F463386

General Info

Members Datasets Scaffolds Average Seq Length
558 244 1116 365

Family's Representative Sequence

Representative Sequence 3300001991|JGI24743J22301_10002067|JGI24743J22301_100020672
Length 395
Sequence MTGELDRRAMVTLSGGHLSVDFASGAVPALLPFLSDEFDLSYTATAALILAVLVSSSLLQPLFGLWSDRRGAMWLLPGGVALAGIGSGLAAVAPSYALVVVLFFVAGVGIAAYHPEGAKLAAYASGRRRASGMSYFNIGGNSGYALAPILITPLVIWLGLGGGLLAMIPVVAFSLFLLRVLPSLRPLVPSVTGRRVAVGEDDTRAMFLLSLVIGLRSVAWFALLAFVPLWVVANGGTEGEGGRELALMLVSGAVGTLVLGPVADRIGLRRTLLVTQTALPGLIVVFVAVGGLVGTLALMLVGLFVVGTFGVTMVLGQLYLPRRVGMASGLTIGLAMGIGGIAAVVLGALADAIDLETALYVAAAGPAIGAIVCLFLPAPIVRLPQAVEPAPAVIV

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 9.68
Rhizosphere 89.96
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10002067 3300001991 Bacteria 2955
2 JGI25406J46586_10004658 3300003203 Bacteria 6386
3 Ga0070658_10030921 3300005327 Bacteria 4300
4 Ga0070658_10057541 3300005327 Bacteria 3162
5 Ga0070683_100007306 3300005329 Bacteria 9324
6 Ga0070683_100070979 3300005329 Bacteria 3249
7 Ga0070683_100086885 3300005329 Bacteria 2932
8 Ga0070683_100098898 3300005329 Bacteria 2746
9 Ga0070683_100120632 3300005329 Bacteria 2477
10 Ga0070683_100150352 3300005329 Bacteria 2207
11 Ga0070690_100110773 3300005330 Bacteria 1832
12 Ga0070690_100161313 3300005330 Bacteria 1536
13 Ga0068869_100052405 3300005334 Bacteria 2963
14 Ga0070680_100003887 3300005336 Bacteria 11170
15 Ga0070680_100113342 3300005336 Bacteria 2258
16 Ga0070682_100025460 3300005337 Bacteria 3531
17 Ga0068868_100020777 3300005338 Bacteria 4940
18 Ga0068868_100033651 3300005338 Bacteria 3952
19 Ga0070660_100034889 3300005339 Bacteria 3804
20 Ga0070660_100243680 3300005339 Bacteria 1465
21 Ga0070689_100041891 3300005340 Bacteria 3515
22 Ga0070689_100110725 3300005340 Bacteria 2183
23 Ga0070687_100020825 3300005343 Bacteria 3073
24 Ga0070661_100034863 3300005344 Bacteria 3652
25 Ga0070661_100126782 3300005344 Bacteria 1915
26 Ga0070668_100256872 3300005347 Unclassified 1452
27 Ga0070675_100010430 3300005354 Bacteria 7259
28 Ga0070671_100112536 3300005355 Bacteria 2287
29 Ga0070671_100303043 3300005355 Bacteria 1361
30 Ga0070674_100018352 3300005356 Bacteria 4422
31 Ga0070674_100026430 3300005356 Bacteria 3791
32 Ga0070674_100038109 3300005356 Bacteria 3237
33 Ga0070674_100064905 3300005356 Bacteria 2560
34 Ga0070673_100005514 3300005364 Bacteria 8107
35 Ga0070673_100098522 3300005364 Bacteria 2403
36 Ga0070688_100010734 3300005365 Bacteria 5061
37 Ga0070688_100011110 3300005365 Bacteria 4998
38 Ga0070688_100233999 3300005365 Unclassified 1301
39 Ga0070659_100026443 3300005366 Bacteria 4467
40 Ga0070659_100065295 3300005366 Bacteria 2882
41 Ga0070659_100119529 3300005366 Bacteria 2133
42 Ga0070659_100163545 3300005366 Bacteria 1820
43 Ga0070714_100154826 3300005435 Bacteria 2068
44 Ga0070710_10118907 3300005437 Bacteria 1597
45 Ga0070701_10040764 3300005438 Bacteria 2362
46 Ga0070711_100034918 3300005439 Bacteria 3357
47 Ga0070700_100011552 3300005441 Bacteria 4894
48 Ga0070700_100020244 3300005441 Bacteria 3852
49 Ga0070694_100101700 3300005444 Bacteria 2034
50 Ga0070708_100110409 3300005445 Bacteria 2527
51 Ga0070663_100010916 3300005455 Bacteria 5676
52 Ga0070663_100195650 3300005455 Bacteria 1576
53 Ga0070678_100033754 3300005456 Bacteria 3557
54 Ga0070662_100027360 3300005457 Bacteria 3957
55 Ga0070662_100074801 3300005457 Bacteria 2507
56 Ga0070662_100147894 3300005457 Bacteria 1826
57 Ga0070681_10000439 3300005458 Bacteria 33866
58 Ga0070681_10097491 3300005458 Bacteria 2887
59 Ga0068867_100023308 3300005459 Bacteria 4432
60 Ga0068867_100037625 3300005459 Bacteria 3517
61 Ga0070685_10004616 3300005466 Bacteria 6971
62 Ga0070685_10054988 3300005466 Bacteria 2311
63 Ga0070706_100082484 3300005467 Bacteria 2978
64 Ga0070706_100145139 3300005467 Bacteria 2216
65 Ga0070698_100262188 3300005471 Bacteria 1660
66 Ga0070679_100033516 3300005530 Bacteria 5085
67 Ga0070679_100071912 3300005530 Bacteria 3451
68 Ga0070679_100109472 3300005530 Bacteria 2749
69 Ga0070679_100120760 3300005530 Bacteria 2605
70 Ga0070679_100192752 3300005530 Bacteria 2006
71 Ga0070679_100238204 3300005530 Bacteria 1778
72 Ga0070684_100002364 3300005535 Bacteria 13907
73 Ga0070684_100013798 3300005535 Bacteria 6523
74 Ga0070684_100016695 3300005535 Bacteria 6008
75 Ga0070684_100031766 3300005535 Bacteria 4497
76 Ga0070684_100035250 3300005535 Bacteria 4282
77 Ga0070684_100047073 3300005535 Bacteria 3737
78 Ga0070684_100196719 3300005535 Bacteria 1836
79 Ga0070684_100345306 3300005535 Bacteria 1368
80 Ga0068853_100017451 3300005539 Bacteria 5923
81 Ga0068853_100026345 3300005539 Bacteria 4882
82 Ga0070672_100048666 3300005543 Bacteria 3295
83 Ga0070672_100122162 3300005543 Bacteria 2133
84 Ga0070686_100023956 3300005544 Bacteria 3655
85 Ga0070686_100059845 3300005544 Bacteria 2455
86 Ga0070696_100064224 3300005546 Bacteria 2572
87 Ga0070693_100027461 3300005547 Bacteria 3086
88 Ga0070693_100060764 3300005547 Bacteria 2194
89 Ga0070665_100014467 3300005548 Bacteria 7914
90 Ga0070704_100314022 3300005549 Bacteria 1310
91 Ga0068855_100105200 3300005563 Bacteria 3245
92 Ga0070664_100022167 3300005564 Bacteria 5239
93 Ga0070664_100225467 3300005564 Bacteria 1678
94 Ga0068857_100173865 3300005577 Bacteria 1958
95 Ga0068854_100001862 3300005578 Bacteria 12851
96 Ga0068854_100022281 3300005578 Bacteria 4312
97 Ga0068854_100250901 3300005578 Bacteria 1413
98 Ga0070702_100129311 3300005615 Unclassified 1593
99 Ga0068852_100080538 3300005616 Bacteria 2887
100 Ga0068852_100154982 3300005616 Bacteria 2133
101 Ga0068852_100193418 3300005616 Bacteria 1921
102 Ga0068859_100054747 3300005617 Bacteria 4014
103 Ga0068859_100462148 3300005617 Unclassified 1365
104 Ga0068864_100074081 3300005618 Bacteria 2970
105 Ga0068864_100082771 3300005618 Bacteria 2816
106 Ga0068861_100072548 3300005719 Bacteria 2671
107 Ga0068870_10030264 3300005840 Bacteria 2735
108 Ga0068870_10039266 3300005840 Bacteria 2449
109 Ga0068858_100012580 3300005842 Bacteria 7979
110 Ga0068858_100109485 3300005842 Unclassified 2579
111 Ga0068862_100226628 3300005844 Bacteria 1694
112 Ga0081455_10029594 3300005937 Bacteria 4991
113 Ga0081455_10036443 3300005937 Bacteria 4379
114 Ga0081539_10000583 3300005985 Bacteria 74948
115 Ga0075364_10111436 3300006051 Bacteria 1826
116 Ga0075432_10001278 3300006058 Bacteria 8119
117 Ga0075367_10096715 3300006178 Unclassified 1801
118 Ga0097621_100033505 3300006237 Bacteria 4091
119 Ga0068871_100079406 3300006358 Bacteria 2715
120 Ga0075428_100020693 3300006844 Bacteria 7286
121 Ga0075431_100091956 3300006847 Bacteria 3131
122 Ga0075431_100349433 3300006847 Bacteria 1487
123 Ga0075433_10072992 3300006852 Bacteria 3018
124 Ga0075434_100063374 3300006871 Bacteria 3679
125 Ga0075434_100182565 3300006871 Unclassified 2119
126 Ga0075429_100015563 3300006880 Bacteria 6590
127 Ga0068865_100030733 3300006881 Bacteria 3575
128 Ga0068865_100131346 3300006881 Bacteria 1877
129 Ga0097620_100054747 3300006931 Bacteria 4014
130 Ga0097620_100462177 3300006931 Unclassified 1365
131 Ga0075435_100041348 3300007076 Bacteria 3684
132 Ga0105240_10240043 3300009093 Bacteria 2101
133 Ga0111539_10037483 3300009094 Bacteria 5853
134 Ga0111539_10058742 3300009094 Bacteria 4562
135 Ga0111539_10071686 3300009094 Bacteria 4088
136 Ga0111539_10075632 3300009094 Bacteria 3967
137 Ga0111539_10348672 3300009094 Bacteria 1723
138 Ga0105245_10018625 3300009098 Bacteria 6072
139 Ga0105245_10036618 3300009098 Bacteria 4360
140 Ga0105245_10079502 3300009098 Bacteria 2994
141 Ga0114129_10077520 3300009147 Bacteria 4622
142 Ga0114129_10116591 3300009147 Bacteria 3680
143 Ga0114129_10139684 3300009147 Bacteria 3322
144 Ga0114129_10173871 3300009147 Bacteria 2934
145 Ga0105243_10004065 3300009148 Bacteria 11655
146 Ga0105243_10017099 3300009148 Bacteria 5485
147 Ga0105243_10095562 3300009148 Bacteria 2456
148 Ga0105243_10205176 3300009148 Bacteria 1732
149 Ga0105241_10247209 3300009174 Bacteria 1511
150 Ga0105242_10022173 3300009176 Bacteria 4990
151 Ga0105242_10033955 3300009176 Bacteria 4088
152 Ga0105242_10186365 3300009176 Bacteria 1834
153 Ga0105248_10135171 3300009177 Unclassified 2781
154 Ga0105248_10167073 3300009177 Bacteria 2480
155 Ga0105238_10043673 3300009551 Bacteria 4534
156 Ga0105238_10086448 3300009551 Bacteria 3123
157 Ga0105238_10204168 3300009551 Bacteria 1952
158 Ga0105238_10205612 3300009551 Bacteria 1945
159 Ga0105239_10014824 3300010375 Bacteria 8645
160 Ga0105239_10045470 3300010375 Bacteria 4812
161 Ga0105239_10429064 3300010375 Bacteria 1498
162 Ga0105246_10056646 3300011119 Bacteria 2710
163 Ga0105246_10088802 3300011119 Bacteria 2222
164 Ga0157373_10121763 3300013100 Bacteria 1834
165 Ga0157371_10029851 3300013102 Bacteria 3937
166 Ga0157370_10010483 3300013104 Bacteria 9762
167 Ga0157370_10047419 3300013104 Bacteria 4119
168 Ga0157370_10052939 3300013104 Bacteria 3873
169 Ga0157370_10064026 3300013104 Bacteria 3482
170 Ga0157370_10096457 3300013104 Bacteria 2774
171 Ga0157369_10015605 3300013105 Bacteria 8560
172 Ga0157369_10019994 3300013105 Bacteria 7487
173 Ga0157369_10052189 3300013105 Bacteria 4425
174 Ga0157369_10196115 3300013105 Bacteria 2120
175 Ga0157378_10196124 3300013297 Unclassified 1907
176 Ga0157372_10003616 3300013307 Bacteria 16644
177 Ga0157372_10058008 3300013307 Bacteria 4327
178 Ga0157372_10253472 3300013307 Bacteria 2043
179 Ga0163163_10019643 3300014325 Bacteria 6347
180 Ga0157380_10028135 3300014326 Bacteria 4282
181 Ga0157380_10090376 3300014326 Bacteria 2526
182 Ga0157380_10174132 3300014326 Unclassified 1883
183 Ga0157377_10000638 3300014745 Bacteria 14581
184 Ga0157377_10020257 3300014745 Bacteria 3482
185 Ga0157379_10045042 3300014968 Bacteria 3938
186 Ga0157376_10020539 3300014969 Bacteria 5111
187 Ga0157376_10044044 3300014969 Unclassified 3666
188 Ga0157376_10139095 3300014969 Bacteria 2176
189 Ga0206354_10377492 3300020081 Bacteria 2419
190 Ga0206353_11314004 3300020082 Bacteria 8016
191 Ga0207710_10044852 3300025900 Bacteria 1970
192 Ga0207688_10001628 3300025901 Bacteria 11851
193 Ga0207688_10009247 3300025901 Bacteria 5371
194 Ga0207685_10046161 3300025905 Bacteria 1657
195 Ga0207643_10005084 3300025908 Bacteria 7046
196 Ga0207643_10008227 3300025908 Bacteria 5598
197 Ga0207643_10016074 3300025908 Bacteria 4078
198 Ga0207705_10028235 3300025909 Bacteria 4000
199 Ga0207705_10160867 3300025909 Bacteria 1687
200 Ga0207707_10011116 3300025912 Bacteria 7828
201 Ga0207707_10013132 3300025912 Bacteria 7217
202 Ga0207707_10016197 3300025912 Bacteria 6503
203 Ga0207695_10144939 3300025913 Bacteria 2320
204 Ga0207695_10270782 3300025913 Bacteria 1594
205 Ga0207671_10051571 3300025914 Bacteria 3049
206 Ga0207693_10001465 3300025915 Bacteria 20855
207 Ga0207693_10094625 3300025915 Bacteria 2341
208 Ga0207660_10027225 3300025917 Bacteria 3898
209 Ga0207660_10120749 3300025917 Bacteria 1984
210 Ga0207660_10149343 3300025917 Bacteria 1794
211 Ga0207662_10007456 3300025918 Bacteria 5958
212 Ga0207657_10003061 3300025919 Bacteria 17896
213 Ga0207657_10013668 3300025919 Bacteria 7952
214 Ga0207657_10110627 3300025919 Bacteria 2269
215 Ga0207649_10078133 3300025920 Bacteria 2135
216 Ga0207649_10145668 3300025920 Bacteria 1626
217 Ga0207652_10002381 3300025921 Bacteria 15884
218 Ga0207652_10210463 3300025921 Unclassified 1751
219 Ga0207681_10050969 3300025923 Bacteria 2803
220 Ga0207694_10179402 3300025924 Bacteria 1717
221 Ga0207650_10063648 3300025925 Bacteria 2758
222 Ga0207659_10103369 3300025926 Unclassified 2153
223 Ga0207687_10025471 3300025927 Bacteria 3958
224 Ga0207687_10038906 3300025927 Bacteria 3253
225 Ga0207690_10190072 3300025932 Bacteria 1552
226 Ga0207706_10089146 3300025933 Bacteria 2712
227 Ga0207706_10093417 3300025933 Bacteria 2645
228 Ga0207706_10117082 3300025933 Bacteria 2343
229 Ga0207686_10003756 3300025934 Bacteria 8149
230 Ga0207686_10034766 3300025934 Bacteria 3019
231 Ga0207686_10132172 3300025934 Bacteria 1713
232 Ga0207709_10024488 3300025935 Bacteria 3447
233 Ga0207709_10031379 3300025935 Bacteria 3103
234 Ga0207669_10036009 3300025937 Bacteria 2823
235 Ga0207669_10045325 3300025937 Bacteria 2590
236 Ga0207669_10235832 3300025937 Unclassified 1353
237 Ga0207689_10133342 3300025942 Bacteria 2045
238 Ga0207689_10253418 3300025942 Unclassified 1456
239 Ga0207661_10003615 3300025944 Bacteria 10760
240 Ga0207661_10027177 3300025944 Bacteria 4369
241 Ga0207661_10031482 3300025944 Bacteria 4099
242 Ga0207661_10120832 3300025944 Bacteria 2230
243 Ga0207679_10265528 3300025945 Bacteria 1466
244 Ga0207667_10133589 3300025949 Bacteria 2556
245 Ga0207667_10217383 3300025949 Bacteria 1958
246 Ga0207668_10029924 3300025972 Bacteria 3574
247 Ga0207668_10272541 3300025972 Unclassified 1384
248 Ga0207640_10008532 3300025981 Bacteria 5692
249 Ga0207640_10131175 3300025981 Bacteria 1812
250 Ga0207677_10162021 3300026023 Unclassified 1739
251 Ga0207677_10280753 3300026023 Bacteria 1367
252 Ga0207703_10178521 3300026035 Unclassified 1873
253 Ga0207639_10053872 3300026041 Bacteria 3071
254 Ga0207639_10152884 3300026041 Bacteria 1935
255 Ga0207678_10024488 3300026067 Bacteria 5272
256 Ga0207708_10004461 3300026075 Bacteria 10319
257 Ga0207708_10020293 3300026075 Bacteria 5012
258 Ga0207708_10035830 3300026075 Bacteria 3775
259 Ga0207702_10126885 3300026078 Bacteria 2292
260 Ga0207702_10168437 3300026078 Bacteria 2006
261 Ga0207702_10264066 3300026078 Bacteria 1622
262 Ga0207648_10018548 3300026089 Bacteria 6297
263 Ga0207648_10038231 3300026089 Bacteria 4224
264 Ga0207648_10062869 3300026089 Bacteria 3236
265 Ga0207676_10067360 3300026095 Bacteria 2860
266 Ga0207676_10184208 3300026095 Bacteria 1831
267 Ga0207676_10392485 3300026095 Bacteria 1295
268 Ga0207674_10144380 3300026116 Bacteria 2339
269 Ga0207675_100123580 3300026118 Bacteria 2450
270 Ga0207683_10020432 3300026121 Bacteria 5664
271 Ga0207683_10022853 3300026121 Bacteria 5372
272 Ga0207683_10066567 3300026121 Bacteria 3177
273 Ga0207698_10160010 3300026142 Unclassified 1968
274 Ga0207698_10186602 3300026142 Bacteria 1842
275 Ga0207428_10000383 3300027907 Bacteria 55634
276 Ga0207428_10027889 3300027907 Bacteria 4697
277 Ga0207428_10059391 3300027907 Bacteria 3033
278 Ga0207428_10096739 3300027907 Bacteria 2286
279 Ga0268266_10027290 3300028379 Bacteria 4856
280 Ga0265334_10055762 3300028573 Bacteria 1502
281 Ga0265318_10001979 3300028577 Bacteria 11374
282 Ga0265318_10044062 3300028577 Bacteria 1689
283 Ga0265338_10005756 3300028800 Bacteria 16037
284 Ga0265330_10008853 3300031235 Bacteria 4815
285 Ga0265330_10026909 3300031235 Bacteria 2600
286 Ga0265332_10022893 3300031238 Bacteria 2756
287 Ga0265328_10006752 3300031239 Bacteria 4829
288 Ga0265325_10009312 3300031241 Bacteria 5739
289 Ga0265329_10005245 3300031242 Bacteria 5264
290 Ga0265340_10011154 3300031247 Bacteria 4786
291 Ga0265339_10008421 3300031249 Bacteria 6560
292 Ga0265339_10048985 3300031249 Bacteria 2315
293 Ga0265331_10073606 3300031250 Bacteria 1595
294 Ga0265327_10010204 3300031251 Bacteria 6635
295 Ga0265327_10014050 3300031251 Bacteria 5268
296 Ga0265327_10016526 3300031251 Bacteria 4680
297 Ga0265316_10007432 3300031344 Bacteria 10324
298 Ga0265316_10025960 3300031344 Bacteria 4881
299 Ga0265313_10003939 3300031595 Bacteria 11684
300 Ga0265313_10021955 3300031595 Bacteria 3477
301 Ga0265313_10023158 3300031595 Bacteria 3351
302 Ga0265314_10001460 3300031711 Bacteria 26370
303 Ga0265314_10006337 3300031711 Bacteria 10497
304 Ga0265342_10010550 3300031712 Bacteria 6394
305 Ga0265342_10022846 3300031712 Bacteria 3969
306 Ga0373955_0093056 3300035172 Bacteria 1721
307 Ga0395899_0001088 3300037312 Bacteria 24437
308 Ga0395899_0017717 3300037312 Bacteria 5425
309 Ga0395900_0072729 3300037418 Unclassified 3534
310 Ga0395900_0079324 3300037418 Bacteria 3373
311 Ga0395900_0191971 3300037418 Bacteria 2071
312 Ga0395898_0010060 3300037466 Bacteria 9899
313 Ga0395898_0015599 3300037466 Bacteria 7789
314 Ga0395898_0023861 3300037466 Bacteria 6174
315 Ga0395898_0130463 3300037466 Bacteria 2408
316 Ga0395898_0164965 3300037466 Bacteria 2119
317 Ga0395905_0193122 3300037471 Unclassified 1909
318 Ga0395901_0001814 3300038443 Bacteria 22056
319 Ga0395901_0008468 3300038443 Bacteria 10394
320 Ga0395901_0013617 3300038443 Bacteria 8269
321 Ga0395901_0020443 3300038443 Bacteria 6777
322 Ga0395901_0383857 3300038443 Unclassified 1445
323 Ga0466969_0084976 3300044656 Bacteria 1505
324 Ga0466966_0046342 3300044684 Bacteria 2776
325 Ga0466961_0001452 3300044693 Bacteria 14727
326 Ga0466961_0023672 3300044693 Bacteria 3951
327 Ga0466961_0068211 3300044693 Bacteria 2258
328 Ga0466963_0000133 3300044694 Bacteria 28504
329 Ga0466963_0001891 3300044694 Bacteria 11436
330 Ga0466963_0066261 3300044694 Bacteria 2422
331 Ga0466963_0085961 3300044694 Bacteria 2136
332 Ga0466964_0008448 3300044706 Bacteria 3869
333 Ga0466964_0022930 3300044706 Bacteria 2425
334 Ga0466964_0029243 3300044706 Bacteria 2174
335 Ga0466971_0000495 3300044719 Bacteria 15481
336 Ga0466957_0000762 3300044842 Bacteria 16399
337 Ga0466957_0011807 3300044842 Bacteria 5051
338 Ga0466959_0022219 3300045049 Bacteria 4687
339 Ga0466959_0052648 3300045049 Bacteria 2980
340 Ga0451576_0035357 3300045051 Bacteria 5301
341 Ga0466958_0000461 3300045836 Bacteria 16966
342 Ga0466958_0000927 3300045836 Bacteria 13210
343 Ga0466967_0000172 3300045976 Bacteria 26699
344 Ga0466967_0000451 3300045976 Bacteria 19714
345 Ga0466967_0002499 3300045976 Bacteria 11484
346 Ga0466967_0007784 3300045976 Bacteria 7778
347 Ga0466967_0049268 3300045976 Bacteria 3683
348 Ga0466967_0064046 3300045976 Bacteria 3268
349 Ga0466967_0101295 3300045976 Bacteria 2632
350 Ga0466967_0114706 3300045976 Bacteria 2480
351 Ga0466967_0151346 3300045976 Bacteria 2169
352 Ga0466967_0182379 3300045976 Bacteria 1981
353 Ga0466967_0258403 3300045976 Bacteria 1666
354 Ga0466967_0357612 3300045976 Bacteria 1414
355 Ga0495592_0011664 3300046454 Bacteria 6656
356 Ga0495592_0035136 3300046454 Bacteria 3777
357 Ga0495603_0073810 3300046455 Bacteria 2004
358 Ga0495641_0012995 3300046461 Bacteria 4610
359 Ga0495651_0003210 3300046462 Bacteria 12560
360 Ga0495651_0078284 3300046462 Bacteria 2501
361 Ga0495594_0052473 3300046499 Bacteria 2245
362 Ga0495608_0011318 3300046511 Bacteria 6212
363 Ga0495608_0012683 3300046511 Bacteria 5847
364 Ga0495628_0003449 3300046516 Bacteria 14162
365 Ga0495644_0043274 3300046523 Bacteria 1695
366 Ga0495652_0016239 3300046529 Bacteria 6660
367 Ga0495640_0003136 3300046533 Bacteria 13322
368 Ga0495587_0059986 3300046536 Bacteria 2232
369 Ga0495667_0006363 3300046559 Bacteria 8011
370 Ga0495667_0010779 3300046559 Bacteria 6179
371 Ga0495667_0053993 3300046559 Bacteria 2645
372 Ga0495667_0062853 3300046559 Bacteria 2432
373 Ga0495657_0014943 3300046675 Bacteria 5693
374 Ga0495624_0071062 3300046690 Bacteria 2166
375 Ga0495604_0006748 3300047317 Bacteria 9104
376 Ga0495604_0174149 3300047317 Bacteria 1510
377 Ga0495674_0003880 3300047319 Bacteria 14521
378 Ga0495674_0106129 3300047319 Bacteria 2386
379 Ga0495680_0001771 3300047322 Bacteria 22882
380 Ga0495680_0003001 3300047322 Bacteria 16840
381 Ga0495680_0007898 3300047322 Bacteria 9710
382 Ga0495680_0038925 3300047322 Bacteria 3797
383 Ga0495684_0002893 3300047471 Bacteria 13524
384 Ga0495684_0082570 3300047471 Bacteria 2438
385 Ga0496100_0006542 3300048903 Bacteria 6360
386 Ga0496100_0017704 3300048903 Bacteria 4212
387 Ga0496100_0072176 3300048903 Bacteria 2307
388 Ga0496100_0079784 3300048903 Bacteria 2206
389 Ga0496101_0001986 3300048904 Bacteria 12409
390 Ga0496101_0003856 3300048904 Bacteria 9375
391 Ga0496101_0010971 3300048904 Bacteria 6001
392 Ga0496101_0030753 3300048904 Unclassified 3768
393 Ga0496102_0036354 3300048905 Bacteria 4436
394 Ga0496102_0040876 3300048905 Bacteria 4197
395 Ga0496102_0149627 3300048905 Bacteria 2193
396 Ga0496104_0098112 3300048907 Bacteria 2805
397 Ga0496104_0143885 3300048907 Bacteria 2290
398 Ga0496104_0240928 3300048907 Bacteria 1721
399 Ga0496104_0279384 3300048907 Bacteria 1583
400 Ga0496105_0004716 3300048908 Bacteria 10286
401 Ga0496105_0043320 3300048908 Bacteria 3712
402 Ga0496105_0118131 3300048908 Bacteria 2187
403 Ga0496105_0213595 3300048908 Bacteria 1572
404 Ga0496106_0027294 3300048909 Bacteria 4252
405 Ga0496106_0098307 3300048909 Unclassified 2267
406 Ga0496107_0004071 3300048910 Bacteria 9846
407 Ga0496107_0009866 3300048910 Bacteria 6621
408 Ga0496107_0043402 3300048910 Bacteria 3230
409 Ga0496108_0000898 3300048911 Bacteria 23175
410 Ga0496108_0002746 3300048911 Bacteria 14086
411 Ga0496108_0003822 3300048911 Bacteria 12066
412 Ga0496108_0051823 3300048911 Bacteria 3438
413 Ga0496109_0001492 3300048912 Bacteria 19442
414 Ga0496109_0011956 3300048912 Bacteria 7474
415 Ga0496109_0025711 3300048912 Bacteria 5247
416 Ga0496109_0084797 3300048912 Bacteria 2923
417 Ga0496109_0093331 3300048912 Bacteria 2785
418 Ga0496109_0117435 3300048912 Bacteria 2476
419 Ga0496110_0002155 3300048913 Bacteria 14697
420 Ga0496110_0004580 3300048913 Bacteria 10740
421 Ga0496110_0010795 3300048913 Bacteria 7445
422 Ga0496110_0072127 3300048913 Bacteria 3063
423 Ga0496110_0114177 3300048913 Bacteria 2430
424 Ga0496111_0000986 3300048914 Bacteria 15592
425 Ga0496111_0003480 3300048914 Bacteria 9740
426 Ga0496111_0006116 3300048914 Bacteria 7788
427 Ga0496111_0007502 3300048914 Bacteria 7156
428 Ga0496112_0007983 3300048915 Bacteria 9440
429 Ga0496112_0081262 3300048915 Bacteria 3205
430 Ga0496112_0124921 3300048915 Bacteria 2544
431 Ga0496112_0226244 3300048915 Bacteria 1826
432 Ga0496113_0004852 3300048916 Bacteria 8326
433 Ga0496113_0063096 3300048916 Bacteria 2800
434 Ga0496113_0068817 3300048916 Bacteria 2687
435 Ga0496114_0011726 3300048917 Bacteria 7010
436 Ga0496114_0039978 3300048917 Bacteria 3881
437 Ga0496114_0044112 3300048917 Bacteria 3699
438 Ga0496114_0122911 3300048917 Bacteria 2234
439 Ga0501031_0009822 3300049568 Bacteria 6230
440 Ga0501031_0085377 3300049568 Bacteria 2058
441 Ga0501031_0187560 3300049568 Bacteria 1350
442 Ga0501032_0041117 3300049569 Bacteria 3141
443 Ga0501033_0005434 3300049570 Bacteria 10096
444 Ga0501033_0046194 3300049570 Bacteria 3238
445 Ga0501036_0036970 3300049572 Bacteria 4130
446 Ga0501036_0051223 3300049572 Bacteria 3495
447 Ga0501036_0149154 3300049572 Bacteria 1972
448 Ga0501036_0156589 3300049572 Bacteria 1921
449 Ga0501037_0021523 3300049573 Bacteria 4767
450 Ga0501037_0160372 3300049573 Bacteria 1603
451 Ga0501038_0003737 3300049574 Bacteria 14178
452 Ga0501039_0014193 3300049575 Bacteria 6100
453 Ga0501040_0007345 3300049576 Bacteria 7136
454 Ga0501040_0030962 3300049576 Bacteria 3616
455 Ga0501040_0045686 3300049576 Bacteria 2988
456 Ga0501040_0092983 3300049576 Bacteria 2097
457 Ga0501040_0144335 3300049576 Bacteria 1677
458 Ga0501041_0027860 3300049577 Bacteria 3406
459 Ga0501041_0066833 3300049577 Bacteria 2203
460 Ga0501042_0010195 3300049578 Bacteria 6288
461 Ga0501042_0049980 3300049578 Bacteria 2983
462 Ga0501042_0068364 3300049578 Bacteria 2540
463 Ga0501042_0075336 3300049578 Bacteria 2415
464 Ga0501043_0007479 3300049579 Bacteria 8675
465 Ga0501043_0016440 3300049579 Bacteria 5802
466 Ga0501043_0152960 3300049579 Unclassified 1805
467 Ga0501043_0233579 3300049579 Bacteria 1420
468 Ga0501046_0022302 3300049580 Bacteria 5216
469 Ga0501048_0028304 3300049582 Bacteria 4067
470 Ga0501048_0032440 3300049582 Bacteria 3774
471 Ga0501048_0056158 3300049582 Bacteria 2793
472 Ga0501048_0147180 3300049582 Bacteria 1666
473 Ga0501067_0004169 3300049583 Bacteria 7979
474 Ga0501067_0010372 3300049583 Bacteria 5156
475 Ga0501067_0041055 3300049583 Bacteria 2569
476 Ga0501067_0060891 3300049583 Bacteria 2089
477 Ga0501068_0004865 3300049584 Bacteria 7312
478 Ga0501068_0025109 3300049584 Bacteria 3504
479 Ga0501068_0025281 3300049584 Bacteria 3493
480 Ga0501069_0002821 3300049585 Bacteria 8892
481 Ga0501069_0012556 3300049585 Bacteria 4504
482 Ga0501069_0014427 3300049585 Bacteria 4226
483 Ga0501070_0007003 3300049586 Bacteria 9593
484 Ga0501070_0132811 3300049586 Bacteria 2056
485 Ga0501071_0002325 3300049587 Bacteria 11476
486 Ga0501071_0010384 3300049587 Bacteria 6238
487 Ga0501071_0011168 3300049587 Bacteria 6040
488 Ga0501071_0012666 3300049587 Bacteria 5731
489 Ga0501071_0039954 3300049587 Bacteria 3357
490 Ga0501071_0058026 3300049587 Bacteria 2798
491 Ga0501071_0142309 3300049587 Bacteria 1786
492 Ga0501072_0007874 3300049588 Bacteria 8093
493 Ga0501072_0023681 3300049588 Bacteria 4770
494 Ga0501072_0110742 3300049588 Bacteria 2185
495 Ga0501073_0033053 3300049589 Bacteria 3686
496 Ga0501073_0052586 3300049589 Bacteria 2852
497 Ga0501074_0021401 3300049590 Bacteria 4695
498 Ga0501074_0039761 3300049590 Bacteria 3406
499 Ga0501074_0094223 3300049590 Bacteria 2144
500 Ga0501075_0001592 3300049591 Bacteria 14848
501 Ga0501075_0031562 3300049591 Bacteria 3933
502 Ga0501075_0101581 3300049591 Bacteria 2184
503 Ga0501075_0189961 3300049591 Bacteria 1566
504 Ga0501076_0002064 3300049592 Bacteria 13763
505 Ga0501076_0004836 3300049592 Bacteria 9614
506 Ga0501076_0030951 3300049592 Bacteria 4170
507 Ga0501076_0031688 3300049592 Bacteria 4125
508 Ga0501076_0060129 3300049592 Bacteria 3022
509 Ga0501076_0087609 3300049592 Bacteria 2502
510 Ga0501076_0176335 3300049592 Bacteria 1742
511 Ga0501077_0018137 3300049593 Bacteria 4450
512 Ga0501077_0023245 3300049593 Bacteria 3930
513 Ga0501077_0023563 3300049593 Bacteria 3903
514 Ga0501077_0045877 3300049593 Bacteria 2776
515 Ga0501077_0127360 3300049593 Bacteria 1614
516 Ga0501079_0020024 3300049741 Bacteria 5111
517 Ga0501079_0229227 3300049741 Bacteria 1451
518 Ga0501079_0339279 3300049741 Bacteria 1177
519 Ga0501080_0019936 3300049742 Bacteria 6209
520 Ga0501080_0117783 3300049742 Bacteria 2462
521 Ga0501080_0164025 3300049742 Bacteria 2051
522 Ga0501080_0168527 3300049742 Bacteria 2020
523 Ga0501081_0030600 3300049743 Bacteria 3644
524 Ga0501081_0062813 3300049743 Bacteria 2576
525 Ga0501083_0012424 3300049744 Bacteria 5957
526 Ga0501083_0069221 3300049744 Bacteria 2348
527 Ga0501083_0106427 3300049744 Unclassified 1846
528 Ga0501035_0091620 3300049822 Bacteria 2675
529 Ga0501044_0017178 3300049823 Bacteria 7763
530 Ga0501045_0015163 3300049824 Bacteria 5470
531 Ga0501045_0025365 3300049824 Bacteria 4261
532 Ga0501045_0036219 3300049824 Bacteria 3583
533 Ga0501045_0042694 3300049824 Bacteria 3301
534 Ga0501045_0118920 3300049824 Bacteria 1961
535 nmdc:mga05p37_102762_c1 3300050507 Bacteria 3519
536 nmdc:mga05p37_155157_c1 3300050507 Bacteria 2798
537 nmdc:mga05p37_160783_c1 3300050507 Bacteria 2743
538 nmdc:mga05p37_251975_c1 3300050507 Bacteria 2117
539 nmdc:mga08y16_62329_c1 3300050511 Bacteria 3894
540 nmdc:mga0a205_42610_c1 3300050515 Bacteria 4374
541 Ga0495595_0004398 3300053084 Bacteria 5670
542 Ga0495595_0060272 3300053084 Bacteria 1776
543 Ga0495619_0012872 3300053085 Bacteria 5269
544 Ga0501084_0053854 3300054114 Bacteria 3365
545 Ga0501084_0129581 3300054114 Unclassified 2123
546 Ga0501084_0140193 3300054114 Bacteria 2036
547 Ga0501082_0033476 3300060353 Bacteria 4435
548 Ga0501082_0058686 3300060353 Bacteria 3315
549 Ga0501082_0086279 3300060353 Bacteria 2707
550 Ga0501082_0100855 3300060353 Bacteria 2497
551 Ga0466962_0000151 3300061719 Bacteria 28962
552 Ga0466962_0010042 3300061719 Bacteria 4543
553 Ga0466962_0051241 3300061719 Bacteria 1973
554 Ga0530510_0002244 3300061734 Bacteria 13248
555 Ga0530510_0005747 3300061734 Bacteria 8594
556 Ga0530510_0037459 3300061734 Bacteria 3498
557 Ga0530510_0042803 3300061734 Bacteria 3271
558 Ga0530510_0055486 3300061734 Bacteria 2862
559 JGI24743J22301_10002067
560 JGI25406J46586_10004658
561 Ga0070658_10030921
562 Ga0070658_10057541
563 Ga0070683_100007306
564 Ga0070683_100070979
565 Ga0070683_100086885
566 Ga0070683_100098898
567 Ga0070683_100120632
568 Ga0070683_100150352
569 Ga0070690_100110773
570 Ga0070690_100161313
571 Ga0068869_100052405
572 Ga0070680_100003887
573 Ga0070680_100113342
574 Ga0070682_100025460
575 Ga0068868_100020777
576 Ga0068868_100033651
577 Ga0070660_100034889
578 Ga0070660_100243680
579 Ga0070689_100041891
580 Ga0070689_100110725
581 Ga0070687_100020825
582 Ga0070661_100034863
583 Ga0070661_100126782
584 Ga0070668_100256872
585 Ga0070675_100010430
586 Ga0070671_100112536
587 Ga0070671_100303043
588 Ga0070674_100018352
589 Ga0070674_100026430
590 Ga0070674_100038109
591 Ga0070674_100064905
592 Ga0070673_100005514
593 Ga0070673_100098522
594 Ga0070688_100010734
595 Ga0070688_100011110
596 Ga0070688_100233999
597 Ga0070659_100026443
598 Ga0070659_100065295
599 Ga0070659_100119529
600 Ga0070659_100163545
601 Ga0070714_100154826
602 Ga0070710_10118907
603 Ga0070701_10040764
604 Ga0070711_100034918
605 Ga0070700_100011552
606 Ga0070700_100020244
607 Ga0070694_100101700
608 Ga0070708_100110409
609 Ga0070663_100010916
610 Ga0070663_100195650
611 Ga0070678_100033754
612 Ga0070662_100027360
613 Ga0070662_100074801
614 Ga0070662_100147894
615 Ga0070681_10000439
616 Ga0070681_10097491
617 Ga0068867_100023308
618 Ga0068867_100037625
619 Ga0070685_10004616
620 Ga0070685_10054988
621 Ga0070706_100082484
622 Ga0070706_100145139
623 Ga0070698_100262188
624 Ga0070679_100033516
625 Ga0070679_100071912
626 Ga0070679_100109472
627 Ga0070679_100120760
628 Ga0070679_100192752
629 Ga0070679_100238204
630 Ga0070684_100002364
631 Ga0070684_100013798
632 Ga0070684_100016695
633 Ga0070684_100031766
634 Ga0070684_100035250
635 Ga0070684_100047073
636 Ga0070684_100196719
637 Ga0070684_100345306
638 Ga0068853_100017451
639 Ga0068853_100026345
640 Ga0070672_100048666
641 Ga0070672_100122162
642 Ga0070686_100023956
643 Ga0070686_100059845
644 Ga0070696_100064224
645 Ga0070693_100027461
646 Ga0070693_100060764
647 Ga0070665_100014467
648 Ga0070704_100314022
649 Ga0068855_100105200
650 Ga0070664_100022167
651 Ga0070664_100225467
652 Ga0068857_100173865
653 Ga0068854_100001862
654 Ga0068854_100022281
655 Ga0068854_100250901
656 Ga0070702_100129311
657 Ga0068852_100080538
658 Ga0068852_100154982
659 Ga0068852_100193418
660 Ga0068859_100054747
661 Ga0068859_100462148
662 Ga0068864_100074081
663 Ga0068864_100082771
664 Ga0068861_100072548
665 Ga0068870_10030264
666 Ga0068870_10039266
667 Ga0068858_100012580
668 Ga0068858_100109485
669 Ga0068862_100226628
670 Ga0081455_10029594
671 Ga0081455_10036443
672 Ga0081539_10000583
673 Ga0075364_10111436
674 Ga0075432_10001278
675 Ga0075367_10096715
676 Ga0097621_100033505
677 Ga0068871_100079406
678 Ga0075428_100020693
679 Ga0075431_100091956
680 Ga0075431_100349433
681 Ga0075433_10072992
682 Ga0075434_100063374
683 Ga0075434_100182565
684 Ga0075429_100015563
685 Ga0068865_100030733
686 Ga0068865_100131346
687 Ga0097620_100054747
688 Ga0097620_100462177
689 Ga0075435_100041348
690 Ga0105240_10240043
691 Ga0111539_10037483
692 Ga0111539_10058742
693 Ga0111539_10071686
694 Ga0111539_10075632
695 Ga0111539_10348672
696 Ga0105245_10018625
697 Ga0105245_10036618
698 Ga0105245_10079502
699 Ga0114129_10077520
700 Ga0114129_10116591
701 Ga0114129_10139684
702 Ga0114129_10173871
703 Ga0105243_10004065
704 Ga0105243_10017099
705 Ga0105243_10095562
706 Ga0105243_10205176
707 Ga0105241_10247209
708 Ga0105242_10022173
709 Ga0105242_10033955
710 Ga0105242_10186365
711 Ga0105248_10135171
712 Ga0105248_10167073
713 Ga0105238_10043673
714 Ga0105238_10086448
715 Ga0105238_10204168
716 Ga0105238_10205612
717 Ga0105239_10014824
718 Ga0105239_10045470
719 Ga0105239_10429064
720 Ga0105246_10056646
721 Ga0105246_10088802
722 Ga0157373_10121763
723 Ga0157371_10029851
724 Ga0157370_10010483
725 Ga0157370_10047419
726 Ga0157370_10052939
727 Ga0157370_10064026
728 Ga0157370_10096457
729 Ga0157369_10015605
730 Ga0157369_10019994
731 Ga0157369_10052189
732 Ga0157369_10196115
733 Ga0157378_10196124
734 Ga0157372_10003616
735 Ga0157372_10058008
736 Ga0157372_10253472
737 Ga0163163_10019643
738 Ga0157380_10028135
739 Ga0157380_10090376
740 Ga0157380_10174132
741 Ga0157377_10000638
742 Ga0157377_10020257
743 Ga0157379_10045042
744 Ga0157376_10020539
745 Ga0157376_10044044
746 Ga0157376_10139095
747 Ga0206354_10377492
748 Ga0206353_11314004
749 Ga0207710_10044852
750 Ga0207688_10001628
751 Ga0207688_10009247
752 Ga0207685_10046161
753 Ga0207643_10005084
754 Ga0207643_10008227
755 Ga0207643_10016074
756 Ga0207705_10028235
757 Ga0207705_10160867
758 Ga0207707_10011116
759 Ga0207707_10013132
760 Ga0207707_10016197
761 Ga0207695_10144939
762 Ga0207695_10270782
763 Ga0207671_10051571
764 Ga0207693_10001465
765 Ga0207693_10094625
766 Ga0207660_10027225
767 Ga0207660_10120749
768 Ga0207660_10149343
769 Ga0207662_10007456
770 Ga0207657_10003061
771 Ga0207657_10013668
772 Ga0207657_10110627
773 Ga0207649_10078133
774 Ga0207649_10145668
775 Ga0207652_10002381
776 Ga0207652_10210463
777 Ga0207681_10050969
778 Ga0207694_10179402
779 Ga0207650_10063648
780 Ga0207659_10103369
781 Ga0207687_10025471
782 Ga0207687_10038906
783 Ga0207690_10190072
784 Ga0207706_10089146
785 Ga0207706_10093417
786 Ga0207706_10117082
787 Ga0207686_10003756
788 Ga0207686_10034766
789 Ga0207686_10132172
790 Ga0207709_10024488
791 Ga0207709_10031379
792 Ga0207669_10036009
793 Ga0207669_10045325
794 Ga0207669_10235832
795 Ga0207689_10133342
796 Ga0207689_10253418
797 Ga0207661_10003615
798 Ga0207661_10027177
799 Ga0207661_10031482
800 Ga0207661_10120832
801 Ga0207679_10265528
802 Ga0207667_10133589
803 Ga0207667_10217383
804 Ga0207668_10029924
805 Ga0207668_10272541
806 Ga0207640_10008532
807 Ga0207640_10131175
808 Ga0207677_10162021
809 Ga0207677_10280753
810 Ga0207703_10178521
811 Ga0207639_10053872
812 Ga0207639_10152884
813 Ga0207678_10024488
814 Ga0207708_10004461
815 Ga0207708_10020293
816 Ga0207708_10035830
817 Ga0207702_10126885
818 Ga0207702_10168437
819 Ga0207702_10264066
820 Ga0207648_10018548
821 Ga0207648_10038231
822 Ga0207648_10062869
823 Ga0207676_10067360
824 Ga0207676_10184208
825 Ga0207676_10392485
826 Ga0207674_10144380
827 Ga0207675_100123580
828 Ga0207683_10020432
829 Ga0207683_10022853
830 Ga0207683_10066567
831 Ga0207698_10160010
832 Ga0207698_10186602
833 Ga0207428_10000383
834 Ga0207428_10027889
835 Ga0207428_10059391
836 Ga0207428_10096739
837 Ga0268266_10027290
838 Ga0265334_10055762
839 Ga0265318_10001979
840 Ga0265318_10044062
841 Ga0265338_10005756
842 Ga0265330_10008853
843 Ga0265330_10026909
844 Ga0265332_10022893
845 Ga0265328_10006752
846 Ga0265325_10009312
847 Ga0265329_10005245
848 Ga0265340_10011154
849 Ga0265339_10008421
850 Ga0265339_10048985
851 Ga0265331_10073606
852 Ga0265327_10010204
853 Ga0265327_10014050
854 Ga0265327_10016526
855 Ga0265316_10007432
856 Ga0265316_10025960
857 Ga0265313_10003939
858 Ga0265313_10021955
859 Ga0265313_10023158
860 Ga0265314_10001460
861 Ga0265314_10006337
862 Ga0265342_10010550
863 Ga0265342_10022846
864 Ga0373955_0093056
865 Ga0395899_0001088
866 Ga0395899_0017717
867 Ga0395900_0072729
868 Ga0395900_0079324
869 Ga0395900_0191971
870 Ga0395898_0010060
871 Ga0395898_0015599
872 Ga0395898_0023861
873 Ga0395898_0130463
874 Ga0395898_0164965
875 Ga0395905_0193122
876 Ga0395901_0001814
877 Ga0395901_0008468
878 Ga0395901_0013617
879 Ga0395901_0020443
880 Ga0395901_0383857
881 Ga0466969_0084976
882 Ga0466966_0046342
883 Ga0466961_0001452
884 Ga0466961_0023672
885 Ga0466961_0068211
886 Ga0466963_0000133
887 Ga0466963_0001891
888 Ga0466963_0066261
889 Ga0466963_0085961
890 Ga0466964_0008448
891 Ga0466964_0022930
892 Ga0466964_0029243
893 Ga0466971_0000495
894 Ga0466957_0000762
895 Ga0466957_0011807
896 Ga0466959_0022219
897 Ga0466959_0052648
898 Ga0451576_0035357
899 Ga0466958_0000461
900 Ga0466958_0000927
901 Ga0466967_0000172
902 Ga0466967_0000451
903 Ga0466967_0002499
904 Ga0466967_0007784
905 Ga0466967_0049268
906 Ga0466967_0064046
907 Ga0466967_0101295
908 Ga0466967_0114706
909 Ga0466967_0151346
910 Ga0466967_0182379
911 Ga0466967_0258403
912 Ga0466967_0357612
913 Ga0495592_0011664
914 Ga0495592_0035136
915 Ga0495603_0073810
916 Ga0495641_0012995
917 Ga0495651_0003210
918 Ga0495651_0078284
919 Ga0495594_0052473
920 Ga0495608_0011318
921 Ga0495608_0012683
922 Ga0495628_0003449
923 Ga0495644_0043274
924 Ga0495652_0016239
925 Ga0495640_0003136
926 Ga0495587_0059986
927 Ga0495667_0006363
928 Ga0495667_0010779
929 Ga0495667_0053993
930 Ga0495667_0062853
931 Ga0495657_0014943
932 Ga0495624_0071062
933 Ga0495604_0006748
934 Ga0495604_0174149
935 Ga0495674_0003880
936 Ga0495674_0106129
937 Ga0495680_0001771
938 Ga0495680_0003001
939 Ga0495680_0007898
940 Ga0495680_0038925
941 Ga0495684_0002893
942 Ga0495684_0082570
943 Ga0496100_0006542
944 Ga0496100_0017704
945 Ga0496100_0072176
946 Ga0496100_0079784
947 Ga0496101_0001986
948 Ga0496101_0003856
949 Ga0496101_0010971
950 Ga0496101_0030753
951 Ga0496102_0036354
952 Ga0496102_0040876
953 Ga0496102_0149627
954 Ga0496104_0098112
955 Ga0496104_0143885
956 Ga0496104_0240928
957 Ga0496104_0279384
958 Ga0496105_0004716
959 Ga0496105_0043320
960 Ga0496105_0118131
961 Ga0496105_0213595
962 Ga0496106_0027294
963 Ga0496106_0098307
964 Ga0496107_0004071
965 Ga0496107_0009866
966 Ga0496107_0043402
967 Ga0496108_0000898
968 Ga0496108_0002746
969 Ga0496108_0003822
970 Ga0496108_0051823
971 Ga0496109_0001492
972 Ga0496109_0011956
973 Ga0496109_0025711
974 Ga0496109_0084797
975 Ga0496109_0093331
976 Ga0496109_0117435
977 Ga0496110_0002155
978 Ga0496110_0004580
979 Ga0496110_0010795
980 Ga0496110_0072127
981 Ga0496110_0114177
982 Ga0496111_0000986
983 Ga0496111_0003480
984 Ga0496111_0006116
985 Ga0496111_0007502
986 Ga0496112_0007983
987 Ga0496112_0081262
988 Ga0496112_0124921
989 Ga0496112_0226244
990 Ga0496113_0004852
991 Ga0496113_0063096
992 Ga0496113_0068817
993 Ga0496114_0011726
994 Ga0496114_0039978
995 Ga0496114_0044112
996 Ga0496114_0122911
997 Ga0501031_0009822
998 Ga0501031_0085377
999 Ga0501031_0187560
1000 Ga0501032_0041117
1001 Ga0501033_0005434
1002 Ga0501033_0046194
1003 Ga0501036_0036970
1004 Ga0501036_0051223
1005 Ga0501036_0149154
1006 Ga0501036_0156589
1007 Ga0501037_0021523
1008 Ga0501037_0160372
1009 Ga0501038_0003737
1010 Ga0501039_0014193
1011 Ga0501040_0007345
1012 Ga0501040_0030962
1013 Ga0501040_0045686
1014 Ga0501040_0092983
1015 Ga0501040_0144335
1016 Ga0501041_0027860
1017 Ga0501041_0066833
1018 Ga0501042_0010195
1019 Ga0501042_0049980
1020 Ga0501042_0068364
1021 Ga0501042_0075336
1022 Ga0501043_0007479
1023 Ga0501043_0016440
1024 Ga0501043_0152960
1025 Ga0501043_0233579
1026 Ga0501046_0022302
1027 Ga0501048_0028304
1028 Ga0501048_0032440
1029 Ga0501048_0056158
1030 Ga0501048_0147180
1031 Ga0501067_0004169
1032 Ga0501067_0010372
1033 Ga0501067_0041055
1034 Ga0501067_0060891
1035 Ga0501068_0004865
1036 Ga0501068_0025109
1037 Ga0501068_0025281
1038 Ga0501069_0002821
1039 Ga0501069_0012556
1040 Ga0501069_0014427
1041 Ga0501070_0007003
1042 Ga0501070_0132811
1043 Ga0501071_0002325
1044 Ga0501071_0010384
1045 Ga0501071_0011168
1046 Ga0501071_0012666
1047 Ga0501071_0039954
1048 Ga0501071_0058026
1049 Ga0501071_0142309
1050 Ga0501072_0007874
1051 Ga0501072_0023681
1052 Ga0501072_0110742
1053 Ga0501073_0033053
1054 Ga0501073_0052586
1055 Ga0501074_0021401
1056 Ga0501074_0039761
1057 Ga0501074_0094223
1058 Ga0501075_0001592
1059 Ga0501075_0031562
1060 Ga0501075_0101581
1061 Ga0501075_0189961
1062 Ga0501076_0002064
1063 Ga0501076_0004836
1064 Ga0501076_0030951
1065 Ga0501076_0031688
1066 Ga0501076_0060129
1067 Ga0501076_0087609
1068 Ga0501076_0176335
1069 Ga0501077_0018137
1070 Ga0501077_0023245
1071 Ga0501077_0023563
1072 Ga0501077_0045877
1073 Ga0501077_0127360
1074 Ga0501079_0020024
1075 Ga0501079_0229227
1076 Ga0501079_0339279
1077 Ga0501080_0019936
1078 Ga0501080_0117783
1079 Ga0501080_0164025
1080 Ga0501080_0168527
1081 Ga0501081_0030600
1082 Ga0501081_0062813
1083 Ga0501083_0012424
1084 Ga0501083_0069221
1085 Ga0501083_0106427
1086 Ga0501035_0091620
1087 Ga0501044_0017178
1088 Ga0501045_0015163
1089 Ga0501045_0025365
1090 Ga0501045_0036219
1091 Ga0501045_0042694
1092 Ga0501045_0118920
1093 nmdc:mga05p37_102762_c1
1094 nmdc:mga05p37_155157_c1
1095 nmdc:mga05p37_160783_c1
1096 nmdc:mga05p37_251975_c1
1097 nmdc:mga08y16_62329_c1
1098 nmdc:mga0a205_42610_c1
1099 Ga0495595_0004398
1100 Ga0495595_0060272
1101 Ga0495619_0012872
1102 Ga0501084_0053854
1103 Ga0501084_0129581
1104 Ga0501084_0140193
1105 Ga0501082_0033476
1106 Ga0501082_0058686
1107 Ga0501082_0086279
1108 Ga0501082_0100855
1109 Ga0466962_0000151
1110 Ga0466962_0010042
1111 Ga0466962_0051241
1112 Ga0530510_0002244
1113 Ga0530510_0005747
1114 Ga0530510_0037459
1115 Ga0530510_0042803
1116 Ga0530510_0055486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

13

331

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.8475 4 374
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8425 9 376
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.8413 4 376
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8281 9 374
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.8271 4 374
ID Description Score Start End Superfamily
af_O01735_368_566_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.931 207 377 1.20.1250.20
af_Q5RGT2_295_489_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9256 204 377 1.20.1250.20
af_P33026_213_392_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9206 203 378 1.20.1250.20
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9188 205 383 1.20.1250.20
af_P31436_213_393_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9141 203 378 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7W0MZI9-F1-model_v4 MFS transporter 0.9561 4 264 GO:0005886
GO:0022857
AF-A0A538J3Q6-F1-model_v4 MFS transporter 0.9466 1 377 GO:0005886
GO:0022857
AF-A0A7W0MZI9-F1-model_v4 MFS transporter 0.9455 4 264 GO:0005886
GO:0022857
AF-A0A7K1L4Q4-F1-model_v4 MFS transporter 0.9429 10 382 GO:0005886
GO:0022857
AF-A0A2H5UX70-F1-model_v4 Fosmidomycin resistance protein 0.934 8 376 GO:0005886
GO:0022857

Map