675_100248217
965 Ga0207683_10024926
966 Ga0207683_10123722
967 Ga0207683_10240063
968 Ga0207683_10561235
969 Ga0207683_10894591
970 Ga0207698_10164242
971 Ga0207428_10002752
972 Ga0207428_10007895
973 Ga0207428_10059655
974 Ga0207428_10423306
975 Ga0268265_10014801
976 Ga0268265_10018194
977 Ga0268265_10123486
978 Ga0268265_10184182
979 Ga0268265_10536856
980 Ga0268264_10006095
981 Ga0268264_10172354
982 Ga0268264_10352721
983 Ga0307408_100301948
984 Ga0307405_10001687
985 Ga0307405_10112924
986 Ga0307413_10098517
987 Ga0307410_10032109
988 Ga0307410_10446191
989 Ga0307406_10096590
990 Ga0307407_10004256
991 Ga0307412_10028351
992 Ga0307412_10139973
993 Ga0307412_10567245
994 Ga0307409_100023913
995 Ga0307409_100227573
996 Ga0307416_100002805
997 Ga0307416_101412494
998 Ga0307414_10239196
999 Ga0307411_10206942
1000 Ga0307411_10517196
1001 Ga0307415_100067586
1002 Ga0373940_0115397
1003 Ga0373939_0017225
1004 Ga0451853_2909224
1005 Ga0451853_3107687
1006 Ga0450923_007686
1007 Ga0439435_0013157
1008 Ga0439460_0005471
1009 Ga0450916_009106
1010 Ga0450918_047848
1011 Ga0451576_0005505
1012 Ga0451576_0046438
1013 Ga0451576_0049151
1014 Ga0451576_0091162
1015 Ga0451576_0267193
1016 Ga0451576_0636454
1017 Ga0495603_0014577
1018 Ga0495603_0306752
1019 Ga0495580_0094830
1020 Ga0495584_0294003
1021 Ga0495643_0009719
1022 Ga0495663_0051581
1023 Ga0495663_0064023
1024 Ga0495665_0166140
1025 Ga0495598_0114704
1026 Ga0495621_0000944
1027 Ga0495656_0042635
1028 Ga0495659_0004844
1029 Ga0495659_0028328
1030 Ga0495659_0041800
1031 Ga0495659_0053135
1032 Ga0495647_0074561
1033 Ga0495658_0178801
1034 Ga0495669_0005387
1035 Ga0495669_0068518
1036 Ga0495670_0055574
1037 Ga0495677_0061547
1038 Ga0496102_0918946
1039 Ga0496104_0002662
1040 Ga0496105_0033702
1041 Ga0496106_0191235
1042 Ga0496107_0643130
1043 Ga0496108_0079391
1044 Ga0496111_0113155
1045 Ga0496112_0021088
1046 Ga0501031_0262002
1047 Ga0501033_0293437
1048 Ga0501036_0070381
1049 Ga0501036_0891809
1050 Ga0501038_0534988
1051 Ga0501040_0281499
1052 Ga0501040_0444566
1053 Ga0501041_0063192
1054 Ga0501042_0084169
1055 Ga0501042_0171120
1056 Ga0501042_0419439
1057 Ga0501046_0090543
1058 Ga0501048_0258558
1059 Ga0501048_0298864
1060 Ga0501067_0101600
1061 Ga0501071_0017623
1062 Ga0501073_0012257
1063 Ga0501073_0149965
1064 Ga0501074_0044835
1065 Ga0501074_0232635
1066 Ga0501076_0075923
1067 Ga0501076_0111085
1068 Ga0501076_0123599
1069 Ga0501081_0039028
1070 nmdc:mga05p37_1594_c1
1071 nmdc:mga05p37_177523_c1
1072 nmdc:mga05p37_181862_c1
1073 nmdc:mga05p37_34881_c1
1074 nmdc:mga05p37_5255_c1
1075 nmdc:mga05p37_73276_c1
1076 nmdc:mga09592_142488_c1
1077 nmdc:mga09592_183823_c1
1078 nmdc:mga09592_475198_c1
1079 nmdc:mga09592_520150_c1
1080 nmdc:mga09592_6960_c1
1081 nmdc:mga09592_92094_c1
1082 nmdc:mga06r32_109745_c1
1083 nmdc:mga06r32_293510_c1
1084 nmdc:mga08y16_13902_c1
1085 nmdc:mga08y16_20109_c1
1086 nmdc:mga08y16_286747_c1
1087 nmdc:mga08y16_3647_c1
1088 nmdc:mga08y16_40551_c1
1089 nmdc:mga08y16_408210_c1
1090 nmdc:mga08y16_460869_c1
1091 nmdc:mga08y16_79465_c1
1092 nmdc:mga08y16_821217_c1
1093 nmdc:mga0n895_298725_c1
1094 nmdc:mga0n895_4404_c1
1095 nmdc:mga0n895_459390_c1
1096 nmdc:mga0n895_47935_c1
1097 nmdc:mga0n895_577128_c1
1098 nmdc:mga0rr50_130414_c1
1099 nmdc:mga0rr50_407253_c1
1100 nmdc:mga0rr50_530199_c1
1101 nmdc:mga0rr50_580792_c1
1102 nmdc:mga0a205_1038_c1
1103 nmdc:mga0a205_149862_c1
1104 Ga0500646_0008489
1105 Ga0500555_011459
1106 Ga0500628_015279
1107 Ga0501084_0297082
1108 Ga0501084_0420135
1109 Ga0590071_000383
1110 Ga0590075_001130
1111 Ga0590075_006947
1112 Ga0590077_000447
1113 Ga0590077_011058
1114 Ga0501082_0132113
1115 Ga0501082_0207105
1116 Ga0530510_0017603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06508

QueC

Queuosine biosynthesis protein QueC

30

240

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8088 7 212
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8043 7 212
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.7859 7 212
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.782 7 212
2pg3-assembly1.cif.gz_A-2 crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution 0.7679 7 212
ID Description Score Start End Superfamily
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8507 8 219 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8223 6 211 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8016 8 219 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7871 6 211 3.40.50.620
1korA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7417 7 178 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2G4JJR6-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9908 7 225
AF-A0A7W0QNP4-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9886 8 225
AF-A0A2D8R4V0-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9877 7 225
AF-A0A7Z9T943-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9871 2 225
AF-A0A2V8GBF9-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9803 73 225

Map