F463405
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 558 | 252 | 558 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100158049|Ga0070674_1001580491 |
| Length | 319 |
| Sequence | MISESDCSMKVAVVAHAGKTLGGGLPELRRALEAAGIADPFWREVRKSAKAPPQVRRALDDGAELLIAWGGDGLVQRCVDTLAGSDVPLAIIPAGTANLFATSLGIPGDIEDALAVGLRGERRPLDVGRFNGERFAVMAGAGFDAAMIQDAAAGLKDRVGRAAYVWTGVKNIRSKSFRATIKVDGAAWYKGSASCILVGNIGALFGGVEVFEDARPDDGKLELGVVTADGVLEWSRLLARVAAGRASKSPFAQTTKARKVKVKFDRKVLYELDGGDRTEVRAFKIKVEPGAVLVCVPNRDGAKDRAEKAGVGEERVPVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 143 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 158 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 159 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 160 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 227 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 228 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 229 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 232 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 233 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 17.56 |
| Rhizosphere | 80.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000148 | 3300002459 | Bacteria | 33693 |
| 2 | JGI25406J46586_10055127 | 3300003203 | Unclassified | 1311 |
| 3 | Ga0070683_100044035 | 3300005329 | Bacteria | 4115 |
| 4 | Ga0070683_100081090 | 3300005329 | Bacteria | 3037 |
| 5 | Ga0070690_100193674 | 3300005330 | Bacteria | 1411 |
| 6 | Ga0070670_100030467 | 3300005331 | Bacteria | 4646 |
| 7 | Ga0070666_10008453 | 3300005335 | Bacteria | 6394 |
| 8 | Ga0070666_10010965 | 3300005335 | Bacteria | 5680 |
| 9 | Ga0070680_100031167 | 3300005336 | Bacteria | 4287 |
| 10 | Ga0070680_100041644 | 3300005336 | Bacteria | 3724 |
| 11 | Ga0070682_100016484 | 3300005337 | Bacteria | 4296 |
| 12 | Ga0068868_100001037 | 3300005338 | Bacteria | 18995 |
| 13 | Ga0068868_100019057 | 3300005338 | Bacteria | 5137 |
| 14 | Ga0068868_100144159 | 3300005338 | Bacteria | 1957 |
| 15 | Ga0068868_100220711 | 3300005338 | Unclassified | 1587 |
| 16 | Ga0070660_100124502 | 3300005339 | Bacteria | 2059 |
| 17 | Ga0070689_100040572 | 3300005340 | Bacteria | 3570 |
| 18 | Ga0070691_10142924 | 3300005341 | Bacteria | 1221 |
| 19 | Ga0070661_100000005 | 3300005344 | Bacteria | 220455 |
| 20 | Ga0070661_100062019 | 3300005344 | Unclassified | 2745 |
| 21 | Ga0070692_10212873 | 3300005345 | Bacteria | 1138 |
| 22 | Ga0070675_100000131 | 3300005354 | Bacteria | 45094 |
| 23 | Ga0070675_100021521 | 3300005354 | Bacteria | 5154 |
| 24 | Ga0070675_100122423 | 3300005354 | Bacteria | 2211 |
| 25 | Ga0070671_100001557 | 3300005355 | Bacteria | 17259 |
| 26 | Ga0070671_100060909 | 3300005355 | Bacteria | 3143 |
| 27 | Ga0070674_100158049 | 3300005356 | Bacteria | 1717 |
| 28 | Ga0070688_100000179 | 3300005365 | Bacteria | 34153 |
| 29 | Ga0070659_100000031 | 3300005366 | Bacteria | 125048 |
| 30 | Ga0070659_100401010 | 3300005366 | Bacteria | 1158 |
| 31 | Ga0070667_100001609 | 3300005367 | Bacteria | 20208 |
| 32 | Ga0070667_100008571 | 3300005367 | Bacteria | 8474 |
| 33 | Ga0070703_10006034 | 3300005406 | Bacteria | 3392 |
| 34 | Ga0070709_10059938 | 3300005434 | Bacteria | 2418 |
| 35 | Ga0070709_10071033 | 3300005434 | Bacteria | 2246 |
| 36 | Ga0070713_100148354 | 3300005436 | Bacteria | 2084 |
| 37 | Ga0070710_10000005 | 3300005437 | Bacteria | 238049 |
| 38 | Ga0070711_100051270 | 3300005439 | Bacteria | 2833 |
| 39 | Ga0070700_100004175 | 3300005441 | Bacteria | 7532 |
| 40 | Ga0070694_100045239 | 3300005444 | Bacteria | 2949 |
| 41 | Ga0070663_100028898 | 3300005455 | Bacteria | 3781 |
| 42 | Ga0070663_100040368 | 3300005455 | Bacteria | 3267 |
| 43 | Ga0070678_100004586 | 3300005456 | Bacteria | 7852 |
| 44 | Ga0070678_100041009 | 3300005456 | Bacteria | 3279 |
| 45 | Ga0070678_100054027 | 3300005456 | Bacteria | 2924 |
| 46 | Ga0070678_100144853 | 3300005456 | Bacteria | 1906 |
| 47 | Ga0070681_10016198 | 3300005458 | Bacteria | 7433 |
| 48 | Ga0070685_10000037 | 3300005466 | Bacteria | 80557 |
| 49 | Ga0070699_100017336 | 3300005518 | Bacteria | 6184 |
| 50 | Ga0070679_100066246 | 3300005530 | Bacteria | 3600 |
| 51 | Ga0070684_100001247 | 3300005535 | Bacteria | 18228 |
| 52 | Ga0070684_100011235 | 3300005535 | Bacteria | 7129 |
| 53 | Ga0070684_100017997 | 3300005535 | Bacteria | 5809 |
| 54 | Ga0070672_100182218 | 3300005543 | Bacteria | 1750 |
| 55 | Ga0070686_100022910 | 3300005544 | Bacteria | 3726 |
| 56 | Ga0070686_100049080 | 3300005544 | Bacteria | 2676 |
| 57 | Ga0070686_100090569 | 3300005544 | Bacteria | 2045 |
| 58 | Ga0070686_100091187 | 3300005544 | Bacteria | 2039 |
| 59 | Ga0070686_100132591 | 3300005544 | Bacteria | 1725 |
| 60 | Ga0070695_100292490 | 3300005545 | Bacteria | 1201 |
| 61 | Ga0070695_100409380 | 3300005545 | Bacteria | 1030 |
| 62 | Ga0070693_100003883 | 3300005547 | Bacteria | 7009 |
| 63 | Ga0070665_100003628 | 3300005548 | Bacteria | 16353 |
| 64 | Ga0070665_100021798 | 3300005548 | Bacteria | 6441 |
| 65 | Ga0070665_100042438 | 3300005548 | Bacteria | 4572 |
| 66 | Ga0070665_100122893 | 3300005548 | Bacteria | 2598 |
| 67 | Ga0070664_100014477 | 3300005564 | Bacteria | 6431 |
| 68 | Ga0068857_100234473 | 3300005577 | Bacteria | 1679 |
| 69 | Ga0068857_100362642 | 3300005577 | Unclassified | 1343 |
| 70 | Ga0068857_100427888 | 3300005577 | Bacteria | 1235 |
| 71 | Ga0068854_100214244 | 3300005578 | Bacteria | 1521 |
| 72 | Ga0068856_100006784 | 3300005614 | Bacteria | 11205 |
| 73 | Ga0068856_100016807 | 3300005614 | Bacteria | 7090 |
| 74 | Ga0070702_100001653 | 3300005615 | Bacteria | 9245 |
| 75 | Ga0070702_100034671 | 3300005615 | Bacteria | 2783 |
| 76 | Ga0068852_100000005 | 3300005616 | Bacteria | 173127 |
| 77 | Ga0068864_100210561 | 3300005618 | Bacteria | 1790 |
| 78 | Ga0068851_10014554 | 3300005834 | Bacteria | 3737 |
| 79 | Ga0068870_10000134 | 3300005840 | Bacteria | 25602 |
| 80 | Ga0068863_100000032 | 3300005841 | Bacteria | 172402 |
| 81 | Ga0068863_100018968 | 3300005841 | Bacteria | 6583 |
| 82 | Ga0068858_100016814 | 3300005842 | Bacteria | 6870 |
| 83 | Ga0068858_100020724 | 3300005842 | Bacteria | 6142 |
| 84 | Ga0068858_100088394 | 3300005842 | Bacteria | 2883 |
| 85 | Ga0068858_100182736 | 3300005842 | Bacteria | 1980 |
| 86 | Ga0068862_100000585 | 3300005844 | Bacteria | 37913 |
| 87 | Ga0068862_100206852 | 3300005844 | Bacteria | 1772 |
| 88 | Ga0081455_10005567 | 3300005937 | Bacteria | 13790 |
| 89 | Ga0081455_10069450 | 3300005937 | Bacteria | 2929 |
| 90 | Ga0081540_1013926 | 3300005983 | Bacteria | 5192 |
| 91 | Ga0081539_10001249 | 3300005985 | Bacteria | 45085 |
| 92 | Ga0081539_10002410 | 3300005985 | Bacteria | 26480 |
| 93 | Ga0070717_10100048 | 3300006028 | Bacteria | 2461 |
| 94 | Ga0070715_10018044 | 3300006163 | Bacteria | 2682 |
| 95 | Ga0070715_10230125 | 3300006163 | Bacteria | 958 |
| 96 | Ga0070716_100016305 | 3300006173 | Bacteria | 3831 |
| 97 | Ga0070716_100026482 | 3300006173 | Bacteria | 3106 |
| 98 | Ga0070712_100002111 | 3300006175 | Bacteria | 12214 |
| 99 | Ga0070712_100105310 | 3300006175 | Unclassified | 2094 |
| 100 | Ga0070712_100424909 | 3300006175 | Unclassified | 1102 |
| 101 | Ga0097621_100032125 | 3300006237 | Bacteria | 4171 |
| 102 | Ga0097621_100178156 | 3300006237 | Bacteria | 1836 |
| 103 | Ga0097621_100180216 | 3300006237 | Bacteria | 1825 |
| 104 | Ga0097621_100212056 | 3300006237 | Bacteria | 1685 |
| 105 | Ga0068871_100029649 | 3300006358 | Bacteria | 4299 |
| 106 | Ga0068871_100030605 | 3300006358 | Bacteria | 4240 |
| 107 | Ga0068871_100101674 | 3300006358 | Bacteria | 2409 |
| 108 | Ga0068871_100374475 | 3300006358 | Bacteria | 1264 |
| 109 | Ga0075431_100358995 | 3300006847 | Bacteria | 1464 |
| 110 | Ga0075433_10044244 | 3300006852 | Unclassified | 3868 |
| 111 | Ga0075433_10057257 | 3300006852 | Bacteria | 3407 |
| 112 | Ga0075433_10086914 | 3300006852 | Bacteria | 2761 |
| 113 | Ga0075434_100008485 | 3300006871 | Bacteria | 9559 |
| 114 | Ga0075434_100080643 | 3300006871 | Bacteria | 3251 |
| 115 | Ga0105251_10036010 | 3300009011 | Bacteria | 2439 |
| 116 | Ga0105250_10064194 | 3300009092 | Bacteria | 1479 |
| 117 | Ga0111539_10069825 | 3300009094 | Bacteria | 4148 |
| 118 | Ga0111539_10126625 | 3300009094 | Bacteria | 2992 |
| 119 | Ga0111539_10180681 | 3300009094 | Bacteria | 2464 |
| 120 | Ga0111539_10359886 | 3300009094 | Bacteria | 1694 |
| 121 | Ga0105245_10000067 | 3300009098 | Bacteria | 107929 |
| 122 | Ga0105245_10000365 | 3300009098 | Bacteria | 42328 |
| 123 | Ga0105245_10044950 | 3300009098 | Bacteria | 3943 |
| 124 | Ga0105245_10227757 | 3300009098 | Bacteria | 1801 |
| 125 | Ga0105245_10334342 | 3300009098 | Bacteria | 1496 |
| 126 | Ga0105245_10456928 | 3300009098 | Bacteria | 1287 |
| 127 | Ga0105247_10109408 | 3300009101 | Bacteria | 1776 |
| 128 | Ga0114129_10164216 | 3300009147 | Bacteria | 3031 |
| 129 | Ga0114129_10650715 | 3300009147 | Bacteria | 1360 |
| 130 | Ga0105243_10052918 | 3300009148 | Bacteria | 3218 |
| 131 | Ga0105243_10059541 | 3300009148 | Bacteria | 3048 |
| 132 | Ga0105241_10034193 | 3300009174 | Bacteria | 3817 |
| 133 | Ga0105241_10050527 | 3300009174 | Bacteria | 3169 |
| 134 | Ga0105241_10063770 | 3300009174 | Bacteria | 2844 |
| 135 | Ga0105242_10001765 | 3300009176 | Bacteria | 17067 |
| 136 | Ga0105248_10000134 | 3300009177 | Bacteria | 86132 |
| 137 | Ga0105248_10036864 | 3300009177 | Bacteria | 5469 |
| 138 | Ga0105248_10056907 | 3300009177 | Bacteria | 4388 |
| 139 | Ga0105248_10145720 | 3300009177 | Bacteria | 2672 |
| 140 | Ga0105248_10274112 | 3300009177 | Unclassified | 1900 |
| 141 | Ga0105248_10415110 | 3300009177 | Bacteria | 1516 |
| 142 | Ga0105238_10185824 | 3300009551 | Bacteria | 2055 |
| 143 | Ga0105249_10000392 | 3300009553 | Bacteria | 42706 |
| 144 | Ga0105249_10422248 | 3300009553 | Bacteria | 1367 |
| 145 | Ga0105239_10094953 | 3300010375 | Bacteria | 3294 |
| 146 | Ga0105239_10209358 | 3300010375 | Unclassified | 2185 |
| 147 | Ga0105246_10027868 | 3300011119 | Bacteria | 3707 |
| 148 | Ga0105246_10040753 | 3300011119 | Bacteria | 3136 |
| 149 | Ga0105246_10065812 | 3300011119 | Bacteria | 2535 |
| 150 | Ga0105246_10194385 | 3300011119 | Bacteria | 1573 |
| 151 | Ga0157342_1002966 | 3300012507 | Bacteria | 1423 |
| 152 | Ga0157371_10008568 | 3300013102 | Bacteria | 8132 |
| 153 | Ga0157369_10000130 | 3300013105 | Bacteria | 108193 |
| 154 | Ga0157369_10069755 | 3300013105 | Unclassified | 3776 |
| 155 | Ga0157374_10410876 | 3300013296 | Bacteria | 1351 |
| 156 | Ga0157378_10000564 | 3300013297 | Bacteria | 35171 |
| 157 | Ga0157378_10014353 | 3300013297 | Bacteria | 6936 |
| 158 | Ga0163162_10378963 | 3300013306 | Bacteria | 1548 |
| 159 | Ga0163162_10484434 | 3300013306 | Unclassified | 1368 |
| 160 | Ga0163162_10543892 | 3300013306 | Bacteria | 1290 |
| 161 | Ga0163162_10645390 | 3300013306 | Unclassified | 1182 |
| 162 | Ga0157372_10313693 | 3300013307 | Unclassified | 1825 |
| 163 | Ga0157372_10472763 | 3300013307 | Bacteria | 1461 |
| 164 | Ga0157375_10632495 | 3300013308 | Bacteria | 1227 |
| 165 | Ga0163163_10024577 | 3300014325 | Bacteria | 5735 |
| 166 | Ga0163163_10186665 | 3300014325 | Bacteria | 2121 |
| 167 | Ga0163163_10410941 | 3300014325 | Bacteria | 1412 |
| 168 | Ga0182008_10075745 | 3300014497 | Bacteria | 1655 |
| 169 | Ga0157379_10003348 | 3300014968 | Bacteria | 13581 |
| 170 | Ga0157379_10003890 | 3300014968 | Bacteria | 12730 |
| 171 | Ga0157379_10014682 | 3300014968 | Bacteria | 6871 |
| 172 | Ga0157379_10273964 | 3300014968 | Bacteria | 1535 |
| 173 | Ga0157376_10005906 | 3300014969 | Bacteria | 8595 |
| 174 | Ga0157376_10010077 | 3300014969 | Bacteria | 6900 |
| 175 | Ga0157376_10014830 | 3300014969 | Bacteria | 5866 |
| 176 | Ga0157376_10026604 | 3300014969 | Bacteria | 4574 |
| 177 | Ga0157376_10060523 | 3300014969 | Bacteria | 3180 |
| 178 | Ga0207656_10041469 | 3300025321 | Bacteria | 1956 |
| 179 | Ga0207653_10004918 | 3300025885 | Bacteria | 4176 |
| 180 | Ga0207653_10024186 | 3300025885 | Unclassified | 1938 |
| 181 | Ga0207692_10000003 | 3300025898 | Bacteria | 431531 |
| 182 | Ga0207642_10107098 | 3300025899 | Bacteria | 1416 |
| 183 | Ga0207688_10013426 | 3300025901 | Bacteria | 4451 |
| 184 | Ga0207680_10004025 | 3300025903 | Bacteria | 6944 |
| 185 | Ga0207680_10004790 | 3300025903 | Bacteria | 6442 |
| 186 | Ga0207647_10052161 | 3300025904 | Bacteria | 2525 |
| 187 | Ga0207643_10000485 | 3300025908 | Bacteria | 25562 |
| 188 | Ga0207705_10023804 | 3300025909 | Bacteria | 4369 |
| 189 | Ga0207654_10056898 | 3300025911 | Bacteria | 2270 |
| 190 | Ga0207707_10011818 | 3300025912 | Bacteria | 7591 |
| 191 | Ga0207693_10012486 | 3300025915 | Bacteria | 6861 |
| 192 | Ga0207693_10129062 | 3300025915 | Unclassified | 1987 |
| 193 | Ga0207693_10356030 | 3300025915 | Unclassified | 1145 |
| 194 | Ga0207663_10006365 | 3300025916 | Bacteria | 6038 |
| 195 | Ga0207663_10020273 | 3300025916 | Bacteria | 3762 |
| 196 | Ga0207663_10115438 | 3300025916 | Bacteria | 1829 |
| 197 | Ga0207657_10125805 | 3300025919 | Bacteria | 2105 |
| 198 | Ga0207657_10129203 | 3300025919 | Bacteria | 2072 |
| 199 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 200 | Ga0207649_10021645 | 3300025920 | Bacteria | 3705 |
| 201 | Ga0207652_10008925 | 3300025921 | Bacteria | 8079 |
| 202 | Ga0207650_10002510 | 3300025925 | Bacteria | 12744 |
| 203 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 204 | Ga0207659_10121913 | 3300025926 | Bacteria | 1999 |
| 205 | Ga0207659_10159173 | 3300025926 | Bacteria | 1771 |
| 206 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 207 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 208 | Ga0207687_10104135 | 3300025927 | Bacteria | 2094 |
| 209 | Ga0207687_10201851 | 3300025927 | Unclassified | 1555 |
| 210 | Ga0207700_10029338 | 3300025928 | Bacteria | 3880 |
| 211 | Ga0207700_10262942 | 3300025928 | Unclassified | 1478 |
| 212 | Ga0207664_10012362 | 3300025929 | Bacteria | 6101 |
| 213 | Ga0207664_10035262 | 3300025929 | Bacteria | 3859 |
| 214 | Ga0207644_10021153 | 3300025931 | Bacteria | 4429 |
| 215 | Ga0207644_10028204 | 3300025931 | Bacteria | 3884 |
| 216 | Ga0207644_10422070 | 3300025931 | Bacteria | 1093 |
| 217 | Ga0207690_10000057 | 3300025932 | Bacteria | 100648 |
| 218 | Ga0207706_10155379 | 3300025933 | Bacteria | 2012 |
| 219 | Ga0207686_10289262 | 3300025934 | Bacteria | 1213 |
| 220 | Ga0207709_10004104 | 3300025935 | Bacteria | 8481 |
| 221 | Ga0207709_10018346 | 3300025935 | Bacteria | 3918 |
| 222 | Ga0207669_10201681 | 3300025937 | Bacteria | 1445 |
| 223 | Ga0207669_10205675 | 3300025937 | Bacteria | 1433 |
| 224 | Ga0207704_10102957 | 3300025938 | Unclassified | 1908 |
| 225 | Ga0207665_10000195 | 3300025939 | Bacteria | 40705 |
| 226 | Ga0207665_10001871 | 3300025939 | Bacteria | 14187 |
| 227 | Ga0207691_10055123 | 3300025940 | Bacteria | 3625 |
| 228 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 229 | Ga0207711_10029140 | 3300025941 | Bacteria | 4653 |
| 230 | Ga0207711_10268225 | 3300025941 | Bacteria | 1570 |
| 231 | Ga0207711_10288083 | 3300025941 | Unclassified | 1513 |
| 232 | Ga0207711_10382336 | 3300025941 | Bacteria | 1306 |
| 233 | Ga0207661_10000145 | 3300025944 | Bacteria | 45007 |
| 234 | Ga0207661_10000550 | 3300025944 | Bacteria | 23997 |
| 235 | Ga0207661_10002679 | 3300025944 | Bacteria | 12260 |
| 236 | Ga0207661_10062458 | 3300025944 | Bacteria | 3014 |
| 237 | Ga0207661_10063955 | 3300025944 | Bacteria | 2981 |
| 238 | Ga0207679_10017728 | 3300025945 | Bacteria | 4756 |
| 239 | Ga0207679_10071313 | 3300025945 | Bacteria | 2620 |
| 240 | Ga0207679_10203917 | 3300025945 | Bacteria | 1654 |
| 241 | Ga0207712_10002083 | 3300025961 | Bacteria | 13097 |
| 242 | Ga0207668_10006847 | 3300025972 | Bacteria | 6759 |
| 243 | Ga0207640_10404100 | 3300025981 | Bacteria | 1113 |
| 244 | Ga0207658_10005076 | 3300025986 | Bacteria | 9057 |
| 245 | Ga0207658_10032748 | 3300025986 | Bacteria | 3702 |
| 246 | Ga0207658_10068542 | 3300025986 | Bacteria | 2677 |
| 247 | Ga0207677_10000497 | 3300026023 | Bacteria | 25525 |
| 248 | Ga0207703_10005692 | 3300026035 | Bacteria | 9998 |
| 249 | Ga0207703_10024690 | 3300026035 | Bacteria | 4729 |
| 250 | Ga0207703_10105957 | 3300026035 | Bacteria | 2390 |
| 251 | Ga0207703_10217560 | 3300026035 | Bacteria | 1706 |
| 252 | Ga0207703_10300159 | 3300026035 | Bacteria | 1464 |
| 253 | Ga0207678_10060299 | 3300026067 | Bacteria | 3263 |
| 254 | Ga0207678_10082901 | 3300026067 | Bacteria | 2743 |
| 255 | Ga0207708_10001317 | 3300026075 | Bacteria | 18650 |
| 256 | Ga0207702_10002839 | 3300026078 | Bacteria | 16194 |
| 257 | Ga0207702_10038113 | 3300026078 | Bacteria | 4026 |
| 258 | Ga0207702_10040588 | 3300026078 | Bacteria | 3901 |
| 259 | Ga0207641_10000071 | 3300026088 | Bacteria | 151812 |
| 260 | Ga0207641_10013865 | 3300026088 | Bacteria | 6612 |
| 261 | Ga0207641_10028834 | 3300026088 | Bacteria | 4588 |
| 262 | Ga0207641_10113949 | 3300026088 | Unclassified | 2402 |
| 263 | Ga0207648_10547515 | 3300026089 | Bacteria | 1063 |
| 264 | Ga0207674_10007726 | 3300026116 | Bacteria | 12518 |
| 265 | Ga0207674_10037067 | 3300026116 | Bacteria | 5074 |
| 266 | Ga0207674_10175981 | 3300026116 | Bacteria | 2092 |
| 267 | Ga0207674_10185686 | 3300026116 | Bacteria | 2030 |
| 268 | Ga0207675_100194983 | 3300026118 | Bacteria | 1944 |
| 269 | Ga0207683_10000353 | 3300026121 | Bacteria | 42039 |
| 270 | Ga0207683_10000833 | 3300026121 | Bacteria | 28215 |
| 271 | Ga0207683_10032980 | 3300026121 | Bacteria | 4498 |
| 272 | Ga0207683_10041159 | 3300026121 | Bacteria | 4033 |
| 273 | Ga0207683_10060776 | 3300026121 | Bacteria | 3322 |
| 274 | Ga0207698_10000038 | 3300026142 | Bacteria | 101918 |
| 275 | Ga0207698_10152139 | 3300026142 | Bacteria | 2010 |
| 276 | Ga0207428_10019920 | 3300027907 | Bacteria | 5713 |
| 277 | Ga0268266_10000085 | 3300028379 | Bacteria | 201288 |
| 278 | Ga0268266_10000303 | 3300028379 | Bacteria | 78632 |
| 279 | Ga0268266_10030395 | 3300028379 | Bacteria | 4589 |
| 280 | Ga0268265_10004635 | 3300028380 | Bacteria | 9494 |
| 281 | Ga0268265_10007739 | 3300028380 | Bacteria | 7252 |
| 282 | Ga0268264_10406503 | 3300028381 | Bacteria | 1309 |
| 283 | Ga0373928_0011127 | 3300035084 | Bacteria | 1777 |
| 284 | Ga0373949_0017344 | 3300035090 | Unclassified | 1622 |
| 285 | Ga0373939_0006555 | 3300035114 | Bacteria | 2808 |
| 286 | Ga0373941_0003460 | 3300035115 | Bacteria | 3576 |
| 287 | Ga0373945_0002474 | 3300035116 | Bacteria | 5794 |
| 288 | Ga0373943_0014243 | 3300035170 | Bacteria | 3597 |
| 289 | Ga0373942_0024414 | 3300035207 | Bacteria | 1550 |
| 290 | Ga0373942_0039405 | 3300035207 | Bacteria | 1285 |
| 291 | Ga0373961_0025287 | 3300035241 | Bacteria | 1613 |
| 292 | Ga0373935_0027841 | 3300035692 | Bacteria | 3493 |
| 293 | Ga0373935_0269694 | 3300035692 | Bacteria | 1196 |
| 294 | Ga0373947_0013419 | 3300035725 | Bacteria | 4694 |
| 295 | Ga0373947_0015776 | 3300035725 | Bacteria | 4339 |
| 296 | Ga0373937_0183042 | 3300036401 | Bacteria | 1968 |
| 297 | Ga0373925_0008537 | 3300037068 | Bacteria | 7465 |
| 298 | Ga0395899_0032240 | 3300037312 | Bacteria | 3937 |
| 299 | Ga0395899_0041560 | 3300037312 | Bacteria | 3435 |
| 300 | Ga0395898_0138803 | 3300037466 | Bacteria | 2327 |
| 301 | Ga0395898_0140999 | 3300037466 | Bacteria | 2307 |
| 302 | Ga0395905_0043279 | 3300037471 | Bacteria | 4225 |
| 303 | Ga0395905_0113863 | 3300037471 | Bacteria | 2541 |
| 304 | Ga0395901_0027166 | 3300038443 | Bacteria | 5879 |
| 305 | Ga0395901_0090345 | 3300038443 | Bacteria | 3205 |
| 306 | Ga0395901_0152636 | 3300038443 | Bacteria | 2427 |
| 307 | Ga0436362_0743083 | 3300039453 | Bacteria | 1406 |
| 308 | Ga0451849_0746551 | 3300041505 | Bacteria | 2239 |
| 309 | Ga0466963_0092609 | 3300044694 | Bacteria | 2059 |
| 310 | Ga0466957_0001680 | 3300044842 | Bacteria | 11630 |
| 311 | Ga0495592_0086690 | 3300046454 | Bacteria | 2254 |
| 312 | Ga0495603_0015336 | 3300046455 | Bacteria | 4637 |
| 313 | Ga0495603_0095412 | 3300046455 | Unclassified | 1738 |
| 314 | Ga0495591_023681 | 3300046458 | Bacteria | 1962 |
| 315 | Ga0495629_0000055 | 3300046459 | Bacteria | 105268 |
| 316 | Ga0495629_0000964 | 3300046459 | Bacteria | 23212 |
| 317 | Ga0495629_0021894 | 3300046459 | Bacteria | 4560 |
| 318 | Ga0495629_0038584 | 3300046459 | Bacteria | 3363 |
| 319 | Ga0495629_0100518 | 3300046459 | Bacteria | 2018 |
| 320 | Ga0495638_0078665 | 3300046460 | Bacteria | 2006 |
| 321 | Ga0495641_0000362 | 3300046461 | Bacteria | 37539 |
| 322 | Ga0495641_0019076 | 3300046461 | Bacteria | 3521 |
| 323 | Ga0495641_0153658 | 3300046461 | Unclassified | 1029 |
| 324 | Ga0495651_0052215 | 3300046462 | Bacteria | 3149 |
| 325 | Ga0495651_0106004 | 3300046462 | Bacteria | 2084 |
| 326 | Ga0495653_0113481 | 3300046463 | Bacteria | 1943 |
| 327 | Ga0495653_0233345 | 3300046463 | Bacteria | 1230 |
| 328 | Ga0495650_0000035 | 3300046471 | Bacteria | 403799 |
| 329 | Ga0495582_0000114 | 3300046473 | Bacteria | 42283 |
| 330 | Ga0495582_0022489 | 3300046473 | Bacteria | 3451 |
| 331 | Ga0495582_0022757 | 3300046473 | Bacteria | 3428 |
| 332 | Ga0495639_0004982 | 3300046475 | Bacteria | 5700 |
| 333 | Ga0495639_0060472 | 3300046475 | Bacteria | 1736 |
| 334 | Ga0495662_0043194 | 3300046476 | Bacteria | 2176 |
| 335 | Ga0495662_0045337 | 3300046476 | Bacteria | 2122 |
| 336 | Ga0495594_0024843 | 3300046499 | Unclassified | 3221 |
| 337 | Ga0495594_0278490 | 3300046499 | Bacteria | 953 |
| 338 | Ga0495607_0169160 | 3300046501 | Bacteria | 1105 |
| 339 | Ga0495606_0000057 | 3300046507 | Bacteria | 197956 |
| 340 | Ga0495608_0017951 | 3300046511 | Bacteria | 4890 |
| 341 | Ga0495608_0070500 | 3300046511 | Bacteria | 2281 |
| 342 | Ga0495618_0139586 | 3300046514 | Bacteria | 1550 |
| 343 | Ga0495618_0239363 | 3300046514 | Bacteria | 1141 |
| 344 | Ga0495628_0017526 | 3300046516 | Bacteria | 5959 |
| 345 | Ga0495630_0000025 | 3300046517 | Bacteria | 152364 |
| 346 | Ga0495630_0005182 | 3300046517 | Bacteria | 9187 |
| 347 | Ga0495630_0011491 | 3300046517 | Bacteria | 6411 |
| 348 | Ga0495630_0027497 | 3300046517 | Bacteria | 4221 |
| 349 | Ga0495630_0208834 | 3300046517 | Bacteria | 1490 |
| 350 | Ga0495630_0214392 | 3300046517 | Bacteria | 1469 |
| 351 | Ga0495666_0066114 | 3300046526 | Bacteria | 1724 |
| 352 | Ga0495666_0112019 | 3300046526 | Bacteria | 1281 |
| 353 | Ga0495652_0026709 | 3300046529 | Bacteria | 5096 |
| 354 | Ga0495652_0027111 | 3300046529 | Bacteria | 5051 |
| 355 | Ga0495652_0036969 | 3300046529 | Bacteria | 4239 |
| 356 | Ga0495665_0003022 | 3300046531 | Bacteria | 9090 |
| 357 | Ga0495640_0004060 | 3300046533 | Bacteria | 11712 |
| 358 | Ga0495640_0014647 | 3300046533 | Bacteria | 5924 |
| 359 | Ga0495640_0021878 | 3300046533 | Bacteria | 4684 |
| 360 | Ga0495640_0038461 | 3300046533 | Bacteria | 3365 |
| 361 | Ga0495640_0045666 | 3300046533 | Bacteria | 3039 |
| 362 | Ga0495586_0153320 | 3300046535 | Bacteria | 1297 |
| 363 | Ga0495645_0005733 | 3300046543 | Bacteria | 8554 |
| 364 | Ga0495645_0093658 | 3300046543 | Bacteria | 2143 |
| 365 | Ga0495622_0087725 | 3300046557 | Bacteria | 1430 |
| 366 | Ga0495667_0001761 | 3300046559 | Bacteria | 14378 |
| 367 | Ga0495667_0004957 | 3300046559 | Bacteria | 9002 |
| 368 | Ga0495667_0106918 | 3300046559 | Bacteria | 1808 |
| 369 | Ga0495667_0157131 | 3300046559 | Bacteria | 1463 |
| 370 | Ga0495656_0000342 | 3300046615 | Bacteria | 15822 |
| 371 | Ga0495656_0058622 | 3300046615 | Unclassified | 1672 |
| 372 | Ga0495634_0011424 | 3300046642 | Bacteria | 6468 |
| 373 | Ga0495634_0032075 | 3300046642 | Bacteria | 3615 |
| 374 | Ga0495634_0073133 | 3300046642 | Bacteria | 2254 |
| 375 | Ga0495634_0115855 | 3300046642 | Bacteria | 1719 |
| 376 | Ga0495625_0000117 | 3300046660 | Bacteria | 121901 |
| 377 | Ga0495635_0019624 | 3300046663 | Bacteria | 4709 |
| 378 | Ga0495635_0048275 | 3300046663 | Bacteria | 2935 |
| 379 | Ga0495635_0127141 | 3300046663 | Bacteria | 1738 |
| 380 | Ga0495588_0141925 | 3300046674 | Bacteria | 1269 |
| 381 | Ga0495599_0004807 | 3300046678 | Bacteria | 8031 |
| 382 | Ga0495647_0003410 | 3300046681 | Bacteria | 5089 |
| 383 | Ga0495658_0000467 | 3300046683 | Bacteria | 22368 |
| 384 | Ga0495658_0057774 | 3300046683 | Unclassified | 2217 |
| 385 | Ga0495669_0000131 | 3300046684 | Bacteria | 47864 |
| 386 | Ga0495613_0002520 | 3300046689 | Bacteria | 13804 |
| 387 | Ga0495613_0004956 | 3300046689 | Bacteria | 9998 |
| 388 | Ga0495613_0160223 | 3300046689 | Bacteria | 1601 |
| 389 | Ga0495624_0000298 | 3300046690 | Bacteria | 39145 |
| 390 | Ga0495624_0016745 | 3300046690 | Bacteria | 4933 |
| 391 | Ga0495624_0114406 | 3300046690 | Bacteria | 1658 |
| 392 | Ga0495600_0025488 | 3300046809 | Bacteria | 3811 |
| 393 | Ga0495600_0357236 | 3300046809 | Unclassified | 914 |
| 394 | Ga0495581_0000327 | 3300047315 | Bacteria | 23532 |
| 395 | Ga0495581_0111877 | 3300047315 | Bacteria | 1588 |
| 396 | Ga0495581_0273927 | 3300047315 | Bacteria | 987 |
| 397 | Ga0495674_0003915 | 3300047319 | Bacteria | 14459 |
| 398 | Ga0495674_0037948 | 3300047319 | Bacteria | 4328 |
| 399 | Ga0495674_0050317 | 3300047319 | Bacteria | 3677 |
| 400 | Ga0495674_0074370 | 3300047319 | Bacteria | 2926 |
| 401 | Ga0495672_0026848 | 3300047320 | Bacteria | 3668 |
| 402 | Ga0495676_0003147 | 3300047321 | Bacteria | 14929 |
| 403 | Ga0495676_0004361 | 3300047321 | Bacteria | 12923 |
| 404 | Ga0495676_0133436 | 3300047321 | Bacteria | 1789 |
| 405 | Ga0495676_0289303 | 3300047321 | Bacteria | 1107 |
| 406 | Ga0495680_0004812 | 3300047322 | Bacteria | 12810 |
| 407 | Ga0495680_0005132 | 3300047322 | Bacteria | 12364 |
| 408 | Ga0495680_0080740 | 3300047322 | Bacteria | 2457 |
| 409 | Ga0495680_0211455 | 3300047322 | Bacteria | 1388 |
| 410 | Ga0495684_0001004 | 3300047471 | Bacteria | 22963 |
| 411 | Ga0495684_0005850 | 3300047471 | Bacteria | 9553 |
| 412 | Ga0495684_0028038 | 3300047471 | Bacteria | 4325 |
| 413 | Ga0495684_0031245 | 3300047471 | Unclassified | 4088 |
| 414 | Ga0495684_0087567 | 3300047471 | Bacteria | 2360 |
| 415 | Ga0495593_0001350 | 3300047673 | Bacteria | 14336 |
| 416 | Ga0495593_0086389 | 3300047673 | Unclassified | 1618 |
| 417 | Ga0495602_0379090 | 3300048088 | Unclassified | 1014 |
| 418 | Ga0495614_0072341 | 3300048089 | Bacteria | 1487 |
| 419 | Ga0496100_0003570 | 3300048903 | Bacteria | 8128 |
| 420 | Ga0496100_0006619 | 3300048903 | Bacteria | 6333 |
| 421 | Ga0496100_0040122 | 3300048903 | Bacteria | 2976 |
| 422 | Ga0496100_0079068 | 3300048903 | Unclassified | 2215 |
| 423 | Ga0496100_0147854 | 3300048903 | Bacteria | 1672 |
| 424 | Ga0496100_0162898 | 3300048903 | Bacteria | 1600 |
| 425 | Ga0496101_0001547 | 3300048904 | Bacteria | 13788 |
| 426 | Ga0496101_0026364 | 3300048904 | Bacteria | 4040 |
| 427 | Ga0496101_0056356 | 3300048904 | Bacteria | 2841 |
| 428 | Ga0496101_0071012 | 3300048904 | Bacteria | 2551 |
| 429 | Ga0496101_0125121 | 3300048904 | Bacteria | 1947 |
| 430 | Ga0496101_0256232 | 3300048904 | Unclassified | 1364 |
| 431 | Ga0496101_0454001 | 3300048904 | Bacteria | 1011 |
| 432 | Ga0496102_0006839 | 3300048905 | Bacteria | 9736 |
| 433 | Ga0496102_0036801 | 3300048905 | Bacteria | 4411 |
| 434 | Ga0496102_0037504 | 3300048905 | Bacteria | 4373 |
| 435 | Ga0496102_0057067 | 3300048905 | Bacteria | 3563 |
| 436 | Ga0496102_0077666 | 3300048905 | Bacteria | 3056 |
| 437 | Ga0496102_0098762 | 3300048905 | Bacteria | 2709 |
| 438 | Ga0496103_0073169 | 3300048906 | Bacteria | 2147 |
| 439 | Ga0496103_0190594 | 3300048906 | Bacteria | 1318 |
| 440 | Ga0496104_0001009 | 3300048907 | Bacteria | 24141 |
| 441 | Ga0496104_0005385 | 3300048907 | Bacteria | 11204 |
| 442 | Ga0496104_0015020 | 3300048907 | Bacteria | 7005 |
| 443 | Ga0496104_0031644 | 3300048907 | Bacteria | 4922 |
| 444 | Ga0496104_0198848 | 3300048907 | Bacteria | 1916 |
| 445 | Ga0496104_0265031 | 3300048907 | Unclassified | 1631 |
| 446 | Ga0496104_0415605 | 3300048907 | Bacteria | 1257 |
| 447 | Ga0496105_0000621 | 3300048908 | Bacteria | 23731 |
| 448 | Ga0496105_0002429 | 3300048908 | Bacteria | 13502 |
| 449 | Ga0496105_0007700 | 3300048908 | Bacteria | 8354 |
| 450 | Ga0496105_0038610 | 3300048908 | Bacteria | 3934 |
| 451 | Ga0496105_0066592 | 3300048908 | Bacteria | 2974 |
| 452 | Ga0496105_0077330 | 3300048908 | Bacteria | 2748 |
| 453 | Ga0496105_0188109 | 3300048908 | Bacteria | 1689 |
| 454 | Ga0496106_0054659 | 3300048909 | Bacteria | 3016 |
| 455 | Ga0496106_0073673 | 3300048909 | Bacteria | 2612 |
| 456 | Ga0496106_0118502 | 3300048909 | Unclassified | 2067 |
| 457 | Ga0496106_0134753 | 3300048909 | Bacteria | 1939 |
| 458 | Ga0496107_0054943 | 3300048910 | Bacteria | 2875 |
| 459 | Ga0496107_0069330 | 3300048910 | Unclassified | 2559 |
| 460 | Ga0496107_0175356 | 3300048910 | Bacteria | 1591 |
| 461 | Ga0496107_0232497 | 3300048910 | Unclassified | 1372 |
| 462 | Ga0496107_0328725 | 3300048910 | Bacteria | 1137 |
| 463 | Ga0496108_0004554 | 3300048911 | Bacteria | 11169 |
| 464 | Ga0496108_0011228 | 3300048911 | Bacteria | 7276 |
| 465 | Ga0496108_0017457 | 3300048911 | Bacteria | 5872 |
| 466 | Ga0496108_0020124 | 3300048911 | Bacteria | 5484 |
| 467 | Ga0496108_0095827 | 3300048911 | Bacteria | 2527 |
| 468 | Ga0496108_0104898 | 3300048911 | Unclassified | 2413 |
| 469 | Ga0496108_0105486 | 3300048911 | Unclassified | 2406 |
| 470 | Ga0496108_0133873 | 3300048911 | Bacteria | 2131 |
| 471 | Ga0496109_0000039 | 3300048912 | Bacteria | 145769 |
| 472 | Ga0496109_0001979 | 3300048912 | Bacteria | 16983 |
| 473 | Ga0496109_0002568 | 3300048912 | Bacteria | 15206 |
| 474 | Ga0496109_0024637 | 3300048912 | Bacteria | 5351 |
| 475 | Ga0496109_0068075 | 3300048912 | Bacteria | 3263 |
| 476 | Ga0496109_0156360 | 3300048912 | Bacteria | 2135 |
| 477 | Ga0496109_0164948 | 3300048912 | Bacteria | 2077 |
| 478 | Ga0496109_0331681 | 3300048912 | Unclassified | 1436 |
| 479 | Ga0496110_0000075 | 3300048913 | Bacteria | 51198 |
| 480 | Ga0496110_0000112 | 3300048913 | Bacteria | 44496 |
| 481 | Ga0496110_0001216 | 3300048913 | Bacteria | 18334 |
| 482 | Ga0496110_0011878 | 3300048913 | Bacteria | 7153 |
| 483 | Ga0496110_0032838 | 3300048913 | Bacteria | 4487 |
| 484 | Ga0496110_0036705 | 3300048913 | Bacteria | 4257 |
| 485 | Ga0496110_0039830 | 3300048913 | Bacteria | 4093 |
| 486 | Ga0496110_0138024 | 3300048913 | Bacteria | 2204 |
| 487 | Ga0496110_0168925 | 3300048913 | Bacteria | 1984 |
| 488 | Ga0496111_0001251 | 3300048914 | Bacteria | 14216 |
| 489 | Ga0496111_0002463 | 3300048914 | Bacteria | 11166 |
| 490 | Ga0496111_0004048 | 3300048914 | Bacteria | 9210 |
| 491 | Ga0496111_0023673 | 3300048914 | Bacteria | 4314 |
| 492 | Ga0496111_0127810 | 3300048914 | Bacteria | 1879 |
| 493 | Ga0496111_0347184 | 3300048914 | Bacteria | 1098 |
| 494 | Ga0496111_0447629 | 3300048914 | Unclassified | 953 |
| 495 | Ga0496112_0075308 | 3300048915 | Bacteria | 3338 |
| 496 | Ga0496112_0158217 | 3300048915 | Bacteria | 2232 |
| 497 | Ga0496113_0008888 | 3300048916 | Bacteria | 6570 |
| 498 | Ga0496113_0043170 | 3300048916 | Bacteria | 3335 |
| 499 | Ga0496113_0093538 | 3300048916 | Bacteria | 2321 |
| 500 | Ga0496113_0100007 | 3300048916 | Unclassified | 2247 |
| 501 | Ga0496113_0109451 | 3300048916 | Bacteria | 2149 |
| 502 | Ga0496113_0125179 | 3300048916 | Bacteria | 2012 |
| 503 | Ga0496114_0000247 | 3300048917 | Bacteria | 39314 |
| 504 | Ga0496114_0007783 | 3300048917 | Bacteria | 8479 |
| 505 | Ga0496114_0014169 | 3300048917 | Bacteria | 6395 |
| 506 | Ga0496114_0041276 | 3300048917 | Bacteria | 3823 |
| 507 | Ga0496114_0052065 | 3300048917 | Unclassified | 3410 |
| 508 | Ga0496114_0114146 | 3300048917 | Bacteria | 2316 |
| 509 | Ga0496114_0337935 | 3300048917 | Bacteria | 1331 |
| 510 | Ga0496115_0042038 | 3300048918 | Bacteria | 3640 |
| 511 | Ga0496115_0042170 | 3300048918 | Bacteria | 3635 |
| 512 | Ga0496115_0049129 | 3300048918 | Bacteria | 3375 |
| 513 | Ga0496115_0096472 | 3300048918 | Bacteria | 2421 |
| 514 | Ga0496115_0100232 | 3300048918 | Bacteria | 2374 |
| 515 | Ga0496115_0121748 | 3300048918 | Bacteria | 2147 |
| 516 | Ga0496115_0460451 | 3300048918 | Bacteria | 1026 |
| 517 | Ga0496117_0001208 | 3300048920 | Bacteria | 38735 |
| 518 | Ga0496118_0000414 | 3300048921 | Bacteria | 71146 |
| 519 | Ga0496119_0003338 | 3300048922 | Bacteria | 16720 |
| 520 | Ga0496119_0061678 | 3300048922 | Bacteria | 2238 |
| 521 | Ga0496120_0002177 | 3300048923 | Bacteria | 20787 |
| 522 | Ga0496121_0013091 | 3300048924 | Bacteria | 8954 |
| 523 | Ga0496121_0070868 | 3300048924 | Bacteria | 2805 |
| 524 | Ga0496124_0083634 | 3300048927 | Bacteria | 2618 |
| 525 | Ga0496125_0019567 | 3300048928 | Bacteria | 6380 |
| 526 | Ga0496126_0005418 | 3300048929 | Bacteria | 14555 |
| 527 | Ga0501042_0029657 | 3300049578 | Bacteria | 3859 |
| 528 | Ga0501047_0325788 | 3300049581 | Bacteria | 1375 |
| 529 | Ga0501067_0014156 | 3300049583 | Bacteria | 4417 |
| 530 | Ga0501067_0083059 | 3300049583 | Bacteria | 1777 |
| 531 | Ga0501069_0001436 | 3300049585 | Bacteria | 11683 |
| 532 | Ga0501070_0006631 | 3300049586 | Bacteria | 9853 |
| 533 | Ga0501071_0111507 | 3300049587 | Bacteria | 2022 |
| 534 | Ga0501076_0037238 | 3300049592 | Bacteria | 3814 |
| 535 | nmdc:mga05p37_135111_c1 | 3300050507 | Bacteria | 3025 |
| 536 | nmdc:mga05p37_283783_c1 | 3300050507 | Bacteria | 1973 |
| 537 | nmdc:mga06r32_251868_c1 | 3300050510 | Unclassified | 1753 |
| 538 | nmdc:mga08y16_119625_c1 | 3300050511 | Bacteria | 2741 |
| 539 | nmdc:mga08y16_308349_c1 | 3300050511 | Bacteria | 1630 |
| 540 | nmdc:mga08y16_42346_c1 | 3300050511 | Bacteria | 4769 |
| 541 | nmdc:mga0n895_252937_c1 | 3300050512 | Bacteria | 1788 |
| 542 | nmdc:mga0rr50_201261_c1 | 3300050513 | Bacteria | 1636 |
| 543 | nmdc:mga0rr50_228882_c1 | 3300050513 | Bacteria | 1538 |
| 544 | nmdc:mga08x19_145522_c1 | 3300050514 | Bacteria | 1602 |
| 545 | nmdc:mga0a205_17551_c1 | 3300050515 | Bacteria | 6714 |
| 546 | nmdc:mga0a205_23081_c1 | 3300050515 | Bacteria | 5900 |
| 547 | nmdc:mga0a205_276811_c1 | 3300050515 | Bacteria | 1554 |
| 548 | nmdc:mga0a205_28771_c1 | 3300050515 | Bacteria | 5314 |
| 549 | nmdc:mga0a205_369487_c1 | 3300050515 | Bacteria | 1300 |
| 550 | Ga0495601_0001813 | 3300053077 | Bacteria | 11867 |
| 551 | Ga0495601_0025163 | 3300053077 | Bacteria | 3669 |
| 552 | Ga0495595_0097445 | 3300053084 | Bacteria | 1417 |
| 553 | Ga0495619_0003326 | 3300053085 | Bacteria | 10391 |
| 554 | Ga0495619_0091499 | 3300053085 | Unclassified | 2059 |
| 555 | Ga0495619_0098743 | 3300053085 | Bacteria | 1985 |
| 556 | Ga0495619_0129041 | 3300053085 | Bacteria | 1737 |
| 557 | Ga0501082_0231217 | 3300060353 | Bacteria | 1609 |
| 558 | Ga0530510_0057246 | 3300061734 | Unclassified | 2816 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0168925 | Ga0496110_0168925_488_1249 | 246 |
| 2 | 3300025938 | Ga0207704_10102957 | Ga0207704_101029571 | 256 |
| 3 | 3300035114 | Ga0373939_0006555 | Ga0373939_0006555_1955_2761 | 261 |
| 4 | 3300048907 | Ga0496104_0265031 | Ga0496104_0265031_48_845 | 261 |
| 5 | 3300046615 | Ga0495656_0058622 | Ga0495656_0058622_191_982 | 263 |
| 6 | 3300046674 | Ga0495588_0141925 | Ga0495588_0141925_450_1241 | 263 |
| 7 | 3300046475 | Ga0495639_0060472 | Ga0495639_0060472_619_1509 | 265 |
| 8 | 3300048918 | Ga0496115_0460451 | Ga0496115_0460451_25_822 | 265 |
| 9 | 3300035207 | Ga0373942_0024414 | Ga0373942_0024414_14_835 | 266 |
| 10 | 3300048916 | Ga0496113_0093538 | Ga0496113_0093538_173_1069 | 266 |
| 11 | 3300049583 | Ga0501067_0014156 | Ga0501067_0014156_1589_2395 | 267 |
| 12 | 3300049585 | Ga0501069_0001436 | Ga0501069_0001436_7756_8562 | 267 |
| 13 | 3300061734 | Ga0530510_0057246 | Ga0530510_0057246_1292_2098 | 267 |
| 14 | 3300005614 | Ga0068856_100006784 | Ga0068856_1000067845 | 269 |
| 15 | 3300005616 | Ga0068852_100000005 | Ga0068852_10000000594 | 269 |
| 16 | 3300009177 | Ga0105248_10000134 | Ga0105248_1000013441 | 269 |
| 17 | 3300025941 | Ga0207711_10000024 | Ga0207711_10000024245 | 269 |
| 18 | 3300026078 | Ga0207702_10002839 | Ga0207702_100028395 | 269 |
| 19 | 3300026142 | Ga0207698_10000038 | Ga0207698_1000003815 | 269 |
| 20 | 3300009098 | Ga0105245_10456928 | Ga0105245_104569282 | 270 |
| 21 | 3300005338 | Ga0068868_100001037 | Ga0068868_10000103711 | 271 |
| 22 | 3300026023 | Ga0207677_10000497 | Ga0207677_1000049720 | 271 |
| 23 | 3300046514 | Ga0495618_0239363 | Ga0495618_0239363_29_865 | 271 |
| 24 | 3300005577 | Ga0068857_100427888 | Ga0068857_1004278882 | 272 |
| 25 | 3300026116 | Ga0207674_10175981 | Ga0207674_101759812 | 272 |
| 26 | 3300005335 | Ga0070666_10010965 | Ga0070666_100109656 | 273 |
| 27 | 3300005367 | Ga0070667_100001609 | Ga0070667_10000160910 | 273 |
| 28 | 3300005544 | Ga0070686_100132591 | Ga0070686_1001325912 | 273 |
| 29 | 3300005548 | Ga0070665_100003628 | Ga0070665_1000036285 | 273 |
| 30 | 3300005548 | Ga0070665_100122893 | Ga0070665_1001228933 | 273 |
| 31 | 3300005842 | Ga0068858_100088394 | Ga0068858_1000883942 | 273 |
| 32 | 3300005844 | Ga0068862_100000585 | Ga0068862_1000005855 | 273 |
| 33 | 3300009553 | Ga0105249_10000392 | Ga0105249_1000039235 | 273 |
| 34 | 3300013306 | Ga0163162_10645390 | Ga0163162_106453901 | 273 |
| 35 | 3300014968 | Ga0157379_10014682 | Ga0157379_100146826 | 273 |
| 36 | 3300025903 | Ga0207680_10004025 | Ga0207680_100040255 | 273 |
| 37 | 3300025961 | Ga0207712_10002083 | Ga0207712_1000208310 | 273 |
| 38 | 3300025972 | Ga0207668_10006847 | Ga0207668_100068473 | 273 |
| 39 | 3300025986 | Ga0207658_10032748 | Ga0207658_100327482 | 273 |
| 40 | 3300026035 | Ga0207703_10105957 | Ga0207703_101059572 | 273 |
| 41 | 3300028379 | Ga0268266_10000303 | Ga0268266_1000030337 | 273 |
| 42 | 3300028380 | Ga0268265_10004635 | Ga0268265_100046356 | 273 |
| 43 | 3300005365 | Ga0070688_100000179 | Ga0070688_10000017924 | 274 |
| 44 | 3300005466 | Ga0070685_10000037 | Ga0070685_1000003772 | 274 |
| 45 | 3300005548 | Ga0070665_100042438 | Ga0070665_1000424383 | 274 |
| 46 | 3300009098 | Ga0105245_10000365 | Ga0105245_1000036521 | 274 |
| 47 | 3300013105 | Ga0157369_10000130 | Ga0157369_1000013055 | 274 |
| 48 | 3300025927 | Ga0207687_10000011 | Ga0207687_1000001134 | 274 |
| 49 | 3300025986 | Ga0207658_10068542 | Ga0207658_100685422 | 274 |
| 50 | 3300028379 | Ga0268266_10030395 | Ga0268266_100303954 | 274 |
| 51 | 3300044694 | Ga0466963_0092609 | Ga0466963_0092609_38_934 | 274 |
| 52 | 3300044842 | Ga0466957_0001680 | Ga0466957_0001680_7225_8121 | 275 |
| 53 | 3300046459 | Ga0495629_0000055 | Ga0495629_0000055_30907_31803 | 275 |
| 54 | 3300046461 | Ga0495641_0019076 | Ga0495641_0019076_1149_2045 | 275 |
| 55 | 3300046517 | Ga0495630_0000025 | Ga0495630_0000025_112371_113267 | 275 |
| 56 | 3300046681 | Ga0495647_0003410 | Ga0495647_0003410_1546_2442 | 275 |
| 57 | 3300048911 | Ga0496108_0011228 | Ga0496108_0011228_3951_4847 | 275 |
| 58 | 3300048912 | Ga0496109_0000039 | Ga0496109_0000039_95888_96784 | 275 |
| 59 | 3300048927 | Ga0496124_0083634 | Ga0496124_0083634_645_1526 | 275 |
| 60 | 3300005329 | Ga0070683_100044035 | Ga0070683_1000440353 | 276 |
| 61 | 3300005354 | Ga0070675_100000131 | Ga0070675_10000013118 | 276 |
| 62 | 3300005535 | Ga0070684_100017997 | Ga0070684_1000179974 | 276 |
| 63 | 3300005834 | Ga0068851_10014554 | Ga0068851_100145545 | 276 |
| 64 | 3300009177 | Ga0105248_10415110 | Ga0105248_104151102 | 276 |
| 65 | 3300013102 | Ga0157371_10008568 | Ga0157371_100085688 | 276 |
| 66 | 3300013297 | Ga0157378_10014353 | Ga0157378_100143537 | 276 |
| 67 | 3300025321 | Ga0207656_10041469 | Ga0207656_100414692 | 276 |
| 68 | 3300025926 | Ga0207659_10000014 | Ga0207659_1000001431 | 276 |
| 69 | 3300025941 | Ga0207711_10268225 | Ga0207711_102682252 | 276 |
| 70 | 3300025944 | Ga0207661_10000145 | Ga0207661_1000014544 | 276 |
| 71 | 3300025944 | Ga0207661_10000550 | Ga0207661_100005507 | 276 |
| 72 | 3300046499 | Ga0495594_0278490 | Ga0495594_0278490_14_844 | 276 |
| 73 | 3300046507 | Ga0495606_0000057 | Ga0495606_0000057_80304_81200 | 276 |
| 74 | 3300047320 | Ga0495672_0026848 | Ga0495672_0026848_515_1411 | 276 |
| 75 | 3300047321 | Ga0495676_0289303 | Ga0495676_0289303_28_858 | 276 |
| 76 | 3300048914 | Ga0496111_0023673 | Ga0496111_0023673_1337_2233 | 276 |
| 77 | 3300005344 | Ga0070661_100000005 | Ga0070661_10000000552 | 277 |
| 78 | 3300006175 | Ga0070712_100002111 | Ga0070712_1000021114 | 277 |
| 79 | 3300014969 | Ga0157376_10026604 | Ga0157376_100266045 | 277 |
| 80 | 3300025915 | Ga0207693_10012486 | Ga0207693_100124865 | 277 |
| 81 | 3300025920 | Ga0207649_10000005 | Ga0207649_10000005196 | 277 |
| 82 | 3300048905 | Ga0496102_0037504 | Ga0496102_0037504_568_1413 | 277 |
| 83 | 3300049578 | Ga0501042_0029657 | Ga0501042_0029657_951_1847 | 277 |
| 84 | 3300025909 | Ga0207705_10023804 | Ga0207705_100238043 | 278 |
| 85 | 3300046690 | Ga0495624_0000298 | Ga0495624_0000298_9341_10237 | 278 |
| 86 | 3300025935 | Ga0207709_10004104 | Ga0207709_100041049 | 279 |
| 87 | 3300025945 | Ga0207679_10017728 | Ga0207679_100177285 | 279 |
| 88 | 3300026142 | Ga0207698_10152139 | Ga0207698_101521392 | 279 |
| 89 | 3300049586 | Ga0501070_0006631 | Ga0501070_0006631_3836_4726 | 280 |
| 90 | 3300046615 | Ga0495656_0000342 | Ga0495656_0000342_8127_9023 | 285 |
| 91 | 3300005937 | Ga0081455_10069450 | Ga0081455_100694502 | 287 |
| 92 | 3300025981 | Ga0207640_10404100 | Ga0207640_104041001 | 288 |
| 93 | 3300046462 | Ga0495651_0052215 | Ga0495651_0052215_687_1577 | 289 |
| 94 | 3300046517 | Ga0495630_0027497 | Ga0495630_0027497_2334_3224 | 289 |
| 95 | 3300046533 | Ga0495640_0021878 | Ga0495640_0021878_2140_3030 | 289 |
| 96 | 3300046559 | Ga0495667_0004957 | Ga0495667_0004957_3103_3993 | 289 |
| 97 | 3300046642 | Ga0495634_0032075 | Ga0495634_0032075_544_1434 | 289 |
| 98 | 3300047315 | Ga0495581_0111877 | Ga0495581_0111877_468_1358 | 289 |
| 99 | 3300047319 | Ga0495674_0003915 | Ga0495674_0003915_9158_10048 | 289 |
| 100 | 3300047321 | Ga0495676_0133436 | Ga0495676_0133436_435_1325 | 289 |
| 101 | 3300047322 | Ga0495680_0005132 | Ga0495680_0005132_6179_7069 | 289 |
| 102 | 3300053077 | Ga0495601_0025163 | Ga0495601_0025163_2450_3340 | 289 |
| 103 | 3300005434 | Ga0070709_10059938 | Ga0070709_100599382 | 290 |
| 104 | 3300005456 | Ga0070678_100004586 | Ga0070678_1000045869 | 291 |
| 105 | 3300005544 | Ga0070686_100022910 | Ga0070686_1000229102 | 291 |
| 106 | 3300005545 | Ga0070695_100409380 | Ga0070695_1004093801 | 291 |
| 107 | 3300005615 | Ga0070702_100001653 | Ga0070702_1000016537 | 291 |
| 108 | 3300005842 | Ga0068858_100016814 | Ga0068858_1000168146 | 291 |
| 109 | 3300005985 | Ga0081539_10002410 | Ga0081539_100024105 | 291 |
| 110 | 3300006163 | Ga0070715_10230125 | Ga0070715_102301251 | 291 |
| 111 | 3300006237 | Ga0097621_100032125 | Ga0097621_1000321252 | 291 |
| 112 | 3300006358 | Ga0068871_100030605 | Ga0068871_1000306054 | 291 |
| 113 | 3300009094 | Ga0111539_10180681 | Ga0111539_101806813 | 291 |
| 114 | 3300009098 | Ga0105245_10227757 | Ga0105245_102277572 | 291 |
| 115 | 3300009148 | Ga0105243_10052918 | Ga0105243_100529182 | 291 |
| 116 | 3300009174 | Ga0105241_10050527 | Ga0105241_100505272 | 291 |
| 117 | 3300009176 | Ga0105242_10001765 | Ga0105242_1000176513 | 291 |
| 118 | 3300011119 | Ga0105246_10027868 | Ga0105246_100278684 | 291 |
| 119 | 3300014968 | Ga0157379_10003348 | Ga0157379_100033484 | 291 |
| 120 | 3300014968 | Ga0157379_10003890 | Ga0157379_100038909 | 291 |
| 121 | 3300014969 | Ga0157376_10005906 | Ga0157376_100059062 | 291 |
| 122 | 3300025899 | Ga0207642_10107098 | Ga0207642_101070982 | 291 |
| 123 | 3300025935 | Ga0207709_10018346 | Ga0207709_100183462 | 291 |
| 124 | 3300025941 | Ga0207711_10029140 | Ga0207711_100291404 | 291 |
| 125 | 3300026035 | Ga0207703_10024690 | Ga0207703_100246904 | 291 |
| 126 | 3300026121 | Ga0207683_10000353 | Ga0207683_1000035343 | 291 |
| 127 | 3300037312 | Ga0395899_0032240 | Ga0395899_0032240_953_1828 | 291 |
| 128 | 3300046471 | Ga0495650_0000035 | Ga0495650_0000035_286892_287767 | 291 |
| 129 | 3300048903 | Ga0496100_0040122 | Ga0496100_0040122_1564_2439 | 291 |
| 130 | 3300048904 | Ga0496101_0026364 | Ga0496101_0026364_1008_1883 | 291 |
| 131 | 3300048905 | Ga0496102_0098762 | Ga0496102_0098762_870_1745 | 291 |
| 132 | 3300048906 | Ga0496103_0073169 | Ga0496103_0073169_328_1203 | 291 |
| 133 | 3300048907 | Ga0496104_0015020 | Ga0496104_0015020_5287_6162 | 291 |
| 134 | 3300048908 | Ga0496105_0007700 | Ga0496105_0007700_5059_5934 | 291 |
| 135 | 3300048909 | Ga0496106_0054659 | Ga0496106_0054659_1011_1886 | 291 |
| 136 | 3300048912 | Ga0496109_0164948 | Ga0496109_0164948_505_1380 | 291 |
| 137 | 3300048914 | Ga0496111_0447629 | Ga0496111_0447629_61_936 | 291 |
| 138 | 3300048917 | Ga0496114_0337935 | Ga0496114_0337935_195_1070 | 291 |
| 139 | 3300003203 | JGI25406J46586_10055127 | JGI25406J46586_100551271 | 292 |
| 140 | 3300005614 | Ga0068856_100016807 | Ga0068856_1000168074 | 292 |
| 141 | 3300005985 | Ga0081539_10001249 | Ga0081539_1000124910 | 292 |
| 142 | 3300009177 | Ga0105248_10274112 | Ga0105248_102741122 | 292 |
| 143 | 3300025941 | Ga0207711_10288083 | Ga0207711_102880831 | 292 |
| 144 | 3300047315 | Ga0495581_0273927 | Ga0495581_0273927_85_975 | 292 |
| 145 | 3300048903 | Ga0496100_0006619 | Ga0496100_0006619_1386_2267 | 292 |
| 146 | 3300048904 | Ga0496101_0001547 | Ga0496101_0001547_6432_7313 | 292 |
| 147 | 3300048905 | Ga0496102_0077666 | Ga0496102_0077666_781_1662 | 292 |
| 148 | 3300048907 | Ga0496104_0001009 | Ga0496104_0001009_9413_10294 | 292 |
| 149 | 3300048908 | Ga0496105_0000621 | Ga0496105_0000621_17996_18877 | 292 |
| 150 | 3300048911 | Ga0496108_0004554 | Ga0496108_0004554_4057_4938 | 292 |
| 151 | 3300048911 | Ga0496108_0104898 | Ga0496108_0104898_1081_1965 | 292 |
| 152 | 3300048912 | Ga0496109_0002568 | Ga0496109_0002568_4999_5880 | 292 |
| 153 | 3300048913 | Ga0496110_0000075 | Ga0496110_0000075_45233_46114 | 292 |
| 154 | 3300048914 | Ga0496111_0001251 | Ga0496111_0001251_3997_4878 | 292 |
| 155 | 3300048916 | Ga0496113_0125179 | Ga0496113_0125179_69_950 | 292 |
| 156 | 3300048917 | Ga0496114_0041276 | Ga0496114_0041276_2648_3547 | 292 |
| 157 | 3300049587 | Ga0501071_0111507 | Ga0501071_0111507_880_1761 | 292 |
| 158 | 3300005331 | Ga0070670_100030467 | Ga0070670_1000304673 | 293 |
| 159 | 3300005335 | Ga0070666_10008453 | Ga0070666_100084535 | 293 |
| 160 | 3300005338 | Ga0068868_100144159 | Ga0068868_1001441592 | 293 |
| 161 | 3300005340 | Ga0070689_100040572 | Ga0070689_1000405723 | 293 |
| 162 | 3300005345 | Ga0070692_10212873 | Ga0070692_102128732 | 293 |
| 163 | 3300005355 | Ga0070671_100001557 | Ga0070671_10000155718 | 293 |
| 164 | 3300005366 | Ga0070659_100000031 | Ga0070659_10000003153 | 293 |
| 165 | 3300005366 | Ga0070659_100401010 | Ga0070659_1004010101 | 293 |
| 166 | 3300005367 | Ga0070667_100008571 | Ga0070667_10000857110 | 293 |
| 167 | 3300005437 | Ga0070710_10000005 | Ga0070710_1000000510 | 293 |
| 168 | 3300005543 | Ga0070672_100182218 | Ga0070672_1001822182 | 293 |
| 169 | 3300005544 | Ga0070686_100049080 | Ga0070686_1000490802 | 293 |
| 170 | 3300005548 | Ga0070665_100021798 | Ga0070665_1000217985 | 293 |
| 171 | 3300005577 | Ga0068857_100234473 | Ga0068857_1002344732 | 293 |
| 172 | 3300005578 | Ga0068854_100214244 | Ga0068854_1002142442 | 293 |
| 173 | 3300005618 | Ga0068864_100210561 | Ga0068864_1002105612 | 293 |
| 174 | 3300005841 | Ga0068863_100000032 | Ga0068863_10000003274 | 293 |
| 175 | 3300005841 | Ga0068863_100018968 | Ga0068863_1000189683 | 293 |
| 176 | 3300005842 | Ga0068858_100020724 | Ga0068858_1000207246 | 293 |
| 177 | 3300005842 | Ga0068858_100182736 | Ga0068858_1001827362 | 293 |
| 178 | 3300005937 | Ga0081455_10005567 | Ga0081455_100055677 | 293 |
| 179 | 3300005983 | Ga0081540_1013926 | Ga0081540_10139263 | 293 |
| 180 | 3300006028 | Ga0070717_10100048 | Ga0070717_101000482 | 293 |
| 181 | 3300006175 | Ga0070712_100424909 | Ga0070712_1004249092 | 293 |
| 182 | 3300009098 | Ga0105245_10000067 | Ga0105245_1000006720 | 293 |
| 183 | 3300009101 | Ga0105247_10109408 | Ga0105247_101094082 | 293 |
| 184 | 3300009147 | Ga0114129_10164216 | Ga0114129_101642163 | 293 |
| 185 | 3300009148 | Ga0105243_10059541 | Ga0105243_100595412 | 293 |
| 186 | 3300009177 | Ga0105248_10056907 | Ga0105248_100569073 | 293 |
| 187 | 3300009553 | Ga0105249_10422248 | Ga0105249_104222482 | 293 |
| 188 | 3300010375 | Ga0105239_10094953 | Ga0105239_100949533 | 293 |
| 189 | 3300011119 | Ga0105246_10040753 | Ga0105246_100407532 | 293 |
| 190 | 3300013297 | Ga0157378_10000564 | Ga0157378_1000056428 | 293 |
| 191 | 3300013308 | Ga0157375_10632495 | Ga0157375_106324952 | 293 |
| 192 | 3300014325 | Ga0163163_10186665 | Ga0163163_101866652 | 293 |
| 193 | 3300014968 | Ga0157379_10273964 | Ga0157379_102739642 | 293 |
| 194 | 3300025898 | Ga0207692_10000003 | Ga0207692_10000003282 | 293 |
| 195 | 3300025901 | Ga0207688_10013426 | Ga0207688_100134263 | 293 |
| 196 | 3300025903 | Ga0207680_10004790 | Ga0207680_100047905 | 293 |
| 197 | 3300025904 | Ga0207647_10052161 | Ga0207647_100521612 | 293 |
| 198 | 3300025915 | Ga0207693_10356030 | Ga0207693_103560302 | 293 |
| 199 | 3300025919 | Ga0207657_10129203 | Ga0207657_101292032 | 293 |
| 200 | 3300025927 | Ga0207687_10000012 | Ga0207687_10000012335 | 293 |
| 201 | 3300025927 | Ga0207687_10104135 | Ga0207687_101041352 | 293 |
| 202 | 3300025931 | Ga0207644_10028204 | Ga0207644_100282043 | 293 |
| 203 | 3300025931 | Ga0207644_10422070 | Ga0207644_104220702 | 293 |
| 204 | 3300025932 | Ga0207690_10000057 | Ga0207690_1000005772 | 293 |
| 205 | 3300025933 | Ga0207706_10155379 | Ga0207706_101553792 | 293 |
| 206 | 3300025934 | Ga0207686_10289262 | Ga0207686_102892622 | 293 |
| 207 | 3300025937 | Ga0207669_10201681 | Ga0207669_102016812 | 293 |
| 208 | 3300025940 | Ga0207691_10055123 | Ga0207691_100551232 | 293 |
| 209 | 3300025941 | Ga0207711_10382336 | Ga0207711_103823362 | 293 |
| 210 | 3300025944 | Ga0207661_10062458 | Ga0207661_100624583 | 293 |
| 211 | 3300025944 | Ga0207661_10063955 | Ga0207661_100639552 | 293 |
| 212 | 3300025986 | Ga0207658_10005076 | Ga0207658_100050762 | 293 |
| 213 | 3300026035 | Ga0207703_10005692 | Ga0207703_100056926 | 293 |
| 214 | 3300026035 | Ga0207703_10217560 | Ga0207703_102175602 | 293 |
| 215 | 3300026035 | Ga0207703_10300159 | Ga0207703_103001592 | 293 |
| 216 | 3300026088 | Ga0207641_10000071 | Ga0207641_1000007174 | 293 |
| 217 | 3300026088 | Ga0207641_10013865 | Ga0207641_100138656 | 293 |
| 218 | 3300026116 | Ga0207674_10037067 | Ga0207674_100370673 | 293 |
| 219 | 3300026116 | Ga0207674_10185686 | Ga0207674_101856862 | 293 |
| 220 | 3300028379 | Ga0268266_10000085 | Ga0268266_10000085198 | 293 |
| 221 | 3300035116 | Ga0373945_0002474 | Ga0373945_0002474_765_1646 | 293 |
| 222 | 3300035170 | Ga0373943_0014243 | Ga0373943_0014243_1634_2515 | 293 |
| 223 | 3300035692 | Ga0373935_0027841 | Ga0373935_0027841_1633_2514 | 293 |
| 224 | 3300035692 | Ga0373935_0269694 | Ga0373935_0269694_263_1144 | 293 |
| 225 | 3300035725 | Ga0373947_0013419 | Ga0373947_0013419_1272_2153 | 293 |
| 226 | 3300035725 | Ga0373947_0015776 | Ga0373947_0015776_142_1023 | 293 |
| 227 | 3300037068 | Ga0373925_0008537 | Ga0373925_0008537_6341_7222 | 293 |
| 228 | 3300037312 | Ga0395899_0041560 | Ga0395899_0041560_1090_1989 | 293 |
| 229 | 3300037466 | Ga0395898_0140999 | Ga0395898_0140999_227_1126 | 293 |
| 230 | 3300037471 | Ga0395905_0043279 | Ga0395905_0043279_715_1623 | 293 |
| 231 | 3300037471 | Ga0395905_0113863 | Ga0395905_0113863_803_1702 | 293 |
| 232 | 3300038443 | Ga0395901_0027166 | Ga0395901_0027166_4191_5099 | 293 |
| 233 | 3300038443 | Ga0395901_0090345 | Ga0395901_0090345_479_1378 | 293 |
| 234 | 3300041505 | Ga0451849_0746551 | Ga0451849_0746551_1319_2215 | 293 |
| 235 | 3300046454 | Ga0495592_0086690 | Ga0495592_0086690_198_1079 | 293 |
| 236 | 3300046455 | Ga0495603_0015336 | Ga0495603_0015336_666_1547 | 293 |
| 237 | 3300046455 | Ga0495603_0095412 | Ga0495603_0095412_89_970 | 293 |
| 238 | 3300046458 | Ga0495591_023681 | Ga0495591_023681_291_1187 | 293 |
| 239 | 3300046459 | Ga0495629_0000964 | Ga0495629_0000964_1976_2872 | 293 |
| 240 | 3300046459 | Ga0495629_0021894 | Ga0495629_0021894_363_1244 | 293 |
| 241 | 3300046459 | Ga0495629_0038584 | Ga0495629_0038584_2287_3168 | 293 |
| 242 | 3300046459 | Ga0495629_0100518 | Ga0495629_0100518_57_938 | 293 |
| 243 | 3300046460 | Ga0495638_0078665 | Ga0495638_0078665_865_1761 | 293 |
| 244 | 3300046461 | Ga0495641_0000362 | Ga0495641_0000362_30087_30968 | 293 |
| 245 | 3300046461 | Ga0495641_0153658 | Ga0495641_0153658_20_928 | 293 |
| 246 | 3300046463 | Ga0495653_0113481 | Ga0495653_0113481_38_919 | 293 |
| 247 | 3300046463 | Ga0495653_0233345 | Ga0495653_0233345_143_1024 | 293 |
| 248 | 3300046473 | Ga0495582_0000114 | Ga0495582_0000114_4085_4966 | 293 |
| 249 | 3300046473 | Ga0495582_0022489 | Ga0495582_0022489_937_1818 | 293 |
| 250 | 3300046475 | Ga0495639_0004982 | Ga0495639_0004982_3981_4862 | 293 |
| 251 | 3300046476 | Ga0495662_0043194 | Ga0495662_0043194_1265_2146 | 293 |
| 252 | 3300046476 | Ga0495662_0045337 | Ga0495662_0045337_1147_2028 | 293 |
| 253 | 3300046499 | Ga0495594_0024843 | Ga0495594_0024843_1947_2828 | 293 |
| 254 | 3300046501 | Ga0495607_0169160 | Ga0495607_0169160_173_1066 | 293 |
| 255 | 3300046511 | Ga0495608_0017951 | Ga0495608_0017951_180_1061 | 293 |
| 256 | 3300046511 | Ga0495608_0070500 | Ga0495608_0070500_523_1404 | 293 |
| 257 | 3300046514 | Ga0495618_0139586 | Ga0495618_0139586_16_897 | 293 |
| 258 | 3300046516 | Ga0495628_0017526 | Ga0495628_0017526_196_1077 | 293 |
| 259 | 3300046517 | Ga0495630_0214392 | Ga0495630_0214392_294_1175 | 293 |
| 260 | 3300046526 | Ga0495666_0066114 | Ga0495666_0066114_338_1219 | 293 |
| 261 | 3300046526 | Ga0495666_0112019 | Ga0495666_0112019_73_981 | 293 |
| 262 | 3300046529 | Ga0495652_0036969 | Ga0495652_0036969_1425_2306 | 293 |
| 263 | 3300046531 | Ga0495665_0003022 | Ga0495665_0003022_7720_8601 | 293 |
| 264 | 3300046533 | Ga0495640_0014647 | Ga0495640_0014647_3011_3892 | 293 |
| 265 | 3300046533 | Ga0495640_0038461 | Ga0495640_0038461_1598_2479 | 293 |
| 266 | 3300046533 | Ga0495640_0045666 | Ga0495640_0045666_1535_2416 | 293 |
| 267 | 3300046543 | Ga0495645_0093658 | Ga0495645_0093658_73_954 | 293 |
| 268 | 3300046559 | Ga0495667_0001761 | Ga0495667_0001761_11946_12827 | 293 |
| 269 | 3300046559 | Ga0495667_0106918 | Ga0495667_0106918_425_1306 | 293 |
| 270 | 3300046559 | Ga0495667_0157131 | Ga0495667_0157131_235_1122 | 293 |
| 271 | 3300046642 | Ga0495634_0115855 | Ga0495634_0115855_793_1674 | 293 |
| 272 | 3300046660 | Ga0495625_0000117 | Ga0495625_0000117_27255_28157 | 293 |
| 273 | 3300046663 | Ga0495635_0019624 | Ga0495635_0019624_3067_3948 | 293 |
| 274 | 3300046663 | Ga0495635_0048275 | Ga0495635_0048275_781_1662 | 293 |
| 275 | 3300046683 | Ga0495658_0000467 | Ga0495658_0000467_13230_14111 | 293 |
| 276 | 3300046683 | Ga0495658_0057774 | Ga0495658_0057774_1257_2138 | 293 |
| 277 | 3300046684 | Ga0495669_0000131 | Ga0495669_0000131_44229_45125 | 293 |
| 278 | 3300046689 | Ga0495613_0002520 | Ga0495613_0002520_10695_11576 | 293 |
| 279 | 3300046689 | Ga0495613_0004956 | Ga0495613_0004956_490_1371 | 293 |
| 280 | 3300046690 | Ga0495624_0016745 | Ga0495624_0016745_2665_3546 | 293 |
| 281 | 3300046690 | Ga0495624_0114406 | Ga0495624_0114406_164_1072 | 293 |
| 282 | 3300046809 | Ga0495600_0025488 | Ga0495600_0025488_1918_2799 | 293 |
| 283 | 3300046809 | Ga0495600_0357236 | Ga0495600_0357236_15_896 | 293 |
| 284 | 3300047315 | Ga0495581_0000327 | Ga0495581_0000327_21505_22386 | 293 |
| 285 | 3300047319 | Ga0495674_0050317 | Ga0495674_0050317_1373_2254 | 293 |
| 286 | 3300047319 | Ga0495674_0074370 | Ga0495674_0074370_1817_2698 | 293 |
| 287 | 3300047321 | Ga0495676_0003147 | Ga0495676_0003147_8976_9857 | 293 |
| 288 | 3300047321 | Ga0495676_0004361 | Ga0495676_0004361_4964_5845 | 293 |
| 289 | 3300047322 | Ga0495680_0004812 | Ga0495680_0004812_7979_8860 | 293 |
| 290 | 3300047471 | Ga0495684_0001004 | Ga0495684_0001004_11679_12560 | 293 |
| 291 | 3300047471 | Ga0495684_0005850 | Ga0495684_0005850_5701_6582 | 293 |
| 292 | 3300047471 | Ga0495684_0028038 | Ga0495684_0028038_618_1499 | 293 |
| 293 | 3300047471 | Ga0495684_0031245 | Ga0495684_0031245_738_1619 | 293 |
| 294 | 3300047673 | Ga0495593_0001350 | Ga0495593_0001350_3391_4272 | 293 |
| 295 | 3300047673 | Ga0495593_0086389 | Ga0495593_0086389_81_962 | 293 |
| 296 | 3300048089 | Ga0495614_0072341 | Ga0495614_0072341_70_951 | 293 |
| 297 | 3300048904 | Ga0496101_0256232 | Ga0496101_0256232_413_1294 | 293 |
| 298 | 3300048904 | Ga0496101_0454001 | Ga0496101_0454001_37_930 | 293 |
| 299 | 3300048905 | Ga0496102_0006839 | Ga0496102_0006839_86_979 | 293 |
| 300 | 3300048905 | Ga0496102_0057067 | Ga0496102_0057067_350_1243 | 293 |
| 301 | 3300048906 | Ga0496103_0190594 | Ga0496103_0190594_151_1044 | 293 |
| 302 | 3300048907 | Ga0496104_0005385 | Ga0496104_0005385_8256_9146 | 293 |
| 303 | 3300048908 | Ga0496105_0002429 | Ga0496105_0002429_5928_6818 | 293 |
| 304 | 3300048910 | Ga0496107_0232497 | Ga0496107_0232497_160_1053 | 293 |
| 305 | 3300048912 | Ga0496109_0024637 | Ga0496109_0024637_625_1515 | 293 |
| 306 | 3300048913 | Ga0496110_0000112 | Ga0496110_0000112_39775_40665 | 293 |
| 307 | 3300048914 | Ga0496111_0002463 | Ga0496111_0002463_2395_3285 | 293 |
| 308 | 3300048916 | Ga0496113_0043170 | Ga0496113_0043170_2005_2901 | 293 |
| 309 | 3300048916 | Ga0496113_0109451 | Ga0496113_0109451_389_1279 | 293 |
| 310 | 3300048917 | Ga0496114_0007783 | Ga0496114_0007783_7076_7957 | 293 |
| 311 | 3300048918 | Ga0496115_0042170 | Ga0496115_0042170_1652_2533 | 293 |
| 312 | 3300048918 | Ga0496115_0096472 | Ga0496115_0096472_1089_1979 | 293 |
| 313 | 3300048920 | Ga0496117_0001208 | Ga0496117_0001208_21231_22124 | 293 |
| 314 | 3300048921 | Ga0496118_0000414 | Ga0496118_0000414_17172_18065 | 293 |
| 315 | 3300048922 | Ga0496119_0003338 | Ga0496119_0003338_2655_3545 | 293 |
| 316 | 3300048922 | Ga0496119_0061678 | Ga0496119_0061678_1067_1957 | 293 |
| 317 | 3300048923 | Ga0496120_0002177 | Ga0496120_0002177_18594_19484 | 293 |
| 318 | 3300048924 | Ga0496121_0013091 | Ga0496121_0013091_3988_4881 | 293 |
| 319 | 3300048924 | Ga0496121_0070868 | Ga0496121_0070868_898_1788 | 293 |
| 320 | 3300048928 | Ga0496125_0019567 | Ga0496125_0019567_3668_4558 | 293 |
| 321 | 3300048929 | Ga0496126_0005418 | Ga0496126_0005418_11184_12074 | 293 |
| 322 | 3300049581 | Ga0501047_0325788 | Ga0501047_0325788_364_1257 | 293 |
| 323 | 3300050507 | nmdc:mga05p37_283783_c1 | nmdc:mga05p37_283783_c1_642_1541 | 293 |
| 324 | 3300053085 | Ga0495619_0003326 | Ga0495619_0003326_5422_6303 | 293 |
| 325 | 3300053085 | Ga0495619_0091499 | Ga0495619_0091499_881_1762 | 293 |
| 326 | 3300053085 | Ga0495619_0129041 | Ga0495619_0129041_51_938 | 293 |
| 327 | 3300005330 | Ga0070690_100193674 | Ga0070690_1001936742 | 294 |
| 328 | 3300005336 | Ga0070680_100031167 | Ga0070680_1000311673 | 294 |
| 329 | 3300005337 | Ga0070682_100016484 | Ga0070682_1000164842 | 294 |
| 330 | 3300005434 | Ga0070709_10071033 | Ga0070709_100710332 | 294 |
| 331 | 3300005439 | Ga0070711_100051270 | Ga0070711_1000512703 | 294 |
| 332 | 3300005455 | Ga0070663_100040368 | Ga0070663_1000403682 | 294 |
| 333 | 3300005544 | Ga0070686_100091187 | Ga0070686_1000911872 | 294 |
| 334 | 3300005547 | Ga0070693_100003883 | Ga0070693_1000038834 | 294 |
| 335 | 3300006163 | Ga0070715_10018044 | Ga0070715_100180442 | 294 |
| 336 | 3300006173 | Ga0070716_100016305 | Ga0070716_1000163052 | 294 |
| 337 | 3300006358 | Ga0068871_100029649 | Ga0068871_1000296493 | 294 |
| 338 | 3300006871 | Ga0075434_100008485 | Ga0075434_1000084852 | 294 |
| 339 | 3300009177 | Ga0105248_10036864 | Ga0105248_100368643 | 294 |
| 340 | 3300014969 | Ga0157376_10014830 | Ga0157376_100148306 | 294 |
| 341 | 3300025916 | Ga0207663_10020273 | Ga0207663_100202733 | 294 |
| 342 | 3300025916 | Ga0207663_10115438 | Ga0207663_101154382 | 294 |
| 343 | 3300025928 | Ga0207700_10029338 | Ga0207700_100293382 | 294 |
| 344 | 3300025929 | Ga0207664_10012362 | Ga0207664_100123624 | 294 |
| 345 | 3300025929 | Ga0207664_10035262 | Ga0207664_100352624 | 294 |
| 346 | 3300025939 | Ga0207665_10000195 | Ga0207665_1000019532 | 294 |
| 347 | 3300025945 | Ga0207679_10203917 | Ga0207679_102039172 | 294 |
| 348 | 3300026067 | Ga0207678_10060299 | Ga0207678_100602993 | 294 |
| 349 | 3300026121 | Ga0207683_10000833 | Ga0207683_1000083327 | 294 |
| 350 | 3300035207 | Ga0373942_0039405 | Ga0373942_0039405_37_942 | 294 |
| 351 | 3300035241 | Ga0373961_0025287 | Ga0373961_0025287_678_1583 | 294 |
| 352 | 3300037466 | Ga0395898_0138803 | Ga0395898_0138803_510_1409 | 294 |
| 353 | 3300039453 | Ga0436362_0743083 | Ga0436362_0743083_375_1262 | 294 |
| 354 | 3300048088 | Ga0495602_0379090 | Ga0495602_0379090_44_943 | 294 |
| 355 | 3300048903 | Ga0496100_0147854 | Ga0496100_0147854_412_1317 | 294 |
| 356 | 3300048904 | Ga0496101_0071012 | Ga0496101_0071012_425_1366 | 294 |
| 357 | 3300048904 | Ga0496101_0125121 | Ga0496101_0125121_693_1598 | 294 |
| 358 | 3300048907 | Ga0496104_0031644 | Ga0496104_0031644_2167_3111 | 294 |
| 359 | 3300048908 | Ga0496105_0066592 | Ga0496105_0066592_213_1157 | 294 |
| 360 | 3300048909 | Ga0496106_0073673 | Ga0496106_0073673_624_1529 | 294 |
| 361 | 3300048909 | Ga0496106_0118502 | Ga0496106_0118502_923_1864 | 294 |
| 362 | 3300048910 | Ga0496107_0069330 | Ga0496107_0069330_991_1932 | 294 |
| 363 | 3300048910 | Ga0496107_0175356 | Ga0496107_0175356_63_968 | 294 |
| 364 | 3300048911 | Ga0496108_0017457 | Ga0496108_0017457_3004_3948 | 294 |
| 365 | 3300048912 | Ga0496109_0001979 | Ga0496109_0001979_14127_15071 | 294 |
| 366 | 3300048912 | Ga0496109_0068075 | Ga0496109_0068075_401_1306 | 294 |
| 367 | 3300048913 | Ga0496110_0001216 | Ga0496110_0001216_10405_11349 | 294 |
| 368 | 3300048915 | Ga0496112_0075308 | Ga0496112_0075308_824_1768 | 294 |
| 369 | 3300048915 | Ga0496112_0158217 | Ga0496112_0158217_244_1149 | 294 |
| 370 | 3300048916 | Ga0496113_0008888 | Ga0496113_0008888_1744_2688 | 294 |
| 371 | 3300048918 | Ga0496115_0042038 | Ga0496115_0042038_2216_3121 | 294 |
| 372 | 3300050512 | nmdc:mga0n895_252937_c1 | nmdc:mga0n895_252937_c1_851_1756 | 294 |
| 373 | 3300050515 | nmdc:mga0a205_276811_c1 | nmdc:mga0a205_276811_c1_456_1361 | 294 |
| 374 | 3300002459 | JGI24751J29686_10000148 | JGI24751J29686_1000014834 | 295 |
| 375 | 3300005329 | Ga0070683_100081090 | Ga0070683_1000810903 | 295 |
| 376 | 3300005336 | Ga0070680_100041644 | Ga0070680_1000416445 | 295 |
| 377 | 3300005338 | Ga0068868_100019057 | Ga0068868_1000190571 | 295 |
| 378 | 3300005338 | Ga0068868_100220711 | Ga0068868_1002207112 | 295 |
| 379 | 3300005339 | Ga0070660_100124502 | Ga0070660_1001245022 | 295 |
| 380 | 3300005341 | Ga0070691_10142924 | Ga0070691_101429242 | 295 |
| 381 | 3300005344 | Ga0070661_100062019 | Ga0070661_1000620193 | 295 |
| 382 | 3300005354 | Ga0070675_100021521 | Ga0070675_1000215213 | 295 |
| 383 | 3300005354 | Ga0070675_100122423 | Ga0070675_1001224232 | 295 |
| 384 | 3300005355 | Ga0070671_100060909 | Ga0070671_1000609093 | 295 |
| 385 | 3300005356 | Ga0070674_100158049 | Ga0070674_1001580491 | 295 |
| 386 | 3300005406 | Ga0070703_10006034 | Ga0070703_100060342 | 295 |
| 387 | 3300005436 | Ga0070713_100148354 | Ga0070713_1001483542 | 295 |
| 388 | 3300005441 | Ga0070700_100004175 | Ga0070700_1000041754 | 295 |
| 389 | 3300005444 | Ga0070694_100045239 | Ga0070694_1000452393 | 295 |
| 390 | 3300005455 | Ga0070663_100028898 | Ga0070663_1000288983 | 295 |
| 391 | 3300005456 | Ga0070678_100041009 | Ga0070678_1000410092 | 295 |
| 392 | 3300005456 | Ga0070678_100054027 | Ga0070678_1000540272 | 295 |
| 393 | 3300005456 | Ga0070678_100144853 | Ga0070678_1001448532 | 295 |
| 394 | 3300005458 | Ga0070681_10016198 | Ga0070681_100161985 | 295 |
| 395 | 3300005518 | Ga0070699_100017336 | Ga0070699_1000173364 | 295 |
| 396 | 3300005530 | Ga0070679_100066246 | Ga0070679_1000662462 | 295 |
| 397 | 3300005535 | Ga0070684_100001247 | Ga0070684_10000124713 | 295 |
| 398 | 3300005535 | Ga0070684_100011235 | Ga0070684_1000112354 | 295 |
| 399 | 3300005544 | Ga0070686_100090569 | Ga0070686_1000905692 | 295 |
| 400 | 3300005545 | Ga0070695_100292490 | Ga0070695_1002924902 | 295 |
| 401 | 3300005564 | Ga0070664_100014477 | Ga0070664_1000144772 | 295 |
| 402 | 3300005577 | Ga0068857_100362642 | Ga0068857_1003626422 | 295 |
| 403 | 3300005615 | Ga0070702_100034671 | Ga0070702_1000346713 | 295 |
| 404 | 3300005840 | Ga0068870_10000134 | Ga0068870_100001343 | 295 |
| 405 | 3300005844 | Ga0068862_100206852 | Ga0068862_1002068522 | 295 |
| 406 | 3300006173 | Ga0070716_100026482 | Ga0070716_1000264822 | 295 |
| 407 | 3300006175 | Ga0070712_100105310 | Ga0070712_1001053102 | 295 |
| 408 | 3300006237 | Ga0097621_100178156 | Ga0097621_1001781562 | 295 |
| 409 | 3300006237 | Ga0097621_100180216 | Ga0097621_1001802162 | 295 |
| 410 | 3300006237 | Ga0097621_100212056 | Ga0097621_1002120562 | 295 |
| 411 | 3300006358 | Ga0068871_100101674 | Ga0068871_1001016742 | 295 |
| 412 | 3300006358 | Ga0068871_100374475 | Ga0068871_1003744752 | 295 |
| 413 | 3300006847 | Ga0075431_100358995 | Ga0075431_1003589952 | 295 |
| 414 | 3300006852 | Ga0075433_10044244 | Ga0075433_100442442 | 295 |
| 415 | 3300006852 | Ga0075433_10057257 | Ga0075433_100572572 | 295 |
| 416 | 3300006852 | Ga0075433_10086914 | Ga0075433_100869142 | 295 |
| 417 | 3300006871 | Ga0075434_100080643 | Ga0075434_1000806433 | 295 |
| 418 | 3300009011 | Ga0105251_10036010 | Ga0105251_100360103 | 295 |
| 419 | 3300009092 | Ga0105250_10064194 | Ga0105250_100641942 | 295 |
| 420 | 3300009094 | Ga0111539_10069825 | Ga0111539_100698255 | 295 |
| 421 | 3300009094 | Ga0111539_10126625 | Ga0111539_101266253 | 295 |
| 422 | 3300009094 | Ga0111539_10359886 | Ga0111539_103598862 | 295 |
| 423 | 3300009098 | Ga0105245_10044950 | Ga0105245_100449503 | 295 |
| 424 | 3300009098 | Ga0105245_10334342 | Ga0105245_103343422 | 295 |
| 425 | 3300009147 | Ga0114129_10650715 | Ga0114129_106507152 | 295 |
| 426 | 3300009174 | Ga0105241_10034193 | Ga0105241_100341933 | 295 |
| 427 | 3300009174 | Ga0105241_10063770 | Ga0105241_100637703 | 295 |
| 428 | 3300009177 | Ga0105248_10145720 | Ga0105248_101457203 | 295 |
| 429 | 3300009551 | Ga0105238_10185824 | Ga0105238_101858242 | 295 |
| 430 | 3300010375 | Ga0105239_10209358 | Ga0105239_102093582 | 295 |
| 431 | 3300011119 | Ga0105246_10065812 | Ga0105246_100658122 | 295 |
| 432 | 3300011119 | Ga0105246_10194385 | Ga0105246_101943852 | 295 |
| 433 | 3300012507 | Ga0157342_1002966 | Ga0157342_10029662 | 295 |
| 434 | 3300013105 | Ga0157369_10069755 | Ga0157369_100697553 | 295 |
| 435 | 3300013296 | Ga0157374_10410876 | Ga0157374_104108762 | 295 |
| 436 | 3300013306 | Ga0163162_10378963 | Ga0163162_103789632 | 295 |
| 437 | 3300013306 | Ga0163162_10484434 | Ga0163162_104844342 | 295 |
| 438 | 3300013306 | Ga0163162_10543892 | Ga0163162_105438922 | 295 |
| 439 | 3300013307 | Ga0157372_10313693 | Ga0157372_103136932 | 295 |
| 440 | 3300013307 | Ga0157372_10472763 | Ga0157372_104727632 | 295 |
| 441 | 3300014325 | Ga0163163_10024577 | Ga0163163_100245772 | 295 |
| 442 | 3300014325 | Ga0163163_10410941 | Ga0163163_104109412 | 295 |
| 443 | 3300014497 | Ga0182008_10075745 | Ga0182008_100757451 | 295 |
| 444 | 3300014969 | Ga0157376_10010077 | Ga0157376_100100775 | 295 |
| 445 | 3300014969 | Ga0157376_10060523 | Ga0157376_100605233 | 295 |
| 446 | 3300025885 | Ga0207653_10004918 | Ga0207653_100049183 | 295 |
| 447 | 3300025885 | Ga0207653_10024186 | Ga0207653_100241862 | 295 |
| 448 | 3300025908 | Ga0207643_10000485 | Ga0207643_1000048516 | 295 |
| 449 | 3300025911 | Ga0207654_10056898 | Ga0207654_100568982 | 295 |
| 450 | 3300025912 | Ga0207707_10011818 | Ga0207707_100118184 | 295 |
| 451 | 3300025915 | Ga0207693_10129062 | Ga0207693_101290622 | 295 |
| 452 | 3300025916 | Ga0207663_10006365 | Ga0207663_100063654 | 295 |
| 453 | 3300025919 | Ga0207657_10125805 | Ga0207657_101258052 | 295 |
| 454 | 3300025920 | Ga0207649_10021645 | Ga0207649_100216453 | 295 |
| 455 | 3300025921 | Ga0207652_10008925 | Ga0207652_100089256 | 295 |
| 456 | 3300025925 | Ga0207650_10002510 | Ga0207650_100025102 | 295 |
| 457 | 3300025926 | Ga0207659_10121913 | Ga0207659_101219132 | 295 |
| 458 | 3300025926 | Ga0207659_10159173 | Ga0207659_101591731 | 295 |
| 459 | 3300025927 | Ga0207687_10201851 | Ga0207687_102018512 | 295 |
| 460 | 3300025928 | Ga0207700_10262942 | Ga0207700_102629422 | 295 |
| 461 | 3300025931 | Ga0207644_10021153 | Ga0207644_100211532 | 295 |
| 462 | 3300025937 | Ga0207669_10205675 | Ga0207669_102056752 | 295 |
| 463 | 3300025939 | Ga0207665_10001871 | Ga0207665_100018713 | 295 |
| 464 | 3300025944 | Ga0207661_10002679 | Ga0207661_1000267910 | 295 |
| 465 | 3300025945 | Ga0207679_10071313 | Ga0207679_100713132 | 295 |
| 466 | 3300026067 | Ga0207678_10082901 | Ga0207678_100829013 | 295 |
| 467 | 3300026075 | Ga0207708_10001317 | Ga0207708_100013179 | 295 |
| 468 | 3300026078 | Ga0207702_10038113 | Ga0207702_100381136 | 295 |
| 469 | 3300026078 | Ga0207702_10040588 | Ga0207702_100405883 | 295 |
| 470 | 3300026088 | Ga0207641_10028834 | Ga0207641_100288342 | 295 |
| 471 | 3300026088 | Ga0207641_10113949 | Ga0207641_101139492 | 295 |
| 472 | 3300026089 | Ga0207648_10547515 | Ga0207648_105475151 | 295 |
| 473 | 3300026116 | Ga0207674_10007726 | Ga0207674_100077266 | 295 |
| 474 | 3300026118 | Ga0207675_100194983 | Ga0207675_1001949832 | 295 |
| 475 | 3300026121 | Ga0207683_10032980 | Ga0207683_100329803 | 295 |
| 476 | 3300026121 | Ga0207683_10041159 | Ga0207683_100411593 | 295 |
| 477 | 3300026121 | Ga0207683_10060776 | Ga0207683_100607763 | 295 |
| 478 | 3300027907 | Ga0207428_10019920 | Ga0207428_100199204 | 295 |
| 479 | 3300028380 | Ga0268265_10007739 | Ga0268265_100077396 | 295 |
| 480 | 3300028381 | Ga0268264_10406503 | Ga0268264_104065032 | 295 |
| 481 | 3300035084 | Ga0373928_0011127 | Ga0373928_0011127_253_1161 | 295 |
| 482 | 3300035090 | Ga0373949_0017344 | Ga0373949_0017344_693_1601 | 295 |
| 483 | 3300035115 | Ga0373941_0003460 | Ga0373941_0003460_2114_3022 | 295 |
| 484 | 3300036401 | Ga0373937_0183042 | Ga0373937_0183042_876_1784 | 295 |
| 485 | 3300038443 | Ga0395901_0152636 | Ga0395901_0152636_890_1810 | 295 |
| 486 | 3300046462 | Ga0495651_0106004 | Ga0495651_0106004_968_1858 | 295 |
| 487 | 3300046473 | Ga0495582_0022757 | Ga0495582_0022757_2356_3264 | 295 |
| 488 | 3300046517 | Ga0495630_0005182 | Ga0495630_0005182_1538_2446 | 295 |
| 489 | 3300046517 | Ga0495630_0011491 | Ga0495630_0011491_949_1857 | 295 |
| 490 | 3300046517 | Ga0495630_0208834 | Ga0495630_0208834_19_909 | 295 |
| 491 | 3300046529 | Ga0495652_0026709 | Ga0495652_0026709_1827_2735 | 295 |
| 492 | 3300046529 | Ga0495652_0027111 | Ga0495652_0027111_2909_3799 | 295 |
| 493 | 3300046533 | Ga0495640_0004060 | Ga0495640_0004060_5726_6634 | 295 |
| 494 | 3300046535 | Ga0495586_0153320 | Ga0495586_0153320_297_1205 | 295 |
| 495 | 3300046543 | Ga0495645_0005733 | Ga0495645_0005733_2368_3276 | 295 |
| 496 | 3300046557 | Ga0495622_0087725 | Ga0495622_0087725_423_1331 | 295 |
| 497 | 3300046642 | Ga0495634_0011424 | Ga0495634_0011424_5264_6172 | 295 |
| 498 | 3300046642 | Ga0495634_0073133 | Ga0495634_0073133_1206_2114 | 295 |
| 499 | 3300046663 | Ga0495635_0127141 | Ga0495635_0127141_802_1710 | 295 |
| 500 | 3300046678 | Ga0495599_0004807 | Ga0495599_0004807_1412_2320 | 295 |
| 501 | 3300046689 | Ga0495613_0160223 | Ga0495613_0160223_321_1211 | 295 |
| 502 | 3300047319 | Ga0495674_0037948 | Ga0495674_0037948_1180_2088 | 295 |
| 503 | 3300047322 | Ga0495680_0080740 | Ga0495680_0080740_922_1812 | 295 |
| 504 | 3300047322 | Ga0495680_0211455 | Ga0495680_0211455_419_1327 | 295 |
| 505 | 3300047471 | Ga0495684_0087567 | Ga0495684_0087567_931_1821 | 295 |
| 506 | 3300048903 | Ga0496100_0003570 | Ga0496100_0003570_5116_6024 | 295 |
| 507 | 3300048903 | Ga0496100_0079068 | Ga0496100_0079068_1291_2199 | 295 |
| 508 | 3300048903 | Ga0496100_0162898 | Ga0496100_0162898_550_1458 | 295 |
| 509 | 3300048904 | Ga0496101_0056356 | Ga0496101_0056356_1005_1913 | 295 |
| 510 | 3300048905 | Ga0496102_0036801 | Ga0496102_0036801_857_1765 | 295 |
| 511 | 3300048907 | Ga0496104_0198848 | Ga0496104_0198848_497_1405 | 295 |
| 512 | 3300048907 | Ga0496104_0415605 | Ga0496104_0415605_107_1015 | 295 |
| 513 | 3300048908 | Ga0496105_0038610 | Ga0496105_0038610_2279_3187 | 295 |
| 514 | 3300048908 | Ga0496105_0077330 | Ga0496105_0077330_317_1225 | 295 |
| 515 | 3300048908 | Ga0496105_0188109 | Ga0496105_0188109_714_1622 | 295 |
| 516 | 3300048909 | Ga0496106_0134753 | Ga0496106_0134753_253_1161 | 295 |
| 517 | 3300048910 | Ga0496107_0054943 | Ga0496107_0054943_1727_2635 | 295 |
| 518 | 3300048910 | Ga0496107_0328725 | Ga0496107_0328725_121_1029 | 295 |
| 519 | 3300048911 | Ga0496108_0020124 | Ga0496108_0020124_2939_3847 | 295 |
| 520 | 3300048911 | Ga0496108_0095827 | Ga0496108_0095827_1424_2332 | 295 |
| 521 | 3300048911 | Ga0496108_0105486 | Ga0496108_0105486_934_1821 | 295 |
| 522 | 3300048911 | Ga0496108_0133873 | Ga0496108_0133873_297_1205 | 295 |
| 523 | 3300048912 | Ga0496109_0156360 | Ga0496109_0156360_436_1323 | 295 |
| 524 | 3300048912 | Ga0496109_0331681 | Ga0496109_0331681_455_1363 | 295 |
| 525 | 3300048913 | Ga0496110_0011878 | Ga0496110_0011878_788_1696 | 295 |
| 526 | 3300048913 | Ga0496110_0032838 | Ga0496110_0032838_2757_3665 | 295 |
| 527 | 3300048913 | Ga0496110_0036705 | Ga0496110_0036705_3019_3927 | 295 |
| 528 | 3300048913 | Ga0496110_0039830 | Ga0496110_0039830_1674_2582 | 295 |
| 529 | 3300048913 | Ga0496110_0138024 | Ga0496110_0138024_928_1836 | 295 |
| 530 | 3300048914 | Ga0496111_0004048 | Ga0496111_0004048_5048_5956 | 295 |
| 531 | 3300048914 | Ga0496111_0127810 | Ga0496111_0127810_676_1584 | 295 |
| 532 | 3300048914 | Ga0496111_0347184 | Ga0496111_0347184_33_941 | 295 |
| 533 | 3300048916 | Ga0496113_0100007 | Ga0496113_0100007_1047_1955 | 295 |
| 534 | 3300048917 | Ga0496114_0000247 | Ga0496114_0000247_2741_3649 | 295 |
| 535 | 3300048917 | Ga0496114_0014169 | Ga0496114_0014169_2732_3640 | 295 |
| 536 | 3300048917 | Ga0496114_0052065 | Ga0496114_0052065_2281_3189 | 295 |
| 537 | 3300048917 | Ga0496114_0114146 | Ga0496114_0114146_930_1838 | 295 |
| 538 | 3300048918 | Ga0496115_0049129 | Ga0496115_0049129_2095_3003 | 295 |
| 539 | 3300048918 | Ga0496115_0100232 | Ga0496115_0100232_1377_2285 | 295 |
| 540 | 3300048918 | Ga0496115_0121748 | Ga0496115_0121748_25_933 | 295 |
| 541 | 3300049583 | Ga0501067_0083059 | Ga0501067_0083059_163_1071 | 295 |
| 542 | 3300049592 | Ga0501076_0037238 | Ga0501076_0037238_2070_2960 | 295 |
| 543 | 3300050507 | nmdc:mga05p37_135111_c1 | nmdc:mga05p37_135111_c1_1486_2394 | 295 |
| 544 | 3300050510 | nmdc:mga06r32_251868_c1 | nmdc:mga06r32_251868_c1_717_1625 | 295 |
| 545 | 3300050511 | nmdc:mga08y16_119625_c1 | nmdc:mga08y16_119625_c1_1196_2083 | 295 |
| 546 | 3300050511 | nmdc:mga08y16_308349_c1 | nmdc:mga08y16_308349_c1_94_1002 | 295 |
| 547 | 3300050511 | nmdc:mga08y16_42346_c1 | nmdc:mga08y16_42346_c1_2897_3805 | 295 |
| 548 | 3300050513 | nmdc:mga0rr50_201261_c1 | nmdc:mga0rr50_201261_c1_179_1087 | 295 |
| 549 | 3300050513 | nmdc:mga0rr50_228882_c1 | nmdc:mga0rr50_228882_c1_456_1364 | 295 |
| 550 | 3300050514 | nmdc:mga08x19_145522_c1 | nmdc:mga08x19_145522_c1_579_1487 | 295 |
| 551 | 3300050515 | nmdc:mga0a205_17551_c1 | nmdc:mga0a205_17551_c1_3509_4417 | 295 |
| 552 | 3300050515 | nmdc:mga0a205_23081_c1 | nmdc:mga0a205_23081_c1_3311_4219 | 295 |
| 553 | 3300050515 | nmdc:mga0a205_28771_c1 | nmdc:mga0a205_28771_c1_772_1680 | 295 |
| 554 | 3300050515 | nmdc:mga0a205_369487_c1 | nmdc:mga0a205_369487_c1_339_1247 | 295 |
| 555 | 3300053077 | Ga0495601_0001813 | Ga0495601_0001813_2635_3525 | 295 |
| 556 | 3300053084 | Ga0495595_0097445 | Ga0495595_0097445_255_1163 | 295 |
| 557 | 3300053085 | Ga0495619_0098743 | Ga0495619_0098743_167_1075 | 295 |
| 558 | 3300060353 | Ga0501082_0231217 | Ga0501082_0231217_40_930 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qvl-assembly1.cif.gz_A | crystal structure of diacylglycerol kinase | 0.8939 | 4 | 290 |
| 2qv7-assembly1.cif.gz_A | crystal structure of diacylglycerol kinase dgkb in complex with adp and mg | 0.8591 | 4 | 290 |
| 4wer-assembly1.cif.gz_A-2 | crystal structure of diacylglycerol kinase catalytic domain protein from enterococcus faecalis v583 | 0.8572 | 1 | 292 |
| 3s40-assembly5.cif.gz_D | the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne | 0.8556 | 2 | 289 |
| 3t5p-assembly3.cif.gz_I | crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne | 0.8545 | 2 | 289 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP29_9_143_3.40.50.10330 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 | 0.8825 | 4 | 122 | 3.40.50.10330 |
| 2jgrA02 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.843 | 122 | 282 | 2.60.200.40 |
| af_A0A0R0JFH4_66_156_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8421 | 39 | 86 | 3.40.50.2300 |
| 2qvlA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 | 0.838 | 4 | 114 | 3.40.50.10330 |
| af_Q2FWZ2_3_120_3.40.50.10330 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 | 0.8378 | 4 | 114 | 3.40.50.10330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W7VI28-F1-model_v4 | deleted | 0.9193 | 4 | 290 |
|
| AF-A0A1G6GG18-F1-model_v4 | Diacylglycerol kinase family enzyme | 0.9096 | 4 | 290 |
GO:0005524
GO:0016020 GO:0016301 |
| AF-A0A535HKM1-F1-model_v4 | DAGKc domain-containing protein | 0.9087 | 4 | 122 |
GO:0016301
|
| AF-A0A7T8UE96-F1-model_v4 | deleted | 0.9027 | 4 | 290 |
|
| AF-A0A3D0PRI0-F1-model_v4 | YegS/DAGK C-terminal domain-containing protein | 0.8956 | 189 | 285 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar