F463405

General Info

Members Datasets Scaffolds Average Seq Length
558 252 558 295

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100158049|Ga0070674_1001580491
Length 319
Sequence MISESDCSMKVAVVAHAGKTLGGGLPELRRALEAAGIADPFWREVRKSAKAPPQVRRALDDGAELLIAWGGDGLVQRCVDTLAGSDVPLAIIPAGTANLFATSLGIPGDIEDALAVGLRGERRPLDVGRFNGERFAVMAGAGFDAAMIQDAAAGLKDRVGRAAYVWTGVKNIRSKSFRATIKVDGAAWYKGSASCILVGNIGALFGGVEVFEDARPDDGKLELGVVTADGVLEWSRLLARVAAGRASKSPFAQTTKARKVKVKFDRKVLYELDGGDRTEVRAFKIKVEPGAVLVCVPNRDGAKDRAEKAGVGEERVPVA

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.56
Rhizosphere 80.47
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000148 3300002459 Bacteria 33693
2 JGI25406J46586_10055127 3300003203 Unclassified 1311
3 Ga0070683_100044035 3300005329 Bacteria 4115
4 Ga0070683_100081090 3300005329 Bacteria 3037
5 Ga0070690_100193674 3300005330 Bacteria 1411
6 Ga0070670_100030467 3300005331 Bacteria 4646
7 Ga0070666_10008453 3300005335 Bacteria 6394
8 Ga0070666_10010965 3300005335 Bacteria 5680
9 Ga0070680_100031167 3300005336 Bacteria 4287
10 Ga0070680_100041644 3300005336 Bacteria 3724
11 Ga0070682_100016484 3300005337 Bacteria 4296
12 Ga0068868_100001037 3300005338 Bacteria 18995
13 Ga0068868_100019057 3300005338 Bacteria 5137
14 Ga0068868_100144159 3300005338 Bacteria 1957
15 Ga0068868_100220711 3300005338 Unclassified 1587
16 Ga0070660_100124502 3300005339 Bacteria 2059
17 Ga0070689_100040572 3300005340 Bacteria 3570
18 Ga0070691_10142924 3300005341 Bacteria 1221
19 Ga0070661_100000005 3300005344 Bacteria 220455
20 Ga0070661_100062019 3300005344 Unclassified 2745
21 Ga0070692_10212873 3300005345 Bacteria 1138
22 Ga0070675_100000131 3300005354 Bacteria 45094
23 Ga0070675_100021521 3300005354 Bacteria 5154
24 Ga0070675_100122423 3300005354 Bacteria 2211
25 Ga0070671_100001557 3300005355 Bacteria 17259
26 Ga0070671_100060909 3300005355 Bacteria 3143
27 Ga0070674_100158049 3300005356 Bacteria 1717
28 Ga0070688_100000179 3300005365 Bacteria 34153
29 Ga0070659_100000031 3300005366 Bacteria 125048
30 Ga0070659_100401010 3300005366 Bacteria 1158
31 Ga0070667_100001609 3300005367 Bacteria 20208
32 Ga0070667_100008571 3300005367 Bacteria 8474
33 Ga0070703_10006034 3300005406 Bacteria 3392
34 Ga0070709_10059938 3300005434 Bacteria 2418
35 Ga0070709_10071033 3300005434 Bacteria 2246
36 Ga0070713_100148354 3300005436 Bacteria 2084
37 Ga0070710_10000005 3300005437 Bacteria 238049
38 Ga0070711_100051270 3300005439 Bacteria 2833
39 Ga0070700_100004175 3300005441 Bacteria 7532
40 Ga0070694_100045239 3300005444 Bacteria 2949
41 Ga0070663_100028898 3300005455 Bacteria 3781
42 Ga0070663_100040368 3300005455 Bacteria 3267
43 Ga0070678_100004586 3300005456 Bacteria 7852
44 Ga0070678_100041009 3300005456 Bacteria 3279
45 Ga0070678_100054027 3300005456 Bacteria 2924
46 Ga0070678_100144853 3300005456 Bacteria 1906
47 Ga0070681_10016198 3300005458 Bacteria 7433
48 Ga0070685_10000037 3300005466 Bacteria 80557
49 Ga0070699_100017336 3300005518 Bacteria 6184
50 Ga0070679_100066246 3300005530 Bacteria 3600
51 Ga0070684_100001247 3300005535 Bacteria 18228
52 Ga0070684_100011235 3300005535 Bacteria 7129
53 Ga0070684_100017997 3300005535 Bacteria 5809
54 Ga0070672_100182218 3300005543 Bacteria 1750
55 Ga0070686_100022910 3300005544 Bacteria 3726
56 Ga0070686_100049080 3300005544 Bacteria 2676
57 Ga0070686_100090569 3300005544 Bacteria 2045
58 Ga0070686_100091187 3300005544 Bacteria 2039
59 Ga0070686_100132591 3300005544 Bacteria 1725
60 Ga0070695_100292490 3300005545 Bacteria 1201
61 Ga0070695_100409380 3300005545 Bacteria 1030
62 Ga0070693_100003883 3300005547 Bacteria 7009
63 Ga0070665_100003628 3300005548 Bacteria 16353
64 Ga0070665_100021798 3300005548 Bacteria 6441
65 Ga0070665_100042438 3300005548 Bacteria 4572
66 Ga0070665_100122893 3300005548 Bacteria 2598
67 Ga0070664_100014477 3300005564 Bacteria 6431
68 Ga0068857_100234473 3300005577 Bacteria 1679
69 Ga0068857_100362642 3300005577 Unclassified 1343
70 Ga0068857_100427888 3300005577 Bacteria 1235
71 Ga0068854_100214244 3300005578 Bacteria 1521
72 Ga0068856_100006784 3300005614 Bacteria 11205
73 Ga0068856_100016807 3300005614 Bacteria 7090
74 Ga0070702_100001653 3300005615 Bacteria 9245
75 Ga0070702_100034671 3300005615 Bacteria 2783
76 Ga0068852_100000005 3300005616 Bacteria 173127
77 Ga0068864_100210561 3300005618 Bacteria 1790
78 Ga0068851_10014554 3300005834 Bacteria 3737
79 Ga0068870_10000134 3300005840 Bacteria 25602
80 Ga0068863_100000032 3300005841 Bacteria 172402
81 Ga0068863_100018968 3300005841 Bacteria 6583
82 Ga0068858_100016814 3300005842 Bacteria 6870
83 Ga0068858_100020724 3300005842 Bacteria 6142
84 Ga0068858_100088394 3300005842 Bacteria 2883
85 Ga0068858_100182736 3300005842 Bacteria 1980
86 Ga0068862_100000585 3300005844 Bacteria 37913
87 Ga0068862_100206852 3300005844 Bacteria 1772
88 Ga0081455_10005567 3300005937 Bacteria 13790
89 Ga0081455_10069450 3300005937 Bacteria 2929
90 Ga0081540_1013926 3300005983 Bacteria 5192
91 Ga0081539_10001249 3300005985 Bacteria 45085
92 Ga0081539_10002410 3300005985 Bacteria 26480
93 Ga0070717_10100048 3300006028 Bacteria 2461
94 Ga0070715_10018044 3300006163 Bacteria 2682
95 Ga0070715_10230125 3300006163 Bacteria 958
96 Ga0070716_100016305 3300006173 Bacteria 3831
97 Ga0070716_100026482 3300006173 Bacteria 3106
98 Ga0070712_100002111 3300006175 Bacteria 12214
99 Ga0070712_100105310 3300006175 Unclassified 2094
100 Ga0070712_100424909 3300006175 Unclassified 1102
101 Ga0097621_100032125 3300006237 Bacteria 4171
102 Ga0097621_100178156 3300006237 Bacteria 1836
103 Ga0097621_100180216 3300006237 Bacteria 1825
104 Ga0097621_100212056 3300006237 Bacteria 1685
105 Ga0068871_100029649 3300006358 Bacteria 4299
106 Ga0068871_100030605 3300006358 Bacteria 4240
107 Ga0068871_100101674 3300006358 Bacteria 2409
108 Ga0068871_100374475 3300006358 Bacteria 1264
109 Ga0075431_100358995 3300006847 Bacteria 1464
110 Ga0075433_10044244 3300006852 Unclassified 3868
111 Ga0075433_10057257 3300006852 Bacteria 3407
112 Ga0075433_10086914 3300006852 Bacteria 2761
113 Ga0075434_100008485 3300006871 Bacteria 9559
114 Ga0075434_100080643 3300006871 Bacteria 3251
115 Ga0105251_10036010 3300009011 Bacteria 2439
116 Ga0105250_10064194 3300009092 Bacteria 1479
117 Ga0111539_10069825 3300009094 Bacteria 4148
118 Ga0111539_10126625 3300009094 Bacteria 2992
119 Ga0111539_10180681 3300009094 Bacteria 2464
120 Ga0111539_10359886 3300009094 Bacteria 1694
121 Ga0105245_10000067 3300009098 Bacteria 107929
122 Ga0105245_10000365 3300009098 Bacteria 42328
123 Ga0105245_10044950 3300009098 Bacteria 3943
124 Ga0105245_10227757 3300009098 Bacteria 1801
125 Ga0105245_10334342 3300009098 Bacteria 1496
126 Ga0105245_10456928 3300009098 Bacteria 1287
127 Ga0105247_10109408 3300009101 Bacteria 1776
128 Ga0114129_10164216 3300009147 Bacteria 3031
129 Ga0114129_10650715 3300009147 Bacteria 1360
130 Ga0105243_10052918 3300009148 Bacteria 3218
131 Ga0105243_10059541 3300009148 Bacteria 3048
132 Ga0105241_10034193 3300009174 Bacteria 3817
133 Ga0105241_10050527 3300009174 Bacteria 3169
134 Ga0105241_10063770 3300009174 Bacteria 2844
135 Ga0105242_10001765 3300009176 Bacteria 17067
136 Ga0105248_10000134 3300009177 Bacteria 86132
137 Ga0105248_10036864 3300009177 Bacteria 5469
138 Ga0105248_10056907 3300009177 Bacteria 4388
139 Ga0105248_10145720 3300009177 Bacteria 2672
140 Ga0105248_10274112 3300009177 Unclassified 1900
141 Ga0105248_10415110 3300009177 Bacteria 1516
142 Ga0105238_10185824 3300009551 Bacteria 2055
143 Ga0105249_10000392 3300009553 Bacteria 42706
144 Ga0105249_10422248 3300009553 Bacteria 1367
145 Ga0105239_10094953 3300010375 Bacteria 3294
146 Ga0105239_10209358 3300010375 Unclassified 2185
147 Ga0105246_10027868 3300011119 Bacteria 3707
148 Ga0105246_10040753 3300011119 Bacteria 3136
149 Ga0105246_10065812 3300011119 Bacteria 2535
150 Ga0105246_10194385 3300011119 Bacteria 1573
151 Ga0157342_1002966 3300012507 Bacteria 1423
152 Ga0157371_10008568 3300013102 Bacteria 8132
153 Ga0157369_10000130 3300013105 Bacteria 108193
154 Ga0157369_10069755 3300013105 Unclassified 3776
155 Ga0157374_10410876 3300013296 Bacteria 1351
156 Ga0157378_10000564 3300013297 Bacteria 35171
157 Ga0157378_10014353 3300013297 Bacteria 6936
158 Ga0163162_10378963 3300013306 Bacteria 1548
159 Ga0163162_10484434 3300013306 Unclassified 1368
160 Ga0163162_10543892 3300013306 Bacteria 1290
161 Ga0163162_10645390 3300013306 Unclassified 1182
162 Ga0157372_10313693 3300013307 Unclassified 1825
163 Ga0157372_10472763 3300013307 Bacteria 1461
164 Ga0157375_10632495 3300013308 Bacteria 1227
165 Ga0163163_10024577 3300014325 Bacteria 5735
166 Ga0163163_10186665 3300014325 Bacteria 2121
167 Ga0163163_10410941 3300014325 Bacteria 1412
168 Ga0182008_10075745 3300014497 Bacteria 1655
169 Ga0157379_10003348 3300014968 Bacteria 13581
170 Ga0157379_10003890 3300014968 Bacteria 12730
171 Ga0157379_10014682 3300014968 Bacteria 6871
172 Ga0157379_10273964 3300014968 Bacteria 1535
173 Ga0157376_10005906 3300014969 Bacteria 8595
174 Ga0157376_10010077 3300014969 Bacteria 6900
175 Ga0157376_10014830 3300014969 Bacteria 5866
176 Ga0157376_10026604 3300014969 Bacteria 4574
177 Ga0157376_10060523 3300014969 Bacteria 3180
178 Ga0207656_10041469 3300025321 Bacteria 1956
179 Ga0207653_10004918 3300025885 Bacteria 4176
180 Ga0207653_10024186 3300025885 Unclassified 1938
181 Ga0207692_10000003 3300025898 Bacteria 431531
182 Ga0207642_10107098 3300025899 Bacteria 1416
183 Ga0207688_10013426 3300025901 Bacteria 4451
184 Ga0207680_10004025 3300025903 Bacteria 6944
185 Ga0207680_10004790 3300025903 Bacteria 6442
186 Ga0207647_10052161 3300025904 Bacteria 2525
187 Ga0207643_10000485 3300025908 Bacteria 25562
188 Ga0207705_10023804 3300025909 Bacteria 4369
189 Ga0207654_10056898 3300025911 Bacteria 2270
190 Ga0207707_10011818 3300025912 Bacteria 7591
191 Ga0207693_10012486 3300025915 Bacteria 6861
192 Ga0207693_10129062 3300025915 Unclassified 1987
193 Ga0207693_10356030 3300025915 Unclassified 1145
194 Ga0207663_10006365 3300025916 Bacteria 6038
195 Ga0207663_10020273 3300025916 Bacteria 3762
196 Ga0207663_10115438 3300025916 Bacteria 1829
197 Ga0207657_10125805 3300025919 Bacteria 2105
198 Ga0207657_10129203 3300025919 Bacteria 2072
199 Ga0207649_10000005 3300025920 Bacteria 356179
200 Ga0207649_10021645 3300025920 Bacteria 3705
201 Ga0207652_10008925 3300025921 Bacteria 8079
202 Ga0207650_10002510 3300025925 Bacteria 12744
203 Ga0207659_10000014 3300025926 Bacteria 168481
204 Ga0207659_10121913 3300025926 Bacteria 1999
205 Ga0207659_10159173 3300025926 Bacteria 1771
206 Ga0207687_10000011 3300025927 Bacteria 388349
207 Ga0207687_10000012 3300025927 Bacteria 370729
208 Ga0207687_10104135 3300025927 Bacteria 2094
209 Ga0207687_10201851 3300025927 Unclassified 1555
210 Ga0207700_10029338 3300025928 Bacteria 3880
211 Ga0207700_10262942 3300025928 Unclassified 1478
212 Ga0207664_10012362 3300025929 Bacteria 6101
213 Ga0207664_10035262 3300025929 Bacteria 3859
214 Ga0207644_10021153 3300025931 Bacteria 4429
215 Ga0207644_10028204 3300025931 Bacteria 3884
216 Ga0207644_10422070 3300025931 Bacteria 1093
217 Ga0207690_10000057 3300025932 Bacteria 100648
218 Ga0207706_10155379 3300025933 Bacteria 2012
219 Ga0207686_10289262 3300025934 Bacteria 1213
220 Ga0207709_10004104 3300025935 Bacteria 8481
221 Ga0207709_10018346 3300025935 Bacteria 3918
222 Ga0207669_10201681 3300025937 Bacteria 1445
223 Ga0207669_10205675 3300025937 Bacteria 1433
224 Ga0207704_10102957 3300025938 Unclassified 1908
225 Ga0207665_10000195 3300025939 Bacteria 40705
226 Ga0207665_10001871 3300025939 Bacteria 14187
227 Ga0207691_10055123 3300025940 Bacteria 3625
228 Ga0207711_10000024 3300025941 Bacteria 293596
229 Ga0207711_10029140 3300025941 Bacteria 4653
230 Ga0207711_10268225 3300025941 Bacteria 1570
231 Ga0207711_10288083 3300025941 Unclassified 1513
232 Ga0207711_10382336 3300025941 Bacteria 1306
233 Ga0207661_10000145 3300025944 Bacteria 45007
234 Ga0207661_10000550 3300025944 Bacteria 23997
235 Ga0207661_10002679 3300025944 Bacteria 12260
236 Ga0207661_10062458 3300025944 Bacteria 3014
237 Ga0207661_10063955 3300025944 Bacteria 2981
238 Ga0207679_10017728 3300025945 Bacteria 4756
239 Ga0207679_10071313 3300025945 Bacteria 2620
240 Ga0207679_10203917 3300025945 Bacteria 1654
241 Ga0207712_10002083 3300025961 Bacteria 13097
242 Ga0207668_10006847 3300025972 Bacteria 6759
243 Ga0207640_10404100 3300025981 Bacteria 1113
244 Ga0207658_10005076 3300025986 Bacteria 9057
245 Ga0207658_10032748 3300025986 Bacteria 3702
246 Ga0207658_10068542 3300025986 Bacteria 2677
247 Ga0207677_10000497 3300026023 Bacteria 25525
248 Ga0207703_10005692 3300026035 Bacteria 9998
249 Ga0207703_10024690 3300026035 Bacteria 4729
250 Ga0207703_10105957 3300026035 Bacteria 2390
251 Ga0207703_10217560 3300026035 Bacteria 1706
252 Ga0207703_10300159 3300026035 Bacteria 1464
253 Ga0207678_10060299 3300026067 Bacteria 3263
254 Ga0207678_10082901 3300026067 Bacteria 2743
255 Ga0207708_10001317 3300026075 Bacteria 18650
256 Ga0207702_10002839 3300026078 Bacteria 16194
257 Ga0207702_10038113 3300026078 Bacteria 4026
258 Ga0207702_10040588 3300026078 Bacteria 3901
259 Ga0207641_10000071 3300026088 Bacteria 151812
260 Ga0207641_10013865 3300026088 Bacteria 6612
261 Ga0207641_10028834 3300026088 Bacteria 4588
262 Ga0207641_10113949 3300026088 Unclassified 2402
263 Ga0207648_10547515 3300026089 Bacteria 1063
264 Ga0207674_10007726 3300026116 Bacteria 12518
265 Ga0207674_10037067 3300026116 Bacteria 5074
266 Ga0207674_10175981 3300026116 Bacteria 2092
267 Ga0207674_10185686 3300026116 Bacteria 2030
268 Ga0207675_100194983 3300026118 Bacteria 1944
269 Ga0207683_10000353 3300026121 Bacteria 42039
270 Ga0207683_10000833 3300026121 Bacteria 28215
271 Ga0207683_10032980 3300026121 Bacteria 4498
272 Ga0207683_10041159 3300026121 Bacteria 4033
273 Ga0207683_10060776 3300026121 Bacteria 3322
274 Ga0207698_10000038 3300026142 Bacteria 101918
275 Ga0207698_10152139 3300026142 Bacteria 2010
276 Ga0207428_10019920 3300027907 Bacteria 5713
277 Ga0268266_10000085 3300028379 Bacteria 201288
278 Ga0268266_10000303 3300028379 Bacteria 78632
279 Ga0268266_10030395 3300028379 Bacteria 4589
280 Ga0268265_10004635 3300028380 Bacteria 9494
281 Ga0268265_10007739 3300028380 Bacteria 7252
282 Ga0268264_10406503 3300028381 Bacteria 1309
283 Ga0373928_0011127 3300035084 Bacteria 1777
284 Ga0373949_0017344 3300035090 Unclassified 1622
285 Ga0373939_0006555 3300035114 Bacteria 2808
286 Ga0373941_0003460 3300035115 Bacteria 3576
287 Ga0373945_0002474 3300035116 Bacteria 5794
288 Ga0373943_0014243 3300035170 Bacteria 3597
289 Ga0373942_0024414 3300035207 Bacteria 1550
290 Ga0373942_0039405 3300035207 Bacteria 1285
291 Ga0373961_0025287 3300035241 Bacteria 1613
292 Ga0373935_0027841 3300035692 Bacteria 3493
293 Ga0373935_0269694 3300035692 Bacteria 1196
294 Ga0373947_0013419 3300035725 Bacteria 4694
295 Ga0373947_0015776 3300035725 Bacteria 4339
296 Ga0373937_0183042 3300036401 Bacteria 1968
297 Ga0373925_0008537 3300037068 Bacteria 7465
298 Ga0395899_0032240 3300037312 Bacteria 3937
299 Ga0395899_0041560 3300037312 Bacteria 3435
300 Ga0395898_0138803 3300037466 Bacteria 2327
301 Ga0395898_0140999 3300037466 Bacteria 2307
302 Ga0395905_0043279 3300037471 Bacteria 4225
303 Ga0395905_0113863 3300037471 Bacteria 2541
304 Ga0395901_0027166 3300038443 Bacteria 5879
305 Ga0395901_0090345 3300038443 Bacteria 3205
306 Ga0395901_0152636 3300038443 Bacteria 2427
307 Ga0436362_0743083 3300039453 Bacteria 1406
308 Ga0451849_0746551 3300041505 Bacteria 2239
309 Ga0466963_0092609 3300044694 Bacteria 2059
310 Ga0466957_0001680 3300044842 Bacteria 11630
311 Ga0495592_0086690 3300046454 Bacteria 2254
312 Ga0495603_0015336 3300046455 Bacteria 4637
313 Ga0495603_0095412 3300046455 Unclassified 1738
314 Ga0495591_023681 3300046458 Bacteria 1962
315 Ga0495629_0000055 3300046459 Bacteria 105268
316 Ga0495629_0000964 3300046459 Bacteria 23212
317 Ga0495629_0021894 3300046459 Bacteria 4560
318 Ga0495629_0038584 3300046459 Bacteria 3363
319 Ga0495629_0100518 3300046459 Bacteria 2018
320 Ga0495638_0078665 3300046460 Bacteria 2006
321 Ga0495641_0000362 3300046461 Bacteria 37539
322 Ga0495641_0019076 3300046461 Bacteria 3521
323 Ga0495641_0153658 3300046461 Unclassified 1029
324 Ga0495651_0052215 3300046462 Bacteria 3149
325 Ga0495651_0106004 3300046462 Bacteria 2084
326 Ga0495653_0113481 3300046463 Bacteria 1943
327 Ga0495653_0233345 3300046463 Bacteria 1230
328 Ga0495650_0000035 3300046471 Bacteria 403799
329 Ga0495582_0000114 3300046473 Bacteria 42283
330 Ga0495582_0022489 3300046473 Bacteria 3451
331 Ga0495582_0022757 3300046473 Bacteria 3428
332 Ga0495639_0004982 3300046475 Bacteria 5700
333 Ga0495639_0060472 3300046475 Bacteria 1736
334 Ga0495662_0043194 3300046476 Bacteria 2176
335 Ga0495662_0045337 3300046476 Bacteria 2122
336 Ga0495594_0024843 3300046499 Unclassified 3221
337 Ga0495594_0278490 3300046499 Bacteria 953
338 Ga0495607_0169160 3300046501 Bacteria 1105
339 Ga0495606_0000057 3300046507 Bacteria 197956
340 Ga0495608_0017951 3300046511 Bacteria 4890
341 Ga0495608_0070500 3300046511 Bacteria 2281
342 Ga0495618_0139586 3300046514 Bacteria 1550
343 Ga0495618_0239363 3300046514 Bacteria 1141
344 Ga0495628_0017526 3300046516 Bacteria 5959
345 Ga0495630_0000025 3300046517 Bacteria 152364
346 Ga0495630_0005182 3300046517 Bacteria 9187
347 Ga0495630_0011491 3300046517 Bacteria 6411
348 Ga0495630_0027497 3300046517 Bacteria 4221
349 Ga0495630_0208834 3300046517 Bacteria 1490
350 Ga0495630_0214392 3300046517 Bacteria 1469
351 Ga0495666_0066114 3300046526 Bacteria 1724
352 Ga0495666_0112019 3300046526 Bacteria 1281
353 Ga0495652_0026709 3300046529 Bacteria 5096
354 Ga0495652_0027111 3300046529 Bacteria 5051
355 Ga0495652_0036969 3300046529 Bacteria 4239
356 Ga0495665_0003022 3300046531 Bacteria 9090
357 Ga0495640_0004060 3300046533 Bacteria 11712
358 Ga0495640_0014647 3300046533 Bacteria 5924
359 Ga0495640_0021878 3300046533 Bacteria 4684
360 Ga0495640_0038461 3300046533 Bacteria 3365
361 Ga0495640_0045666 3300046533 Bacteria 3039
362 Ga0495586_0153320 3300046535 Bacteria 1297
363 Ga0495645_0005733 3300046543 Bacteria 8554
364 Ga0495645_0093658 3300046543 Bacteria 2143
365 Ga0495622_0087725 3300046557 Bacteria 1430
366 Ga0495667_0001761 3300046559 Bacteria 14378
367 Ga0495667_0004957 3300046559 Bacteria 9002
368 Ga0495667_0106918 3300046559 Bacteria 1808
369 Ga0495667_0157131 3300046559 Bacteria 1463
370 Ga0495656_0000342 3300046615 Bacteria 15822
371 Ga0495656_0058622 3300046615 Unclassified 1672
372 Ga0495634_0011424 3300046642 Bacteria 6468
373 Ga0495634_0032075 3300046642 Bacteria 3615
374 Ga0495634_0073133 3300046642 Bacteria 2254
375 Ga0495634_0115855 3300046642 Bacteria 1719
376 Ga0495625_0000117 3300046660 Bacteria 121901
377 Ga0495635_0019624 3300046663 Bacteria 4709
378 Ga0495635_0048275 3300046663 Bacteria 2935
379 Ga0495635_0127141 3300046663 Bacteria 1738
380 Ga0495588_0141925 3300046674 Bacteria 1269
381 Ga0495599_0004807 3300046678 Bacteria 8031
382 Ga0495647_0003410 3300046681 Bacteria 5089
383 Ga0495658_0000467 3300046683 Bacteria 22368
384 Ga0495658_0057774 3300046683 Unclassified 2217
385 Ga0495669_0000131 3300046684 Bacteria 47864
386 Ga0495613_0002520 3300046689 Bacteria 13804
387 Ga0495613_0004956 3300046689 Bacteria 9998
388 Ga0495613_0160223 3300046689 Bacteria 1601
389 Ga0495624_0000298 3300046690 Bacteria 39145
390 Ga0495624_0016745 3300046690 Bacteria 4933
391 Ga0495624_0114406 3300046690 Bacteria 1658
392 Ga0495600_0025488 3300046809 Bacteria 3811
393 Ga0495600_0357236 3300046809 Unclassified 914
394 Ga0495581_0000327 3300047315 Bacteria 23532
395 Ga0495581_0111877 3300047315 Bacteria 1588
396 Ga0495581_0273927 3300047315 Bacteria 987
397 Ga0495674_0003915 3300047319 Bacteria 14459
398 Ga0495674_0037948 3300047319 Bacteria 4328
399 Ga0495674_0050317 3300047319 Bacteria 3677
400 Ga0495674_0074370 3300047319 Bacteria 2926
401 Ga0495672_0026848 3300047320 Bacteria 3668
402 Ga0495676_0003147 3300047321 Bacteria 14929
403 Ga0495676_0004361 3300047321 Bacteria 12923
404 Ga0495676_0133436 3300047321 Bacteria 1789
405 Ga0495676_0289303 3300047321 Bacteria 1107
406 Ga0495680_0004812 3300047322 Bacteria 12810
407 Ga0495680_0005132 3300047322 Bacteria 12364
408 Ga0495680_0080740 3300047322 Bacteria 2457
409 Ga0495680_0211455 3300047322 Bacteria 1388
410 Ga0495684_0001004 3300047471 Bacteria 22963
411 Ga0495684_0005850 3300047471 Bacteria 9553
412 Ga0495684_0028038 3300047471 Bacteria 4325
413 Ga0495684_0031245 3300047471 Unclassified 4088
414 Ga0495684_0087567 3300047471 Bacteria 2360
415 Ga0495593_0001350 3300047673 Bacteria 14336
416 Ga0495593_0086389 3300047673 Unclassified 1618
417 Ga0495602_0379090 3300048088 Unclassified 1014
418 Ga0495614_0072341 3300048089 Bacteria 1487
419 Ga0496100_0003570 3300048903 Bacteria 8128
420 Ga0496100_0006619 3300048903 Bacteria 6333
421 Ga0496100_0040122 3300048903 Bacteria 2976
422 Ga0496100_0079068 3300048903 Unclassified 2215
423 Ga0496100_0147854 3300048903 Bacteria 1672
424 Ga0496100_0162898 3300048903 Bacteria 1600
425 Ga0496101_0001547 3300048904 Bacteria 13788
426 Ga0496101_0026364 3300048904 Bacteria 4040
427 Ga0496101_0056356 3300048904 Bacteria 2841
428 Ga0496101_0071012 3300048904 Bacteria 2551
429 Ga0496101_0125121 3300048904 Bacteria 1947
430 Ga0496101_0256232 3300048904 Unclassified 1364
431 Ga0496101_0454001 3300048904 Bacteria 1011
432 Ga0496102_0006839 3300048905 Bacteria 9736
433 Ga0496102_0036801 3300048905 Bacteria 4411
434 Ga0496102_0037504 3300048905 Bacteria 4373
435 Ga0496102_0057067 3300048905 Bacteria 3563
436 Ga0496102_0077666 3300048905 Bacteria 3056
437 Ga0496102_0098762 3300048905 Bacteria 2709
438 Ga0496103_0073169 3300048906 Bacteria 2147
439 Ga0496103_0190594 3300048906 Bacteria 1318
440 Ga0496104_0001009 3300048907 Bacteria 24141
441 Ga0496104_0005385 3300048907 Bacteria 11204
442 Ga0496104_0015020 3300048907 Bacteria 7005
443 Ga0496104_0031644 3300048907 Bacteria 4922
444 Ga0496104_0198848 3300048907 Bacteria 1916
445 Ga0496104_0265031 3300048907 Unclassified 1631
446 Ga0496104_0415605 3300048907 Bacteria 1257
447 Ga0496105_0000621 3300048908 Bacteria 23731
448 Ga0496105_0002429 3300048908 Bacteria 13502
449 Ga0496105_0007700 3300048908 Bacteria 8354
450 Ga0496105_0038610 3300048908 Bacteria 3934
451 Ga0496105_0066592 3300048908 Bacteria 2974
452 Ga0496105_0077330 3300048908 Bacteria 2748
453 Ga0496105_0188109 3300048908 Bacteria 1689
454 Ga0496106_0054659 3300048909 Bacteria 3016
455 Ga0496106_0073673 3300048909 Bacteria 2612
456 Ga0496106_0118502 3300048909 Unclassified 2067
457 Ga0496106_0134753 3300048909 Bacteria 1939
458 Ga0496107_0054943 3300048910 Bacteria 2875
459 Ga0496107_0069330 3300048910 Unclassified 2559
460 Ga0496107_0175356 3300048910 Bacteria 1591
461 Ga0496107_0232497 3300048910 Unclassified 1372
462 Ga0496107_0328725 3300048910 Bacteria 1137
463 Ga0496108_0004554 3300048911 Bacteria 11169
464 Ga0496108_0011228 3300048911 Bacteria 7276
465 Ga0496108_0017457 3300048911 Bacteria 5872
466 Ga0496108_0020124 3300048911 Bacteria 5484
467 Ga0496108_0095827 3300048911 Bacteria 2527
468 Ga0496108_0104898 3300048911 Unclassified 2413
469 Ga0496108_0105486 3300048911 Unclassified 2406
470 Ga0496108_0133873 3300048911 Bacteria 2131
471 Ga0496109_0000039 3300048912 Bacteria 145769
472 Ga0496109_0001979 3300048912 Bacteria 16983
473 Ga0496109_0002568 3300048912 Bacteria 15206
474 Ga0496109_0024637 3300048912 Bacteria 5351
475 Ga0496109_0068075 3300048912 Bacteria 3263
476 Ga0496109_0156360 3300048912 Bacteria 2135
477 Ga0496109_0164948 3300048912 Bacteria 2077
478 Ga0496109_0331681 3300048912 Unclassified 1436
479 Ga0496110_0000075 3300048913 Bacteria 51198
480 Ga0496110_0000112 3300048913 Bacteria 44496
481 Ga0496110_0001216 3300048913 Bacteria 18334
482 Ga0496110_0011878 3300048913 Bacteria 7153
483 Ga0496110_0032838 3300048913 Bacteria 4487
484 Ga0496110_0036705 3300048913 Bacteria 4257
485 Ga0496110_0039830 3300048913 Bacteria 4093
486 Ga0496110_0138024 3300048913 Bacteria 2204
487 Ga0496110_0168925 3300048913 Bacteria 1984
488 Ga0496111_0001251 3300048914 Bacteria 14216
489 Ga0496111_0002463 3300048914 Bacteria 11166
490 Ga0496111_0004048 3300048914 Bacteria 9210
491 Ga0496111_0023673 3300048914 Bacteria 4314
492 Ga0496111_0127810 3300048914 Bacteria 1879
493 Ga0496111_0347184 3300048914 Bacteria 1098
494 Ga0496111_0447629 3300048914 Unclassified 953
495 Ga0496112_0075308 3300048915 Bacteria 3338
496 Ga0496112_0158217 3300048915 Bacteria 2232
497 Ga0496113_0008888 3300048916 Bacteria 6570
498 Ga0496113_0043170 3300048916 Bacteria 3335
499 Ga0496113_0093538 3300048916 Bacteria 2321
500 Ga0496113_0100007 3300048916 Unclassified 2247
501 Ga0496113_0109451 3300048916 Bacteria 2149
502 Ga0496113_0125179 3300048916 Bacteria 2012
503 Ga0496114_0000247 3300048917 Bacteria 39314
504 Ga0496114_0007783 3300048917 Bacteria 8479
505 Ga0496114_0014169 3300048917 Bacteria 6395
506 Ga0496114_0041276 3300048917 Bacteria 3823
507 Ga0496114_0052065 3300048917 Unclassified 3410
508 Ga0496114_0114146 3300048917 Bacteria 2316
509 Ga0496114_0337935 3300048917 Bacteria 1331
510 Ga0496115_0042038 3300048918 Bacteria 3640
511 Ga0496115_0042170 3300048918 Bacteria 3635
512 Ga0496115_0049129 3300048918 Bacteria 3375
513 Ga0496115_0096472 3300048918 Bacteria 2421
514 Ga0496115_0100232 3300048918 Bacteria 2374
515 Ga0496115_0121748 3300048918 Bacteria 2147
516 Ga0496115_0460451 3300048918 Bacteria 1026
517 Ga0496117_0001208 3300048920 Bacteria 38735
518 Ga0496118_0000414 3300048921 Bacteria 71146
519 Ga0496119_0003338 3300048922 Bacteria 16720
520 Ga0496119_0061678 3300048922 Bacteria 2238
521 Ga0496120_0002177 3300048923 Bacteria 20787
522 Ga0496121_0013091 3300048924 Bacteria 8954
523 Ga0496121_0070868 3300048924 Bacteria 2805
524 Ga0496124_0083634 3300048927 Bacteria 2618
525 Ga0496125_0019567 3300048928 Bacteria 6380
526 Ga0496126_0005418 3300048929 Bacteria 14555
527 Ga0501042_0029657 3300049578 Bacteria 3859
528 Ga0501047_0325788 3300049581 Bacteria 1375
529 Ga0501067_0014156 3300049583 Bacteria 4417
530 Ga0501067_0083059 3300049583 Bacteria 1777
531 Ga0501069_0001436 3300049585 Bacteria 11683
532 Ga0501070_0006631 3300049586 Bacteria 9853
533 Ga0501071_0111507 3300049587 Bacteria 2022
534 Ga0501076_0037238 3300049592 Bacteria 3814
535 nmdc:mga05p37_135111_c1 3300050507 Bacteria 3025
536 nmdc:mga05p37_283783_c1 3300050507 Bacteria 1973
537 nmdc:mga06r32_251868_c1 3300050510 Unclassified 1753
538 nmdc:mga08y16_119625_c1 3300050511 Bacteria 2741
539 nmdc:mga08y16_308349_c1 3300050511 Bacteria 1630
540 nmdc:mga08y16_42346_c1 3300050511 Bacteria 4769
541 nmdc:mga0n895_252937_c1 3300050512 Bacteria 1788
542 nmdc:mga0rr50_201261_c1 3300050513 Bacteria 1636
543 nmdc:mga0rr50_228882_c1 3300050513 Bacteria 1538
544 nmdc:mga08x19_145522_c1 3300050514 Bacteria 1602
545 nmdc:mga0a205_17551_c1 3300050515 Bacteria 6714
546 nmdc:mga0a205_23081_c1 3300050515 Bacteria 5900
547 nmdc:mga0a205_276811_c1 3300050515 Bacteria 1554
548 nmdc:mga0a205_28771_c1 3300050515 Bacteria 5314
549 nmdc:mga0a205_369487_c1 3300050515 Bacteria 1300
550 Ga0495601_0001813 3300053077 Bacteria 11867
551 Ga0495601_0025163 3300053077 Bacteria 3669
552 Ga0495595_0097445 3300053084 Bacteria 1417
553 Ga0495619_0003326 3300053085 Bacteria 10391
554 Ga0495619_0091499 3300053085 Unclassified 2059
555 Ga0495619_0098743 3300053085 Bacteria 1985
556 Ga0495619_0129041 3300053085 Bacteria 1737
557 Ga0501082_0231217 3300060353 Bacteria 1609
558 Ga0530510_0057246 3300061734 Unclassified 2816

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0168925 Ga0496110_0168925_488_1249 246
2 3300025938 Ga0207704_10102957 Ga0207704_101029571 256
3 3300035114 Ga0373939_0006555 Ga0373939_0006555_1955_2761 261
4 3300048907 Ga0496104_0265031 Ga0496104_0265031_48_845 261
5 3300046615 Ga0495656_0058622 Ga0495656_0058622_191_982 263
6 3300046674 Ga0495588_0141925 Ga0495588_0141925_450_1241 263
7 3300046475 Ga0495639_0060472 Ga0495639_0060472_619_1509 265
8 3300048918 Ga0496115_0460451 Ga0496115_0460451_25_822 265
9 3300035207 Ga0373942_0024414 Ga0373942_0024414_14_835 266
10 3300048916 Ga0496113_0093538 Ga0496113_0093538_173_1069 266
11 3300049583 Ga0501067_0014156 Ga0501067_0014156_1589_2395 267
12 3300049585 Ga0501069_0001436 Ga0501069_0001436_7756_8562 267
13 3300061734 Ga0530510_0057246 Ga0530510_0057246_1292_2098 267
14 3300005614 Ga0068856_100006784 Ga0068856_1000067845 269
15 3300005616 Ga0068852_100000005 Ga0068852_10000000594 269
16 3300009177 Ga0105248_10000134 Ga0105248_1000013441 269
17 3300025941 Ga0207711_10000024 Ga0207711_10000024245 269
18 3300026078 Ga0207702_10002839 Ga0207702_100028395 269
19 3300026142 Ga0207698_10000038 Ga0207698_1000003815 269
20 3300009098 Ga0105245_10456928 Ga0105245_104569282 270
21 3300005338 Ga0068868_100001037 Ga0068868_10000103711 271
22 3300026023 Ga0207677_10000497 Ga0207677_1000049720 271
23 3300046514 Ga0495618_0239363 Ga0495618_0239363_29_865 271
24 3300005577 Ga0068857_100427888 Ga0068857_1004278882 272
25 3300026116 Ga0207674_10175981 Ga0207674_101759812 272
26 3300005335 Ga0070666_10010965 Ga0070666_100109656 273
27 3300005367 Ga0070667_100001609 Ga0070667_10000160910 273
28 3300005544 Ga0070686_100132591 Ga0070686_1001325912 273
29 3300005548 Ga0070665_100003628 Ga0070665_1000036285 273
30 3300005548 Ga0070665_100122893 Ga0070665_1001228933 273
31 3300005842 Ga0068858_100088394 Ga0068858_1000883942 273
32 3300005844 Ga0068862_100000585 Ga0068862_1000005855 273
33 3300009553 Ga0105249_10000392 Ga0105249_1000039235 273
34 3300013306 Ga0163162_10645390 Ga0163162_106453901 273
35 3300014968 Ga0157379_10014682 Ga0157379_100146826 273
36 3300025903 Ga0207680_10004025 Ga0207680_100040255 273
37 3300025961 Ga0207712_10002083 Ga0207712_1000208310 273
38 3300025972 Ga0207668_10006847 Ga0207668_100068473 273
39 3300025986 Ga0207658_10032748 Ga0207658_100327482 273
40 3300026035 Ga0207703_10105957 Ga0207703_101059572 273
41 3300028379 Ga0268266_10000303 Ga0268266_1000030337 273
42 3300028380 Ga0268265_10004635 Ga0268265_100046356 273
43 3300005365 Ga0070688_100000179 Ga0070688_10000017924 274
44 3300005466 Ga0070685_10000037 Ga0070685_1000003772 274
45 3300005548 Ga0070665_100042438 Ga0070665_1000424383 274
46 3300009098 Ga0105245_10000365 Ga0105245_1000036521 274
47 3300013105 Ga0157369_10000130 Ga0157369_1000013055 274
48 3300025927 Ga0207687_10000011 Ga0207687_1000001134 274
49 3300025986 Ga0207658_10068542 Ga0207658_100685422 274
50 3300028379 Ga0268266_10030395 Ga0268266_100303954 274
51 3300044694 Ga0466963_0092609 Ga0466963_0092609_38_934 274
52 3300044842 Ga0466957_0001680 Ga0466957_0001680_7225_8121 275
53 3300046459 Ga0495629_0000055 Ga0495629_0000055_30907_31803 275
54 3300046461 Ga0495641_0019076 Ga0495641_0019076_1149_2045 275
55 3300046517 Ga0495630_0000025 Ga0495630_0000025_112371_113267 275
56 3300046681 Ga0495647_0003410 Ga0495647_0003410_1546_2442 275
57 3300048911 Ga0496108_0011228 Ga0496108_0011228_3951_4847 275
58 3300048912 Ga0496109_0000039 Ga0496109_0000039_95888_96784 275
59 3300048927 Ga0496124_0083634 Ga0496124_0083634_645_1526 275
60 3300005329 Ga0070683_100044035 Ga0070683_1000440353 276
61 3300005354 Ga0070675_100000131 Ga0070675_10000013118 276
62 3300005535 Ga0070684_100017997 Ga0070684_1000179974 276
63 3300005834 Ga0068851_10014554 Ga0068851_100145545 276
64 3300009177 Ga0105248_10415110 Ga0105248_104151102 276
65 3300013102 Ga0157371_10008568 Ga0157371_100085688 276
66 3300013297 Ga0157378_10014353 Ga0157378_100143537 276
67 3300025321 Ga0207656_10041469 Ga0207656_100414692 276
68 3300025926 Ga0207659_10000014 Ga0207659_1000001431 276
69 3300025941 Ga0207711_10268225 Ga0207711_102682252 276
70 3300025944 Ga0207661_10000145 Ga0207661_1000014544 276
71 3300025944 Ga0207661_10000550 Ga0207661_100005507 276
72 3300046499 Ga0495594_0278490 Ga0495594_0278490_14_844 276
73 3300046507 Ga0495606_0000057 Ga0495606_0000057_80304_81200 276
74 3300047320 Ga0495672_0026848 Ga0495672_0026848_515_1411 276
75 3300047321 Ga0495676_0289303 Ga0495676_0289303_28_858 276
76 3300048914 Ga0496111_0023673 Ga0496111_0023673_1337_2233 276
77 3300005344 Ga0070661_100000005 Ga0070661_10000000552 277
78 3300006175 Ga0070712_100002111 Ga0070712_1000021114 277
79 3300014969 Ga0157376_10026604 Ga0157376_100266045 277
80 3300025915 Ga0207693_10012486 Ga0207693_100124865 277
81 3300025920 Ga0207649_10000005 Ga0207649_10000005196 277
82 3300048905 Ga0496102_0037504 Ga0496102_0037504_568_1413 277
83 3300049578 Ga0501042_0029657 Ga0501042_0029657_951_1847 277
84 3300025909 Ga0207705_10023804 Ga0207705_100238043 278
85 3300046690 Ga0495624_0000298 Ga0495624_0000298_9341_10237 278
86 3300025935 Ga0207709_10004104 Ga0207709_100041049 279
87 3300025945 Ga0207679_10017728 Ga0207679_100177285 279
88 3300026142 Ga0207698_10152139 Ga0207698_101521392 279
89 3300049586 Ga0501070_0006631 Ga0501070_0006631_3836_4726 280
90 3300046615 Ga0495656_0000342 Ga0495656_0000342_8127_9023 285
91 3300005937 Ga0081455_10069450 Ga0081455_100694502 287
92 3300025981 Ga0207640_10404100 Ga0207640_104041001 288
93 3300046462 Ga0495651_0052215 Ga0495651_0052215_687_1577 289
94 3300046517 Ga0495630_0027497 Ga0495630_0027497_2334_3224 289
95 3300046533 Ga0495640_0021878 Ga0495640_0021878_2140_3030 289
96 3300046559 Ga0495667_0004957 Ga0495667_0004957_3103_3993 289
97 3300046642 Ga0495634_0032075 Ga0495634_0032075_544_1434 289
98 3300047315 Ga0495581_0111877 Ga0495581_0111877_468_1358 289
99 3300047319 Ga0495674_0003915 Ga0495674_0003915_9158_10048 289
100 3300047321 Ga0495676_0133436 Ga0495676_0133436_435_1325 289
101 3300047322 Ga0495680_0005132 Ga0495680_0005132_6179_7069 289
102 3300053077 Ga0495601_0025163 Ga0495601_0025163_2450_3340 289
103 3300005434 Ga0070709_10059938 Ga0070709_100599382 290
104 3300005456 Ga0070678_100004586 Ga0070678_1000045869 291
105 3300005544 Ga0070686_100022910 Ga0070686_1000229102 291
106 3300005545 Ga0070695_100409380 Ga0070695_1004093801 291
107 3300005615 Ga0070702_100001653 Ga0070702_1000016537 291
108 3300005842 Ga0068858_100016814 Ga0068858_1000168146 291
109 3300005985 Ga0081539_10002410 Ga0081539_100024105 291
110 3300006163 Ga0070715_10230125 Ga0070715_102301251 291
111 3300006237 Ga0097621_100032125 Ga0097621_1000321252 291
112 3300006358 Ga0068871_100030605 Ga0068871_1000306054 291
113 3300009094 Ga0111539_10180681 Ga0111539_101806813 291
114 3300009098 Ga0105245_10227757 Ga0105245_102277572 291
115 3300009148 Ga0105243_10052918 Ga0105243_100529182 291
116 3300009174 Ga0105241_10050527 Ga0105241_100505272 291
117 3300009176 Ga0105242_10001765 Ga0105242_1000176513 291
118 3300011119 Ga0105246_10027868 Ga0105246_100278684 291
119 3300014968 Ga0157379_10003348 Ga0157379_100033484 291
120 3300014968 Ga0157379_10003890 Ga0157379_100038909 291
121 3300014969 Ga0157376_10005906 Ga0157376_100059062 291
122 3300025899 Ga0207642_10107098 Ga0207642_101070982 291
123 3300025935 Ga0207709_10018346 Ga0207709_100183462 291
124 3300025941 Ga0207711_10029140 Ga0207711_100291404 291
125 3300026035 Ga0207703_10024690 Ga0207703_100246904 291
126 3300026121 Ga0207683_10000353 Ga0207683_1000035343 291
127 3300037312 Ga0395899_0032240 Ga0395899_0032240_953_1828 291
128 3300046471 Ga0495650_0000035 Ga0495650_0000035_286892_287767 291
129 3300048903 Ga0496100_0040122 Ga0496100_0040122_1564_2439 291
130 3300048904 Ga0496101_0026364 Ga0496101_0026364_1008_1883 291
131 3300048905 Ga0496102_0098762 Ga0496102_0098762_870_1745 291
132 3300048906 Ga0496103_0073169 Ga0496103_0073169_328_1203 291
133 3300048907 Ga0496104_0015020 Ga0496104_0015020_5287_6162 291
134 3300048908 Ga0496105_0007700 Ga0496105_0007700_5059_5934 291
135 3300048909 Ga0496106_0054659 Ga0496106_0054659_1011_1886 291
136 3300048912 Ga0496109_0164948 Ga0496109_0164948_505_1380 291
137 3300048914 Ga0496111_0447629 Ga0496111_0447629_61_936 291
138 3300048917 Ga0496114_0337935 Ga0496114_0337935_195_1070 291
139 3300003203 JGI25406J46586_10055127 JGI25406J46586_100551271 292
140 3300005614 Ga0068856_100016807 Ga0068856_1000168074 292
141 3300005985 Ga0081539_10001249 Ga0081539_1000124910 292
142 3300009177 Ga0105248_10274112 Ga0105248_102741122 292
143 3300025941 Ga0207711_10288083 Ga0207711_102880831 292
144 3300047315 Ga0495581_0273927 Ga0495581_0273927_85_975 292
145 3300048903 Ga0496100_0006619 Ga0496100_0006619_1386_2267 292
146 3300048904 Ga0496101_0001547 Ga0496101_0001547_6432_7313 292
147 3300048905 Ga0496102_0077666 Ga0496102_0077666_781_1662 292
148 3300048907 Ga0496104_0001009 Ga0496104_0001009_9413_10294 292
149 3300048908 Ga0496105_0000621 Ga0496105_0000621_17996_18877 292
150 3300048911 Ga0496108_0004554 Ga0496108_0004554_4057_4938 292
151 3300048911 Ga0496108_0104898 Ga0496108_0104898_1081_1965 292
152 3300048912 Ga0496109_0002568 Ga0496109_0002568_4999_5880 292
153 3300048913 Ga0496110_0000075 Ga0496110_0000075_45233_46114 292
154 3300048914 Ga0496111_0001251 Ga0496111_0001251_3997_4878 292
155 3300048916 Ga0496113_0125179 Ga0496113_0125179_69_950 292
156 3300048917 Ga0496114_0041276 Ga0496114_0041276_2648_3547 292
157 3300049587 Ga0501071_0111507 Ga0501071_0111507_880_1761 292
158 3300005331 Ga0070670_100030467 Ga0070670_1000304673 293
159 3300005335 Ga0070666_10008453 Ga0070666_100084535 293
160 3300005338 Ga0068868_100144159 Ga0068868_1001441592 293
161 3300005340 Ga0070689_100040572 Ga0070689_1000405723 293
162 3300005345 Ga0070692_10212873 Ga0070692_102128732 293
163 3300005355 Ga0070671_100001557 Ga0070671_10000155718 293
164 3300005366 Ga0070659_100000031 Ga0070659_10000003153 293
165 3300005366 Ga0070659_100401010 Ga0070659_1004010101 293
166 3300005367 Ga0070667_100008571 Ga0070667_10000857110 293
167 3300005437 Ga0070710_10000005 Ga0070710_1000000510 293
168 3300005543 Ga0070672_100182218 Ga0070672_1001822182 293
169 3300005544 Ga0070686_100049080 Ga0070686_1000490802 293
170 3300005548 Ga0070665_100021798 Ga0070665_1000217985 293
171 3300005577 Ga0068857_100234473 Ga0068857_1002344732 293
172 3300005578 Ga0068854_100214244 Ga0068854_1002142442 293
173 3300005618 Ga0068864_100210561 Ga0068864_1002105612 293
174 3300005841 Ga0068863_100000032 Ga0068863_10000003274 293
175 3300005841 Ga0068863_100018968 Ga0068863_1000189683 293
176 3300005842 Ga0068858_100020724 Ga0068858_1000207246 293
177 3300005842 Ga0068858_100182736 Ga0068858_1001827362 293
178 3300005937 Ga0081455_10005567 Ga0081455_100055677 293
179 3300005983 Ga0081540_1013926 Ga0081540_10139263 293
180 3300006028 Ga0070717_10100048 Ga0070717_101000482 293
181 3300006175 Ga0070712_100424909 Ga0070712_1004249092 293
182 3300009098 Ga0105245_10000067 Ga0105245_1000006720 293
183 3300009101 Ga0105247_10109408 Ga0105247_101094082 293
184 3300009147 Ga0114129_10164216 Ga0114129_101642163 293
185 3300009148 Ga0105243_10059541 Ga0105243_100595412 293
186 3300009177 Ga0105248_10056907 Ga0105248_100569073 293
187 3300009553 Ga0105249_10422248 Ga0105249_104222482 293
188 3300010375 Ga0105239_10094953 Ga0105239_100949533 293
189 3300011119 Ga0105246_10040753 Ga0105246_100407532 293
190 3300013297 Ga0157378_10000564 Ga0157378_1000056428 293
191 3300013308 Ga0157375_10632495 Ga0157375_106324952 293
192 3300014325 Ga0163163_10186665 Ga0163163_101866652 293
193 3300014968 Ga0157379_10273964 Ga0157379_102739642 293
194 3300025898 Ga0207692_10000003 Ga0207692_10000003282 293
195 3300025901 Ga0207688_10013426 Ga0207688_100134263 293
196 3300025903 Ga0207680_10004790 Ga0207680_100047905 293
197 3300025904 Ga0207647_10052161 Ga0207647_100521612 293
198 3300025915 Ga0207693_10356030 Ga0207693_103560302 293
199 3300025919 Ga0207657_10129203 Ga0207657_101292032 293
200 3300025927 Ga0207687_10000012 Ga0207687_10000012335 293
201 3300025927 Ga0207687_10104135 Ga0207687_101041352 293
202 3300025931 Ga0207644_10028204 Ga0207644_100282043 293
203 3300025931 Ga0207644_10422070 Ga0207644_104220702 293
204 3300025932 Ga0207690_10000057 Ga0207690_1000005772 293
205 3300025933 Ga0207706_10155379 Ga0207706_101553792 293
206 3300025934 Ga0207686_10289262 Ga0207686_102892622 293
207 3300025937 Ga0207669_10201681 Ga0207669_102016812 293
208 3300025940 Ga0207691_10055123 Ga0207691_100551232 293
209 3300025941 Ga0207711_10382336 Ga0207711_103823362 293
210 3300025944 Ga0207661_10062458 Ga0207661_100624583 293
211 3300025944 Ga0207661_10063955 Ga0207661_100639552 293
212 3300025986 Ga0207658_10005076 Ga0207658_100050762 293
213 3300026035 Ga0207703_10005692 Ga0207703_100056926 293
214 3300026035 Ga0207703_10217560 Ga0207703_102175602 293
215 3300026035 Ga0207703_10300159 Ga0207703_103001592 293
216 3300026088 Ga0207641_10000071 Ga0207641_1000007174 293
217 3300026088 Ga0207641_10013865 Ga0207641_100138656 293
218 3300026116 Ga0207674_10037067 Ga0207674_100370673 293
219 3300026116 Ga0207674_10185686 Ga0207674_101856862 293
220 3300028379 Ga0268266_10000085 Ga0268266_10000085198 293
221 3300035116 Ga0373945_0002474 Ga0373945_0002474_765_1646 293
222 3300035170 Ga0373943_0014243 Ga0373943_0014243_1634_2515 293
223 3300035692 Ga0373935_0027841 Ga0373935_0027841_1633_2514 293
224 3300035692 Ga0373935_0269694 Ga0373935_0269694_263_1144 293
225 3300035725 Ga0373947_0013419 Ga0373947_0013419_1272_2153 293
226 3300035725 Ga0373947_0015776 Ga0373947_0015776_142_1023 293
227 3300037068 Ga0373925_0008537 Ga0373925_0008537_6341_7222 293
228 3300037312 Ga0395899_0041560 Ga0395899_0041560_1090_1989 293
229 3300037466 Ga0395898_0140999 Ga0395898_0140999_227_1126 293
230 3300037471 Ga0395905_0043279 Ga0395905_0043279_715_1623 293
231 3300037471 Ga0395905_0113863 Ga0395905_0113863_803_1702 293
232 3300038443 Ga0395901_0027166 Ga0395901_0027166_4191_5099 293
233 3300038443 Ga0395901_0090345 Ga0395901_0090345_479_1378 293
234 3300041505 Ga0451849_0746551 Ga0451849_0746551_1319_2215 293
235 3300046454 Ga0495592_0086690 Ga0495592_0086690_198_1079 293
236 3300046455 Ga0495603_0015336 Ga0495603_0015336_666_1547 293
237 3300046455 Ga0495603_0095412 Ga0495603_0095412_89_970 293
238 3300046458 Ga0495591_023681 Ga0495591_023681_291_1187 293
239 3300046459 Ga0495629_0000964 Ga0495629_0000964_1976_2872 293
240 3300046459 Ga0495629_0021894 Ga0495629_0021894_363_1244 293
241 3300046459 Ga0495629_0038584 Ga0495629_0038584_2287_3168 293
242 3300046459 Ga0495629_0100518 Ga0495629_0100518_57_938 293
243 3300046460 Ga0495638_0078665 Ga0495638_0078665_865_1761 293
244 3300046461 Ga0495641_0000362 Ga0495641_0000362_30087_30968 293
245 3300046461 Ga0495641_0153658 Ga0495641_0153658_20_928 293
246 3300046463 Ga0495653_0113481 Ga0495653_0113481_38_919 293
247 3300046463 Ga0495653_0233345 Ga0495653_0233345_143_1024 293
248 3300046473 Ga0495582_0000114 Ga0495582_0000114_4085_4966 293
249 3300046473 Ga0495582_0022489 Ga0495582_0022489_937_1818 293
250 3300046475 Ga0495639_0004982 Ga0495639_0004982_3981_4862 293
251 3300046476 Ga0495662_0043194 Ga0495662_0043194_1265_2146 293
252 3300046476 Ga0495662_0045337 Ga0495662_0045337_1147_2028 293
253 3300046499 Ga0495594_0024843 Ga0495594_0024843_1947_2828 293
254 3300046501 Ga0495607_0169160 Ga0495607_0169160_173_1066 293
255 3300046511 Ga0495608_0017951 Ga0495608_0017951_180_1061 293
256 3300046511 Ga0495608_0070500 Ga0495608_0070500_523_1404 293
257 3300046514 Ga0495618_0139586 Ga0495618_0139586_16_897 293
258 3300046516 Ga0495628_0017526 Ga0495628_0017526_196_1077 293
259 3300046517 Ga0495630_0214392 Ga0495630_0214392_294_1175 293
260 3300046526 Ga0495666_0066114 Ga0495666_0066114_338_1219 293
261 3300046526 Ga0495666_0112019 Ga0495666_0112019_73_981 293
262 3300046529 Ga0495652_0036969 Ga0495652_0036969_1425_2306 293
263 3300046531 Ga0495665_0003022 Ga0495665_0003022_7720_8601 293
264 3300046533 Ga0495640_0014647 Ga0495640_0014647_3011_3892 293
265 3300046533 Ga0495640_0038461 Ga0495640_0038461_1598_2479 293
266 3300046533 Ga0495640_0045666 Ga0495640_0045666_1535_2416 293
267 3300046543 Ga0495645_0093658 Ga0495645_0093658_73_954 293
268 3300046559 Ga0495667_0001761 Ga0495667_0001761_11946_12827 293
269 3300046559 Ga0495667_0106918 Ga0495667_0106918_425_1306 293
270 3300046559 Ga0495667_0157131 Ga0495667_0157131_235_1122 293
271 3300046642 Ga0495634_0115855 Ga0495634_0115855_793_1674 293
272 3300046660 Ga0495625_0000117 Ga0495625_0000117_27255_28157 293
273 3300046663 Ga0495635_0019624 Ga0495635_0019624_3067_3948 293
274 3300046663 Ga0495635_0048275 Ga0495635_0048275_781_1662 293
275 3300046683 Ga0495658_0000467 Ga0495658_0000467_13230_14111 293
276 3300046683 Ga0495658_0057774 Ga0495658_0057774_1257_2138 293
277 3300046684 Ga0495669_0000131 Ga0495669_0000131_44229_45125 293
278 3300046689 Ga0495613_0002520 Ga0495613_0002520_10695_11576 293
279 3300046689 Ga0495613_0004956 Ga0495613_0004956_490_1371 293
280 3300046690 Ga0495624_0016745 Ga0495624_0016745_2665_3546 293
281 3300046690 Ga0495624_0114406 Ga0495624_0114406_164_1072 293
282 3300046809 Ga0495600_0025488 Ga0495600_0025488_1918_2799 293
283 3300046809 Ga0495600_0357236 Ga0495600_0357236_15_896 293
284 3300047315 Ga0495581_0000327 Ga0495581_0000327_21505_22386 293
285 3300047319 Ga0495674_0050317 Ga0495674_0050317_1373_2254 293
286 3300047319 Ga0495674_0074370 Ga0495674_0074370_1817_2698 293
287 3300047321 Ga0495676_0003147 Ga0495676_0003147_8976_9857 293
288 3300047321 Ga0495676_0004361 Ga0495676_0004361_4964_5845 293
289 3300047322 Ga0495680_0004812 Ga0495680_0004812_7979_8860 293
290 3300047471 Ga0495684_0001004 Ga0495684_0001004_11679_12560 293
291 3300047471 Ga0495684_0005850 Ga0495684_0005850_5701_6582 293
292 3300047471 Ga0495684_0028038 Ga0495684_0028038_618_1499 293
293 3300047471 Ga0495684_0031245 Ga0495684_0031245_738_1619 293
294 3300047673 Ga0495593_0001350 Ga0495593_0001350_3391_4272 293
295 3300047673 Ga0495593_0086389 Ga0495593_0086389_81_962 293
296 3300048089 Ga0495614_0072341 Ga0495614_0072341_70_951 293
297 3300048904 Ga0496101_0256232 Ga0496101_0256232_413_1294 293
298 3300048904 Ga0496101_0454001 Ga0496101_0454001_37_930 293
299 3300048905 Ga0496102_0006839 Ga0496102_0006839_86_979 293
300 3300048905 Ga0496102_0057067 Ga0496102_0057067_350_1243 293
301 3300048906 Ga0496103_0190594 Ga0496103_0190594_151_1044 293
302 3300048907 Ga0496104_0005385 Ga0496104_0005385_8256_9146 293
303 3300048908 Ga0496105_0002429 Ga0496105_0002429_5928_6818 293
304 3300048910 Ga0496107_0232497 Ga0496107_0232497_160_1053 293
305 3300048912 Ga0496109_0024637 Ga0496109_0024637_625_1515 293
306 3300048913 Ga0496110_0000112 Ga0496110_0000112_39775_40665 293
307 3300048914 Ga0496111_0002463 Ga0496111_0002463_2395_3285 293
308 3300048916 Ga0496113_0043170 Ga0496113_0043170_2005_2901 293
309 3300048916 Ga0496113_0109451 Ga0496113_0109451_389_1279 293
310 3300048917 Ga0496114_0007783 Ga0496114_0007783_7076_7957 293
311 3300048918 Ga0496115_0042170 Ga0496115_0042170_1652_2533 293
312 3300048918 Ga0496115_0096472 Ga0496115_0096472_1089_1979 293
313 3300048920 Ga0496117_0001208 Ga0496117_0001208_21231_22124 293
314 3300048921 Ga0496118_0000414 Ga0496118_0000414_17172_18065 293
315 3300048922 Ga0496119_0003338 Ga0496119_0003338_2655_3545 293
316 3300048922 Ga0496119_0061678 Ga0496119_0061678_1067_1957 293
317 3300048923 Ga0496120_0002177 Ga0496120_0002177_18594_19484 293
318 3300048924 Ga0496121_0013091 Ga0496121_0013091_3988_4881 293
319 3300048924 Ga0496121_0070868 Ga0496121_0070868_898_1788 293
320 3300048928 Ga0496125_0019567 Ga0496125_0019567_3668_4558 293
321 3300048929 Ga0496126_0005418 Ga0496126_0005418_11184_12074 293
322 3300049581 Ga0501047_0325788 Ga0501047_0325788_364_1257 293
323 3300050507 nmdc:mga05p37_283783_c1 nmdc:mga05p37_283783_c1_642_1541 293
324 3300053085 Ga0495619_0003326 Ga0495619_0003326_5422_6303 293
325 3300053085 Ga0495619_0091499 Ga0495619_0091499_881_1762 293
326 3300053085 Ga0495619_0129041 Ga0495619_0129041_51_938 293
327 3300005330 Ga0070690_100193674 Ga0070690_1001936742 294
328 3300005336 Ga0070680_100031167 Ga0070680_1000311673 294
329 3300005337 Ga0070682_100016484 Ga0070682_1000164842 294
330 3300005434 Ga0070709_10071033 Ga0070709_100710332 294
331 3300005439 Ga0070711_100051270 Ga0070711_1000512703 294
332 3300005455 Ga0070663_100040368 Ga0070663_1000403682 294
333 3300005544 Ga0070686_100091187 Ga0070686_1000911872 294
334 3300005547 Ga0070693_100003883 Ga0070693_1000038834 294
335 3300006163 Ga0070715_10018044 Ga0070715_100180442 294
336 3300006173 Ga0070716_100016305 Ga0070716_1000163052 294
337 3300006358 Ga0068871_100029649 Ga0068871_1000296493 294
338 3300006871 Ga0075434_100008485 Ga0075434_1000084852 294
339 3300009177 Ga0105248_10036864 Ga0105248_100368643 294
340 3300014969 Ga0157376_10014830 Ga0157376_100148306 294
341 3300025916 Ga0207663_10020273 Ga0207663_100202733 294
342 3300025916 Ga0207663_10115438 Ga0207663_101154382 294
343 3300025928 Ga0207700_10029338 Ga0207700_100293382 294
344 3300025929 Ga0207664_10012362 Ga0207664_100123624 294
345 3300025929 Ga0207664_10035262 Ga0207664_100352624 294
346 3300025939 Ga0207665_10000195 Ga0207665_1000019532 294
347 3300025945 Ga0207679_10203917 Ga0207679_102039172 294
348 3300026067 Ga0207678_10060299 Ga0207678_100602993 294
349 3300026121 Ga0207683_10000833 Ga0207683_1000083327 294
350 3300035207 Ga0373942_0039405 Ga0373942_0039405_37_942 294
351 3300035241 Ga0373961_0025287 Ga0373961_0025287_678_1583 294
352 3300037466 Ga0395898_0138803 Ga0395898_0138803_510_1409 294
353 3300039453 Ga0436362_0743083 Ga0436362_0743083_375_1262 294
354 3300048088 Ga0495602_0379090 Ga0495602_0379090_44_943 294
355 3300048903 Ga0496100_0147854 Ga0496100_0147854_412_1317 294
356 3300048904 Ga0496101_0071012 Ga0496101_0071012_425_1366 294
357 3300048904 Ga0496101_0125121 Ga0496101_0125121_693_1598 294
358 3300048907 Ga0496104_0031644 Ga0496104_0031644_2167_3111 294
359 3300048908 Ga0496105_0066592 Ga0496105_0066592_213_1157 294
360 3300048909 Ga0496106_0073673 Ga0496106_0073673_624_1529 294
361 3300048909 Ga0496106_0118502 Ga0496106_0118502_923_1864 294
362 3300048910 Ga0496107_0069330 Ga0496107_0069330_991_1932 294
363 3300048910 Ga0496107_0175356 Ga0496107_0175356_63_968 294
364 3300048911 Ga0496108_0017457 Ga0496108_0017457_3004_3948 294
365 3300048912 Ga0496109_0001979 Ga0496109_0001979_14127_15071 294
366 3300048912 Ga0496109_0068075 Ga0496109_0068075_401_1306 294
367 3300048913 Ga0496110_0001216 Ga0496110_0001216_10405_11349 294
368 3300048915 Ga0496112_0075308 Ga0496112_0075308_824_1768 294
369 3300048915 Ga0496112_0158217 Ga0496112_0158217_244_1149 294
370 3300048916 Ga0496113_0008888 Ga0496113_0008888_1744_2688 294
371 3300048918 Ga0496115_0042038 Ga0496115_0042038_2216_3121 294
372 3300050512 nmdc:mga0n895_252937_c1 nmdc:mga0n895_252937_c1_851_1756 294
373 3300050515 nmdc:mga0a205_276811_c1 nmdc:mga0a205_276811_c1_456_1361 294
374 3300002459 JGI24751J29686_10000148 JGI24751J29686_1000014834 295
375 3300005329 Ga0070683_100081090 Ga0070683_1000810903 295
376 3300005336 Ga0070680_100041644 Ga0070680_1000416445 295
377 3300005338 Ga0068868_100019057 Ga0068868_1000190571 295
378 3300005338 Ga0068868_100220711 Ga0068868_1002207112 295
379 3300005339 Ga0070660_100124502 Ga0070660_1001245022 295
380 3300005341 Ga0070691_10142924 Ga0070691_101429242 295
381 3300005344 Ga0070661_100062019 Ga0070661_1000620193 295
382 3300005354 Ga0070675_100021521 Ga0070675_1000215213 295
383 3300005354 Ga0070675_100122423 Ga0070675_1001224232 295
384 3300005355 Ga0070671_100060909 Ga0070671_1000609093 295
385 3300005356 Ga0070674_100158049 Ga0070674_1001580491 295
386 3300005406 Ga0070703_10006034 Ga0070703_100060342 295
387 3300005436 Ga0070713_100148354 Ga0070713_1001483542 295
388 3300005441 Ga0070700_100004175 Ga0070700_1000041754 295
389 3300005444 Ga0070694_100045239 Ga0070694_1000452393 295
390 3300005455 Ga0070663_100028898 Ga0070663_1000288983 295
391 3300005456 Ga0070678_100041009 Ga0070678_1000410092 295
392 3300005456 Ga0070678_100054027 Ga0070678_1000540272 295
393 3300005456 Ga0070678_100144853 Ga0070678_1001448532 295
394 3300005458 Ga0070681_10016198 Ga0070681_100161985 295
395 3300005518 Ga0070699_100017336 Ga0070699_1000173364 295
396 3300005530 Ga0070679_100066246 Ga0070679_1000662462 295
397 3300005535 Ga0070684_100001247 Ga0070684_10000124713 295
398 3300005535 Ga0070684_100011235 Ga0070684_1000112354 295
399 3300005544 Ga0070686_100090569 Ga0070686_1000905692 295
400 3300005545 Ga0070695_100292490 Ga0070695_1002924902 295
401 3300005564 Ga0070664_100014477 Ga0070664_1000144772 295
402 3300005577 Ga0068857_100362642 Ga0068857_1003626422 295
403 3300005615 Ga0070702_100034671 Ga0070702_1000346713 295
404 3300005840 Ga0068870_10000134 Ga0068870_100001343 295
405 3300005844 Ga0068862_100206852 Ga0068862_1002068522 295
406 3300006173 Ga0070716_100026482 Ga0070716_1000264822 295
407 3300006175 Ga0070712_100105310 Ga0070712_1001053102 295
408 3300006237 Ga0097621_100178156 Ga0097621_1001781562 295
409 3300006237 Ga0097621_100180216 Ga0097621_1001802162 295
410 3300006237 Ga0097621_100212056 Ga0097621_1002120562 295
411 3300006358 Ga0068871_100101674 Ga0068871_1001016742 295
412 3300006358 Ga0068871_100374475 Ga0068871_1003744752 295
413 3300006847 Ga0075431_100358995 Ga0075431_1003589952 295
414 3300006852 Ga0075433_10044244 Ga0075433_100442442 295
415 3300006852 Ga0075433_10057257 Ga0075433_100572572 295
416 3300006852 Ga0075433_10086914 Ga0075433_100869142 295
417 3300006871 Ga0075434_100080643 Ga0075434_1000806433 295
418 3300009011 Ga0105251_10036010 Ga0105251_100360103 295
419 3300009092 Ga0105250_10064194 Ga0105250_100641942 295
420 3300009094 Ga0111539_10069825 Ga0111539_100698255 295
421 3300009094 Ga0111539_10126625 Ga0111539_101266253 295
422 3300009094 Ga0111539_10359886 Ga0111539_103598862 295
423 3300009098 Ga0105245_10044950 Ga0105245_100449503 295
424 3300009098 Ga0105245_10334342 Ga0105245_103343422 295
425 3300009147 Ga0114129_10650715 Ga0114129_106507152 295
426 3300009174 Ga0105241_10034193 Ga0105241_100341933 295
427 3300009174 Ga0105241_10063770 Ga0105241_100637703 295
428 3300009177 Ga0105248_10145720 Ga0105248_101457203 295
429 3300009551 Ga0105238_10185824 Ga0105238_101858242 295
430 3300010375 Ga0105239_10209358 Ga0105239_102093582 295
431 3300011119 Ga0105246_10065812 Ga0105246_100658122 295
432 3300011119 Ga0105246_10194385 Ga0105246_101943852 295
433 3300012507 Ga0157342_1002966 Ga0157342_10029662 295
434 3300013105 Ga0157369_10069755 Ga0157369_100697553 295
435 3300013296 Ga0157374_10410876 Ga0157374_104108762 295
436 3300013306 Ga0163162_10378963 Ga0163162_103789632 295
437 3300013306 Ga0163162_10484434 Ga0163162_104844342 295
438 3300013306 Ga0163162_10543892 Ga0163162_105438922 295
439 3300013307 Ga0157372_10313693 Ga0157372_103136932 295
440 3300013307 Ga0157372_10472763 Ga0157372_104727632 295
441 3300014325 Ga0163163_10024577 Ga0163163_100245772 295
442 3300014325 Ga0163163_10410941 Ga0163163_104109412 295
443 3300014497 Ga0182008_10075745 Ga0182008_100757451 295
444 3300014969 Ga0157376_10010077 Ga0157376_100100775 295
445 3300014969 Ga0157376_10060523 Ga0157376_100605233 295
446 3300025885 Ga0207653_10004918 Ga0207653_100049183 295
447 3300025885 Ga0207653_10024186 Ga0207653_100241862 295
448 3300025908 Ga0207643_10000485 Ga0207643_1000048516 295
449 3300025911 Ga0207654_10056898 Ga0207654_100568982 295
450 3300025912 Ga0207707_10011818 Ga0207707_100118184 295
451 3300025915 Ga0207693_10129062 Ga0207693_101290622 295
452 3300025916 Ga0207663_10006365 Ga0207663_100063654 295
453 3300025919 Ga0207657_10125805 Ga0207657_101258052 295
454 3300025920 Ga0207649_10021645 Ga0207649_100216453 295
455 3300025921 Ga0207652_10008925 Ga0207652_100089256 295
456 3300025925 Ga0207650_10002510 Ga0207650_100025102 295
457 3300025926 Ga0207659_10121913 Ga0207659_101219132 295
458 3300025926 Ga0207659_10159173 Ga0207659_101591731 295
459 3300025927 Ga0207687_10201851 Ga0207687_102018512 295
460 3300025928 Ga0207700_10262942 Ga0207700_102629422 295
461 3300025931 Ga0207644_10021153 Ga0207644_100211532 295
462 3300025937 Ga0207669_10205675 Ga0207669_102056752 295
463 3300025939 Ga0207665_10001871 Ga0207665_100018713 295
464 3300025944 Ga0207661_10002679 Ga0207661_1000267910 295
465 3300025945 Ga0207679_10071313 Ga0207679_100713132 295
466 3300026067 Ga0207678_10082901 Ga0207678_100829013 295
467 3300026075 Ga0207708_10001317 Ga0207708_100013179 295
468 3300026078 Ga0207702_10038113 Ga0207702_100381136 295
469 3300026078 Ga0207702_10040588 Ga0207702_100405883 295
470 3300026088 Ga0207641_10028834 Ga0207641_100288342 295
471 3300026088 Ga0207641_10113949 Ga0207641_101139492 295
472 3300026089 Ga0207648_10547515 Ga0207648_105475151 295
473 3300026116 Ga0207674_10007726 Ga0207674_100077266 295
474 3300026118 Ga0207675_100194983 Ga0207675_1001949832 295
475 3300026121 Ga0207683_10032980 Ga0207683_100329803 295
476 3300026121 Ga0207683_10041159 Ga0207683_100411593 295
477 3300026121 Ga0207683_10060776 Ga0207683_100607763 295
478 3300027907 Ga0207428_10019920 Ga0207428_100199204 295
479 3300028380 Ga0268265_10007739 Ga0268265_100077396 295
480 3300028381 Ga0268264_10406503 Ga0268264_104065032 295
481 3300035084 Ga0373928_0011127 Ga0373928_0011127_253_1161 295
482 3300035090 Ga0373949_0017344 Ga0373949_0017344_693_1601 295
483 3300035115 Ga0373941_0003460 Ga0373941_0003460_2114_3022 295
484 3300036401 Ga0373937_0183042 Ga0373937_0183042_876_1784 295
485 3300038443 Ga0395901_0152636 Ga0395901_0152636_890_1810 295
486 3300046462 Ga0495651_0106004 Ga0495651_0106004_968_1858 295
487 3300046473 Ga0495582_0022757 Ga0495582_0022757_2356_3264 295
488 3300046517 Ga0495630_0005182 Ga0495630_0005182_1538_2446 295
489 3300046517 Ga0495630_0011491 Ga0495630_0011491_949_1857 295
490 3300046517 Ga0495630_0208834 Ga0495630_0208834_19_909 295
491 3300046529 Ga0495652_0026709 Ga0495652_0026709_1827_2735 295
492 3300046529 Ga0495652_0027111 Ga0495652_0027111_2909_3799 295
493 3300046533 Ga0495640_0004060 Ga0495640_0004060_5726_6634 295
494 3300046535 Ga0495586_0153320 Ga0495586_0153320_297_1205 295
495 3300046543 Ga0495645_0005733 Ga0495645_0005733_2368_3276 295
496 3300046557 Ga0495622_0087725 Ga0495622_0087725_423_1331 295
497 3300046642 Ga0495634_0011424 Ga0495634_0011424_5264_6172 295
498 3300046642 Ga0495634_0073133 Ga0495634_0073133_1206_2114 295
499 3300046663 Ga0495635_0127141 Ga0495635_0127141_802_1710 295
500 3300046678 Ga0495599_0004807 Ga0495599_0004807_1412_2320 295
501 3300046689 Ga0495613_0160223 Ga0495613_0160223_321_1211 295
502 3300047319 Ga0495674_0037948 Ga0495674_0037948_1180_2088 295
503 3300047322 Ga0495680_0080740 Ga0495680_0080740_922_1812 295
504 3300047322 Ga0495680_0211455 Ga0495680_0211455_419_1327 295
505 3300047471 Ga0495684_0087567 Ga0495684_0087567_931_1821 295
506 3300048903 Ga0496100_0003570 Ga0496100_0003570_5116_6024 295
507 3300048903 Ga0496100_0079068 Ga0496100_0079068_1291_2199 295
508 3300048903 Ga0496100_0162898 Ga0496100_0162898_550_1458 295
509 3300048904 Ga0496101_0056356 Ga0496101_0056356_1005_1913 295
510 3300048905 Ga0496102_0036801 Ga0496102_0036801_857_1765 295
511 3300048907 Ga0496104_0198848 Ga0496104_0198848_497_1405 295
512 3300048907 Ga0496104_0415605 Ga0496104_0415605_107_1015 295
513 3300048908 Ga0496105_0038610 Ga0496105_0038610_2279_3187 295
514 3300048908 Ga0496105_0077330 Ga0496105_0077330_317_1225 295
515 3300048908 Ga0496105_0188109 Ga0496105_0188109_714_1622 295
516 3300048909 Ga0496106_0134753 Ga0496106_0134753_253_1161 295
517 3300048910 Ga0496107_0054943 Ga0496107_0054943_1727_2635 295
518 3300048910 Ga0496107_0328725 Ga0496107_0328725_121_1029 295
519 3300048911 Ga0496108_0020124 Ga0496108_0020124_2939_3847 295
520 3300048911 Ga0496108_0095827 Ga0496108_0095827_1424_2332 295
521 3300048911 Ga0496108_0105486 Ga0496108_0105486_934_1821 295
522 3300048911 Ga0496108_0133873 Ga0496108_0133873_297_1205 295
523 3300048912 Ga0496109_0156360 Ga0496109_0156360_436_1323 295
524 3300048912 Ga0496109_0331681 Ga0496109_0331681_455_1363 295
525 3300048913 Ga0496110_0011878 Ga0496110_0011878_788_1696 295
526 3300048913 Ga0496110_0032838 Ga0496110_0032838_2757_3665 295
527 3300048913 Ga0496110_0036705 Ga0496110_0036705_3019_3927 295
528 3300048913 Ga0496110_0039830 Ga0496110_0039830_1674_2582 295
529 3300048913 Ga0496110_0138024 Ga0496110_0138024_928_1836 295
530 3300048914 Ga0496111_0004048 Ga0496111_0004048_5048_5956 295
531 3300048914 Ga0496111_0127810 Ga0496111_0127810_676_1584 295
532 3300048914 Ga0496111_0347184 Ga0496111_0347184_33_941 295
533 3300048916 Ga0496113_0100007 Ga0496113_0100007_1047_1955 295
534 3300048917 Ga0496114_0000247 Ga0496114_0000247_2741_3649 295
535 3300048917 Ga0496114_0014169 Ga0496114_0014169_2732_3640 295
536 3300048917 Ga0496114_0052065 Ga0496114_0052065_2281_3189 295
537 3300048917 Ga0496114_0114146 Ga0496114_0114146_930_1838 295
538 3300048918 Ga0496115_0049129 Ga0496115_0049129_2095_3003 295
539 3300048918 Ga0496115_0100232 Ga0496115_0100232_1377_2285 295
540 3300048918 Ga0496115_0121748 Ga0496115_0121748_25_933 295
541 3300049583 Ga0501067_0083059 Ga0501067_0083059_163_1071 295
542 3300049592 Ga0501076_0037238 Ga0501076_0037238_2070_2960 295
543 3300050507 nmdc:mga05p37_135111_c1 nmdc:mga05p37_135111_c1_1486_2394 295
544 3300050510 nmdc:mga06r32_251868_c1 nmdc:mga06r32_251868_c1_717_1625 295
545 3300050511 nmdc:mga08y16_119625_c1 nmdc:mga08y16_119625_c1_1196_2083 295
546 3300050511 nmdc:mga08y16_308349_c1 nmdc:mga08y16_308349_c1_94_1002 295
547 3300050511 nmdc:mga08y16_42346_c1 nmdc:mga08y16_42346_c1_2897_3805 295
548 3300050513 nmdc:mga0rr50_201261_c1 nmdc:mga0rr50_201261_c1_179_1087 295
549 3300050513 nmdc:mga0rr50_228882_c1 nmdc:mga0rr50_228882_c1_456_1364 295
550 3300050514 nmdc:mga08x19_145522_c1 nmdc:mga08x19_145522_c1_579_1487 295
551 3300050515 nmdc:mga0a205_17551_c1 nmdc:mga0a205_17551_c1_3509_4417 295
552 3300050515 nmdc:mga0a205_23081_c1 nmdc:mga0a205_23081_c1_3311_4219 295
553 3300050515 nmdc:mga0a205_28771_c1 nmdc:mga0a205_28771_c1_772_1680 295
554 3300050515 nmdc:mga0a205_369487_c1 nmdc:mga0a205_369487_c1_339_1247 295
555 3300053077 Ga0495601_0001813 Ga0495601_0001813_2635_3525 295
556 3300053084 Ga0495595_0097445 Ga0495595_0097445_255_1163 295
557 3300053085 Ga0495619_0098743 Ga0495619_0098743_167_1075 295
558 3300060353 Ga0501082_0231217 Ga0501082_0231217_40_930 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19279

YegS_C

YegS C-terminal NAD kinase beta sandwich-like domain

137

296

0.9

PF00781

DAGK_cat

Diacylglycerol kinase catalytic domain

10

130

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qvl-assembly1.cif.gz_A crystal structure of diacylglycerol kinase 0.8939 4 290
2qv7-assembly1.cif.gz_A crystal structure of diacylglycerol kinase dgkb in complex with adp and mg 0.8591 4 290
4wer-assembly1.cif.gz_A-2 crystal structure of diacylglycerol kinase catalytic domain protein from enterococcus faecalis v583 0.8572 1 292
3s40-assembly5.cif.gz_D the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8556 2 289
3t5p-assembly3.cif.gz_I crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.8545 2 289
ID Description Score Start End Superfamily
af_P9WP29_9_143_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8825 4 122 3.40.50.10330
2jgrA02 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.843 122 282 2.60.200.40
af_A0A0R0JFH4_66_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8421 39 86 3.40.50.2300
2qvlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.838 4 114 3.40.50.10330
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8378 4 114 3.40.50.10330
ID Description Score Start End GO Terms
AF-W7VI28-F1-model_v4 deleted 0.9193 4 290
AF-A0A1G6GG18-F1-model_v4 Diacylglycerol kinase family enzyme 0.9096 4 290 GO:0005524
GO:0016020
GO:0016301
AF-A0A535HKM1-F1-model_v4 DAGKc domain-containing protein 0.9087 4 122 GO:0016301
AF-A0A7T8UE96-F1-model_v4 deleted 0.9027 4 290
AF-A0A3D0PRI0-F1-model_v4 YegS/DAGK C-terminal domain-containing protein 0.8956 189 285

Feature Viewer

pLDDT pTM Quality
79.17 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map