metagRoot

F463267

General Info

Members	Datasets	Scaffolds	Average Seq Length
556	317	473	291

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2977971508\|2977971968
Length	332
Sequence	RNSFFIKILLRNQMGDCESDKYLISYKLSSKMKSWESRSMPNPPTPSDIALRPDDEQIALLRDKAEFIRLETLRLIQIAKVGHYSSVFSCAEIFATLYYDAMRLKRGEPQWPDRDRFLMGKGHAAVGLYPLLVDWGFFSKDILDGYTRLGNPLGDHPDMRKVPGVDFSSGSIGHALSAGLGMTLGCRAADRQFDVYVLLGDGEMQEGQVWEAALSAAHHKAGNLIAIVDRNGYQLDGQVDDIIGIEPLTDKWAAFGWQVHEVDGHDVAALATLLRQLKAETNRTRPVCIIAKTSKGKGVGYMETEPGWHLGYLAPSDEALAADEIKRGGKAQ

Samples

	Sample ID	Description	Type	Environment
1	2501025502	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
2	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
3	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
4	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
5	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
6	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
7	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
8	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
9	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
10	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
11	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
12	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
13	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
14	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
15	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
16	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
17	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
18	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
19	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
20	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
21	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
22	2622736626	Micromonospora rhizosphaerae DSM 45431	Isolate	Rhizosphere
23	2643221557	Ensifer sp. Root558	Isolate	Unclassified
24	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
25	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
26	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
27	2643221668	Ensifer sp. Root423	Isolate	Unclassified
28	2643221723	Ensifer sp. Root278	Isolate	Unclassified
29	2693429783	Mesorhizobium sp. LCM 4577	Isolate	Rhizosphere
30	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
31	2773857763	Microbacterium sp. SAI-030	Isolate	Unclassified
32	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
33	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
34	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
35	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
36	2834578030	Paracoccus thiocyanatus SST	Isolate	Unclassified
37	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
38	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
39	2852677369	Pseudoclavibacter sp. JAI123	Isolate	Rhizosphere
40	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
41	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
42	2858950400	Achromobacter sp. K91	Isolate	Unclassified
43	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
44	2876377896	Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1	Isolate	Nodule
45	2888343758	Mesorhizobium sp. AA22	Isolate	Unclassified
46	2889010040	Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1	Isolate	Nodule
47	2889914905	Chelativorans alearense UJN715	Isolate	Rhizosphere
48	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
49	2906354277	Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1	Isolate	Nodule
50	2917699015	Bosea sp. F3-2	Isolate	Rhizosphere
51	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
52	2922185730	Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	Isolate	Nodule
53	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
54	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
55	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
56	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
57	2938014810	Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1	Isolate	Nodule
58	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
59	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
60	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
61	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
62	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
63	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
64	2977971508	Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1	Isolate	Nodule
65	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
66	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
67	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
68	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
69	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
70	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
71	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
72	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
73	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
74	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
75	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
76	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
77	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
78	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
79	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
80	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
81	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
82	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
83	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
84	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
85	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
86	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
87	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
88	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
89	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
90	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
91	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
92	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
93	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
94	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
95	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
96	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
97	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
98	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
99	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
100	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
101	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
102	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
103	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
104	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
105	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
106	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
107	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
108	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
109	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
110	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
111	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
112	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
113	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
114	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
115	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
116	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
117	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
118	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
119	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
120	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
121	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
122	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
123	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
124	3300013250	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05	Metagenome	Rhizosphere
125	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
126	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
127	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
128	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
129	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
130	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
131	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
132	3300015684	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02	Metagenome	Unclassified
133	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
134	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
135	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
136	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
137	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
148	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
151	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
152	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
154	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
180	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
184	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
185	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
186	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
187	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
188	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
189	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
190	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
191	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
192	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
193	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
194	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
195	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
196	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
197	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
198	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
199	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
200	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
201	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
202	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
203	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
204	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
205	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
206	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
207	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
208	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
209	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
210	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
211	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
212	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
213	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
214	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
215	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
216	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
217	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
218	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
219	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
220	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
221	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
222	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
223	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
224	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
225	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
226	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
227	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
228	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
229	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
230	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
231	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
232	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
233	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
234	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
235	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
236	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
237	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
238	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
239	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
240	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
241	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
242	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
243	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
244	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
245	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
246	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
247	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
248	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
249	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
250	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
251	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
252	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
253	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
254	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
255	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
256	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
257	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
258	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
259	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
260	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
261	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
262	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
263	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
264	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
265	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
266	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
267	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
268	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
269	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
270	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
271	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
272	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
273	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
274	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
275	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
276	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
277	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
278	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
279	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
280	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
281	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
282	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
283	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
284	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
285	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
286	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
287	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
288	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
289	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
290	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
291	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
292	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
293	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
294	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
295	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
296	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
297	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
298	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
299	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
300	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
301	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
302	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
303	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
304	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
305	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
306	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
307	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
308	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
309	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
310	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
311	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
312	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule
313	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
314	8054002106	Azospirillum lipoferum 59b	Isolate	Unclassified
315	8055034563	Leucobacter allii H21R-40	Isolate	Rhizosphere
316	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
317	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	85.97
Metatranscriptomes	0
Isolates	14.03

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.15
Nodule	6.12
Rhizoplane	5.58
Rhizosphere	64.21
Stem	0
Stem Tuber	0
Unclassified	12.95

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25159J45721_1000042	3300002987	Bacteria	65091
2	JGI25151J46595_10012460	3300003187	Bacteria	3866
3	JGI25165J46597_1000034	3300003214	Bacteria	292458
4	JGI25160J50197_1000139	3300003354	Bacteria	65091
5	JGI25161J50226_1000837	3300003374	Bacteria	11505
6	Ga0055532_1000287	3300003758	Bacteria	32158
7	Ga0055527_1000193	3300003760	Bacteria	40712
8	Ga0055535_1000401	3300003761	Bacteria	40712
9	Ga0055542_1001329	3300003762	Bacteria	12922
10	Ga0055529_1001541	3300003763	Bacteria	6571
11	Ga0055524_1000604	3300003775	Bacteria	25776
12	Ga0055524_1002447	3300003775	Bacteria	9554
13	Ga0055536_1028900	3300003781	Bacteria	1500
14	Ga0055528_1000637	3300003790	Bacteria	25718
15	Ga0055530_10005549	3300003791	Bacteria	5953
16	Ga0055530_10044301	3300003791	Bacteria	1068
17	Ga0055541_1004899	3300003841	Bacteria	2388
18	Ga0055543_1000268	3300004625	Bacteria	38841
19	Ga0065165_1000443	3300005262	Bacteria	65129
20	Ga0065714_10064524	3300005288	Bacteria	41924
21	Ga0065704_10163562	3300005289	Bacteria	1338
22	Ga0070670_100000097	3300005331	Bacteria	81485
23	Ga0070660_100000019	3300005339	Bacteria	99607
24	Ga0070668_100000312	3300005347	Bacteria	32059
25	Ga0070668_100006759	3300005347	Bacteria	8502
26	Ga0070668_100134617	3300005347	Bacteria	1986
27	Ga0070659_100000012	3300005366	Bacteria	180004
28	Ga0070667_100000169	3300005367	Bacteria	81539
29	Ga0070681_10379035	3300005458	Bacteria	1325
30	Ga0070685_10237889	3300005466	Bacteria	1201
31	Ga0068853_100017999	3300005539	Bacteria	5840
32	Ga0070665_100000610	3300005548	Bacteria	49084
33	Ga0068855_100698277	3300005563	Bacteria	1086
34	Ga0068852_100080376	3300005616	Bacteria	2890
35	Ga0068859_100060114	3300005617	Bacteria	3829
36	Ga0068864_100294320	3300005618	Bacteria	1518
37	Ga0068861_100195231	3300005719	Bacteria	1695
38	Ga0068863_100000185	3300005841	Bacteria	66169
39	Ga0068863_100034823	3300005841	Bacteria	4795
40	Ga0068858_100008637	3300005842	Bacteria	9782
41	Ga0068858_100139409	3300005842	Bacteria	2276
42	Ga0068860_100000211	3300005843	Bacteria	91286
43	Ga0068862_100000514	3300005844	Bacteria	41173
44	Ga0075364_10000118	3300006051	Bacteria	32819
45	Ga0070716_100229692	3300006173	Bacteria	1252
46	Ga0075370_10189900	3300006353	Bacteria	1210
47	Ga0075434_100013855	3300006871	Bacteria	7691
48	Ga0097620_100060110	3300006931	Bacteria	3829
49	Ga0079104_1000693	3300006946	Bacteria	30756
50	Ga0105251_10008446	3300009011	Bacteria	6197
51	Ga0105244_10001460	3300009036	Bacteria	19075
52	Ga0105244_10017137	3300009036	Bacteria	4104
53	Ga0105250_10002161	3300009092	Bacteria	10094
54	Ga0105250_10004853	3300009092	Bacteria	6116
55	Ga0105247_10145262	3300009101	Bacteria	1558
56	Ga0105242_10078858	3300009176	Bacteria	2749
57	Ga0105248_10064649	3300009177	Bacteria	4107
58	Ga0105237_10003361	3300009545	Bacteria	19048
59	Ga0105237_10005925	3300009545	Bacteria	13707
60	Ga0105238_10002329	3300009551	Bacteria	19107
61	Ga0105238_10004487	3300009551	Bacteria	13831
62	Ga0105238_10019812	3300009551	Bacteria	6848
63	Ga0105249_10000855	3300009553	Bacteria	27177
64	Ga0105239_10001477	3300010375	Bacteria	31257
65	Ga0105239_10022510	3300010375	Bacteria	6948
66	Ga0157373_10000173	3300013100	Bacteria	52678
67	Ga0157371_10000084	3300013102	Bacteria	149557
68	Ga0157370_10004581	3300013104	Bacteria	15828
69	Ga0157369_10003281	3300013105	Bacteria	19267
70	Ga0157369_10081574	3300013105	Bacteria	3461
71	Ga0157369_10101267	3300013105	Bacteria	3070
72	Ga0171463_1002	3300013249	Bacteria	1274851
73	Ga0171462_1029	3300013250	Bacteria	110139
74	Ga0157375_10006979	3300013308	Bacteria	9864
75	Ga0163163_10250312	3300014325	Bacteria	1822
76	Ga0182008_10000401	3300014497	Bacteria	33522
77	Ga0182008_10000806	3300014497	Bacteria	21928
78	Ga0182008_10001539	3300014497	Bacteria	15338
79	Ga0182008_10003476	3300014497	Bacteria	9502
80	Ga0182008_10015968	3300014497	Bacteria	3909
81	Ga0182008_10022982	3300014497	Bacteria	3190
82	Ga0182008_10036717	3300014497	Bacteria	2451
83	Ga0157379_10042615	3300014968	Bacteria	4052
84	Ga0182006_1002540	3300015261	Bacteria	9906
85	Ga0182006_1008622	3300015261	Bacteria	4618
86	Ga0182007_10000263	3300015262	Bacteria	35043
87	Ga0182007_10000547	3300015262	Bacteria	22177
88	Ga0182007_10007769	3300015262	Bacteria	4459
89	Ga0182007_10016817	3300015262	Bacteria	2688
90	Ga0182005_1000508	3300015265	Bacteria	19922
91	Ga0182005_1000555	3300015265	Bacteria	18723
92	Ga0182005_1004160	3300015265	Bacteria	4731
93	Ga0183365_10066	3300015684	Bacteria	2421
94	Ga0183363_1075	3300015690	Bacteria	29742
95	Ga0163161_10002029	3300017792	Bacteria	14663
96	Ga0163161_10005559	3300017792	Bacteria	8733
97	Ga0163161_10042114	3300017792	Bacteria	3283
98	Ga0228711_1006984	3300022739	Bacteria	16561
99	Ga0228710_1002664	3300022740	Bacteria	28275
100	Ga0209436_100065	3300025208	Bacteria	54858
101	Ga0209566_100243	3300025225	Bacteria	52362
102	Ga0209674_101231	3300025226	Bacteria	7267
103	Ga0209672_100059	3300025228	Bacteria	209692
104	Ga0209147_100072	3300025229	Bacteria	209692
105	Ga0209563_100227	3300025230	Bacteria	27902
106	Ga0209258_100102	3300025242	Bacteria	209692
107	Ga0209148_1000916	3300025254	Bacteria	19824
108	Ga0209233_1000028	3300025261	Bacteria	642062
109	Ga0209233_1018275	3300025261	Bacteria	1890
110	Ga0209455_1000375	3300025272	Bacteria	40764
111	Ga0209673_1000965	3300025273	Bacteria	35667
112	Ga0209130_1000115	3300025284	Bacteria	129623
113	Ga0209676_1001168	3300025292	Bacteria	28452
114	Ga0209676_1001421	3300025292	Bacteria	22726
115	Ga0209676_1003721	3300025292	Bacteria	9073
116	Ga0209676_1003837	3300025292	Bacteria	8832
117	Ga0209025_1000026	3300025294	Bacteria	519850
118	Ga0209025_1000079	3300025294	Bacteria	270973
119	Ga0209025_1000470	3300025294	Bacteria	78526
120	Ga0209564_1000682	3300025295	Bacteria	50102
121	Ga0209050_1000155	3300025298	Bacteria	159095
122	Ga0209050_1001226	3300025298	Bacteria	29774
123	Ga0209050_1005171	3300025298	Bacteria	8357
124	Ga0209050_1015319	3300025298	Bacteria	3227
125	Ga0209256_1000286	3300025299	Bacteria	88880
126	Ga0209256_1000357	3300025299	Bacteria	74660
127	Ga0207426_1000226	3300025302	Bacteria	129623
128	Ga0209051_1004027	3300025303	Bacteria	9296
129	Ga0209051_1012849	3300025303	Bacteria	4025
130	Ga0209051_1045028	3300025303	Bacteria	1531
131	Ga0209257_1007792	3300025304	Bacteria	6350
132	Ga0207696_1000784	3300025711	Bacteria	20866
133	Ga0207655_1000445	3300025728	Bacteria	54522
134	Ga0207713_1002802	3300025735	Bacteria	12305
135	Ga0207647_10018890	3300025904	Bacteria	4646
136	Ga0207707_10231166	3300025912	Bacteria	1609
137	Ga0207695_10267335	3300025913	Bacteria	1606
138	Ga0207671_10004094	3300025914	Bacteria	14112
139	Ga0207671_10320925	3300025914	Bacteria	1226
140	Ga0207657_10000013	3300025919	Bacteria	180080
141	Ga0207694_10012896	3300025924	Bacteria	6293
142	Ga0207694_10090826	3300025924	Bacteria	2410
143	Ga0207650_10000160	3300025925	Bacteria	81491
144	Ga0207687_10175779	3300025927	Bacteria	1655
145	Ga0207690_10000048	3300025932	Bacteria	114048
146	Ga0207665_10038804	3300025939	Bacteria	3173
147	Ga0207711_10061917	3300025941	Bacteria	3227
148	Ga0207712_10000203	3300025961	Bacteria	59867
149	Ga0207668_10000414	3300025972	Bacteria	26930
150	Ga0207668_10002809	3300025972	Bacteria	10182
151	Ga0207668_10214484	3300025972	Bacteria	1541
152	Ga0207658_10000341	3300025986	Bacteria	46166
153	Ga0207703_10006632	3300026035	Bacteria	9235
154	Ga0207703_10381796	3300026035	Bacteria	1303
155	Ga0207639_10014389	3300026041	Bacteria	5565
156	Ga0207641_10001171	3300026088	Bacteria	26343
157	Ga0207676_10365325	3300026095	Bacteria	1339
158	Ga0207675_100142053	3300026118	Bacteria	2281
159	Ga0209281_1000766	3300027111	Bacteria	30770
160	Ga0268266_10002265	3300028379	Bacteria	20936
161	Ga0268266_10431235	3300028379	Bacteria	1251
162	Ga0268265_10000779	3300028380	Bacteria	30604
163	Ga0268264_10000270	3300028381	Bacteria	90954
164	Ga0265338_10010503	3300028800	Bacteria	10841
165	Ga0307408_100063379	3300031548	Bacteria	2704
166	Ga0307413_10052714	3300031824	Bacteria	2459
167	Ga0307410_10016458	3300031852	Bacteria	4411
168	Ga0307406_10000335	3300031901	Bacteria	27323
169	Ga0307407_10189679	3300031903	Bacteria	1369
170	Ga0307412_10000199	3300031911	Bacteria	41000
171	Ga0307409_100106844	3300031995	Bacteria	2337
172	Ga0307416_100022616	3300032002	Bacteria	4541
173	Ga0307416_100659444	3300032002	Bacteria	1132
174	Ga0307414_10113903	3300032004	Bacteria	2065
175	Ga0395900_0259787	3300037418	Bacteria	1735
176	Ga0395905_0047123	3300037471	Bacteria	4041
177	Ga0395905_0080748	3300037471	Bacteria	3048
178	Ga0395901_0173239	3300038443	Bacteria	2264
179	Ga0395901_0217007	3300038443	Bacteria	2000
180	Ga0436365_0839014	3300039437	Bacteria	3744
181	Ga0439436_0002149	3300041404	Bacteria	5896
182	Ga0439438_000053	3300041405	Bacteria	55678
183	Ga0439438_000154	3300041405	Bacteria	31368
184	Ga0439438_003911	3300041405	Bacteria	5863
185	Ga0439447_000015	3300041407	Bacteria	67494
186	Ga0439447_000034	3300041407	Bacteria	49064
187	Ga0439466_0000108	3300041411	Bacteria	31679
188	Ga0439466_0000130	3300041411	Bacteria	29384
189	Ga0439466_0000427	3300041411	Bacteria	16023
190	Ga0439466_0013183	3300041411	Bacteria	3029
191	Ga0451791_1411515	3300041451	Bacteria	1557
192	Ga0439432_000074	3300042006	Bacteria	30979
193	Ga0439432_012758	3300042006	Bacteria	2868
194	Ga0439451_000266	3300042009	Bacteria	10131
195	Ga0439451_000609	3300042009	Bacteria	6788
196	Ga0439452_000148	3300042010	Bacteria	51785
197	Ga0439452_005672	3300042010	Bacteria	3995
198	Ga0439456_000054	3300042013	Bacteria	42184
199	Ga0439463_044974	3300042016	Bacteria	1125
200	Ga0450911_000974	3300042115	Bacteria	7469
201	Ga0450906_009924	3300042145	Bacteria	1808
202	Ga0450907_001452	3300042146	Bacteria	5115
203	Ga0439446_0012246	3300042156	Bacteria	2341
204	Ga0450909_003180	3300042185	Bacteria	2337
205	Ga0439434_0000013	3300042435	Bacteria	44761
206	Ga0439434_0033473	3300042435	Bacteria	1566
207	Ga0450918_001497	3300042531	Bacteria	4624
208	Ga0495617_000825	3300046452	Bacteria	14838
209	Ga0495617_025317	3300046452	Bacteria	2001
210	Ga0495627_006784	3300046453	Bacteria	4455
211	Ga0495627_006865	3300046453	Bacteria	4427
212	Ga0495627_010757	3300046453	Bacteria	3310
213	Ga0495590_0001239	3300046457	Bacteria	11130
214	Ga0495590_0002653	3300046457	Bacteria	7388
215	Ga0495591_000123	3300046458	Bacteria	84832
216	Ga0495591_001526	3300046458	Bacteria	14234
217	Ga0495591_024712	3300046458	Bacteria	1898
218	Ga0495638_0000554	3300046460	Bacteria	42645
219	Ga0495638_0000770	3300046460	Bacteria	34035
220	Ga0495638_0002104	3300046460	Bacteria	16836
221	Ga0495638_0002920	3300046460	Bacteria	13653
222	Ga0495638_0003662	3300046460	Bacteria	11979
223	Ga0495638_0007210	3300046460	Bacteria	7996
224	Ga0495638_0008017	3300046460	Bacteria	7523
225	Ga0495638_0017064	3300046460	Bacteria	4850
226	Ga0495638_0092155	3300046460	Bacteria	1824
227	Ga0495653_0003254	3300046463	Bacteria	13030
228	Ga0495650_0000488	3300046471	Bacteria	60332
229	Ga0495650_0000673	3300046471	Bacteria	44385
230	Ga0495650_0000771	3300046471	Bacteria	39556
231	Ga0495605_0000194	3300046474	Bacteria	76134
232	Ga0495605_0000864	3300046474	Bacteria	20993
233	Ga0495605_0001602	3300046474	Bacteria	14657
234	Ga0495605_0004720	3300046474	Bacteria	7971
235	Ga0495584_0000020	3300046491	Bacteria	132682
236	Ga0495584_0003534	3300046491	Bacteria	8565
237	Ga0495584_0011933	3300046491	Bacteria	4442
238	Ga0495584_0019179	3300046491	Bacteria	3474
239	Ga0495584_0028313	3300046491	Bacteria	2839
240	Ga0495584_0034794	3300046491	Bacteria	2547
241	Ga0495585_0000120	3300046492	Bacteria	85123
242	Ga0495585_0000509	3300046492	Bacteria	36748
243	Ga0495585_0019774	3300046492	Bacteria	3879
244	Ga0495596_0016132	3300046500	Bacteria	3109
245	Ga0495607_0002116	3300046501	Bacteria	16575
246	Ga0495607_0011413	3300046501	Bacteria	5913
247	Ga0495583_0000163	3300046506	Bacteria	112327
248	Ga0495583_0000297	3300046506	Bacteria	78953
249	Ga0495583_0002722	3300046506	Bacteria	14633
250	Ga0495583_0048136	3300046506	Bacteria	1957
251	Ga0495606_0000300	3300046507	Bacteria	85461
252	Ga0495606_0002362	3300046507	Bacteria	22159
253	Ga0495606_0002782	3300046507	Bacteria	19567
254	Ga0495606_0018066	3300046507	Bacteria	5302
255	Ga0495606_0018113	3300046507	Bacteria	5294
256	Ga0495606_0039399	3300046507	Bacteria	3185
257	Ga0495610_0000223	3300046512	Bacteria	60959
258	Ga0495610_0001575	3300046512	Bacteria	20078
259	Ga0495610_0002570	3300046512	Bacteria	15093
260	Ga0495610_0002897	3300046512	Bacteria	13887
261	Ga0495616_0007055	3300046513	Bacteria	6753
262	Ga0495616_0059374	3300046513	Bacteria	1881
263	Ga0495620_0000098	3300046515	Bacteria	69404
264	Ga0495620_0023526	3300046515	Bacteria	2943
265	Ga0495631_0019026	3300046518	Bacteria	3225
266	Ga0495632_0000543	3300046519	Bacteria	35463
267	Ga0495632_0002536	3300046519	Bacteria	13843
268	Ga0495632_0012799	3300046519	Bacteria	4816
269	Ga0495632_0016854	3300046519	Bacteria	4051
270	Ga0495632_0030087	3300046519	Bacteria	2821
271	Ga0495632_0036739	3300046519	Bacteria	2489
272	Ga0495632_0062728	3300046519	Bacteria	1801
273	Ga0495637_0000118	3300046520	Bacteria	58203
274	Ga0495637_0000191	3300046520	Bacteria	47977
275	Ga0495637_0001236	3300046520	Bacteria	15480
276	Ga0495637_0004494	3300046520	Bacteria	7214
277	Ga0495637_0008704	3300046520	Bacteria	4976
278	Ga0495643_0000177	3300046522	Bacteria	101375
279	Ga0495643_0004223	3300046522	Bacteria	10170
280	Ga0495643_0005789	3300046522	Bacteria	8273
281	Ga0495643_0007104	3300046522	Bacteria	7265
282	Ga0495643_0016362	3300046522	Bacteria	4355
283	Ga0495644_0000025	3300046523	Bacteria	75756
284	Ga0495644_0000052	3300046523	Bacteria	55714
285	Ga0495644_0000168	3300046523	Bacteria	30880
286	Ga0495644_0000256	3300046523	Bacteria	24532
287	Ga0495648_0038952	3300046524	Bacteria	3032
288	Ga0495648_0083252	3300046524	Bacteria	1813
289	Ga0495666_0000093	3300046526	Bacteria	36630
290	Ga0495666_0001369	3300046526	Bacteria	11815
291	Ga0495654_0000112	3300046530	Bacteria	92528
292	Ga0495654_0000311	3300046530	Bacteria	42613
293	Ga0495654_0001562	3300046530	Bacteria	15523
294	Ga0495654_0002430	3300046530	Bacteria	11997
295	Ga0495654_0006385	3300046530	Bacteria	6705
296	Ga0495597_0000816	3300046542	Bacteria	24537
297	Ga0495597_0001410	3300046542	Bacteria	17336
298	Ga0495597_0001573	3300046542	Bacteria	16076
299	Ga0495597_0001880	3300046542	Bacteria	14351
300	Ga0495597_0004976	3300046542	Bacteria	7135
301	Ga0495597_0047520	3300046542	Bacteria	1899
302	Ga0495633_0001257	3300046558	Bacteria	20202
303	Ga0495668_0036027	3300046616	Bacteria	2773
304	Ga0495611_0018510	3300046648	Bacteria	2987
305	Ga0495625_0003013	3300046660	Bacteria	17353
306	Ga0495625_0023207	3300046660	Bacteria	4741
307	Ga0495661_0000001	3300046665	Bacteria	898372
308	Ga0495661_0000299	3300046665	Bacteria	56225
309	Ga0495661_0002697	3300046665	Bacteria	13536
310	Ga0495623_0090159	3300046679	Bacteria	1883
311	Ga0495671_0000229	3300046692	Bacteria	48226
312	Ga0495671_0000459	3300046692	Bacteria	31939
313	Ga0495671_0002669	3300046692	Bacteria	11185
314	Ga0495671_0002874	3300046692	Bacteria	10768
315	Ga0495671_0003295	3300046692	Bacteria	9987
316	Ga0495671_0007392	3300046692	Bacteria	6267
317	Ga0495671_0035324	3300046692	Bacteria	2538
318	Ga0495671_0044367	3300046692	Bacteria	2229
319	Ga0495649_0001366	3300046694	Bacteria	18539
320	Ga0495649_0001930	3300046694	Bacteria	15114
321	Ga0495649_0002529	3300046694	Bacteria	12828
322	Ga0495649_0006695	3300046694	Bacteria	7147
323	Ga0495600_0005345	3300046809	Bacteria	7736
324	Ga0495660_0000720	3300046810	Bacteria	25314
325	Ga0495660_0001768	3300046810	Bacteria	14319
326	Ga0495660_0001904	3300046810	Bacteria	13639
327	Ga0495660_0010023	3300046810	Bacteria	5512
328	Ga0495660_0058657	3300046810	Bacteria	2072
329	Ga0495604_0010177	3300047317	Bacteria	7449
330	Ga0495604_0040008	3300047317	Bacteria	3682
331	Ga0495674_0000199	3300047319	Bacteria	48627
332	Ga0495672_0000247	3300047320	Bacteria	75920
333	Ga0495672_0000506	3300047320	Bacteria	45016
334	Ga0495672_0043853	3300047320	Bacteria	2686
335	Ga0495672_0077236	3300047320	Bacteria	1867
336	Ga0495680_0001784	3300047322	Bacteria	22804
337	Ga0495680_0008003	3300047322	Bacteria	9635
338	Ga0495683_0000674	3300047323	Bacteria	25217
339	Ga0495675_0000016	3300047444	Bacteria	129732
340	Ga0495675_0002600	3300047444	Bacteria	10820
341	Ga0495679_000174	3300047446	Bacteria	58164
342	Ga0495679_000324	3300047446	Bacteria	37980
343	Ga0495673_0000659	3300047469	Bacteria	33985
344	Ga0495673_0002077	3300047469	Bacteria	14634
345	Ga0495673_0008177	3300047469	Bacteria	5915
346	Ga0495673_0030343	3300047469	Bacteria	2539
347	Ga0495673_0031005	3300047469	Bacteria	2506
348	Ga0495681_0000082	3300047470	Bacteria	83609
349	Ga0495681_0000217	3300047470	Bacteria	47740
350	Ga0495681_0002018	3300047470	Bacteria	14825
351	Ga0495681_0002226	3300047470	Bacteria	13964
352	Ga0495681_0003556	3300047470	Bacteria	10846
353	Ga0495681_0006981	3300047470	Bacteria	7311
354	Ga0495681_0025622	3300047470	Bacteria	3082
355	Ga0495681_0027819	3300047470	Bacteria	2920
356	Ga0495684_0007396	3300047471	Bacteria	8514
357	Ga0495686_0000599	3300047472	Bacteria	50255
358	Ga0495686_0000653	3300047472	Bacteria	47362
359	Ga0495593_0000090	3300047673	Bacteria	40409
360	Ga0495626_0000429	3300048091	Bacteria	43047
361	Ga0495626_0000503	3300048091	Bacteria	39230
362	Ga0495626_0001953	3300048091	Bacteria	15319
363	Ga0495626_0014409	3300048091	Bacteria	4079
364	Ga0496100_0203771	3300048903	Bacteria	1443
365	Ga0496101_0008551	3300048904	Bacteria	6690
366	Ga0496102_0068506	3300048905	Bacteria	3256
367	Ga0496102_0086925	3300048905	Bacteria	2888
368	Ga0496103_0017936	3300048906	Bacteria	4242
369	Ga0496103_0112907	3300048906	Bacteria	1727
370	Ga0496104_0000930	3300048907	Bacteria	25137
371	Ga0496105_0052590	3300048908	Bacteria	3364
372	Ga0496105_0151375	3300048908	Bacteria	1907
373	Ga0496106_0213550	3300048909	Bacteria	1537
374	Ga0496107_0129277	3300048910	Bacteria	1864
375	Ga0496108_0064670	3300048911	Bacteria	3082
376	Ga0496109_0012887	3300048912	Bacteria	7229
377	Ga0496110_0408596	3300048913	Bacteria	1238
378	Ga0496112_0025314	3300048915	Bacteria	5698
379	Ga0496113_0056558	3300048916	Bacteria	2946
380	Ga0496113_0204717	3300048916	Bacteria	1569
381	Ga0496114_0006795	3300048917	Bacteria	9009
382	Ga0496114_0337482	3300048917	Bacteria	1332
383	Ga0496115_0009472	3300048918	Bacteria	7234
384	Ga0496115_0163091	3300048918	Bacteria	1843
385	Ga0496116_0003463	3300048919	Bacteria	15558
386	Ga0496117_0009256	3300048920	Bacteria	9203
387	Ga0496117_0013415	3300048920	Bacteria	7152
388	Ga0496117_0015415	3300048920	Bacteria	6518
389	Ga0496117_0021205	3300048920	Bacteria	5267
390	Ga0496117_0029913	3300048920	Bacteria	4189
391	Ga0496118_0000752	3300048921	Bacteria	52469
392	Ga0496118_0006489	3300048921	Bacteria	12837
393	Ga0496118_0015438	3300048921	Bacteria	7068
394	Ga0496118_0021890	3300048921	Bacteria	5608
395	Ga0496118_0033890	3300048921	Bacteria	4179
396	Ga0496118_0132902	3300048921	Bacteria	1594
397	Ga0496119_0004110	3300048922	Bacteria	14670
398	Ga0496119_0007370	3300048922	Bacteria	9931
399	Ga0496119_0011502	3300048922	Bacteria	7317
400	Ga0496120_0002947	3300048923	Bacteria	16215
401	Ga0496120_0003169	3300048923	Bacteria	15330
402	Ga0496120_0006186	3300048923	Bacteria	9258
403	Ga0496121_0000005	3300048924	Bacteria	1034486
404	Ga0496121_0000140	3300048924	Bacteria	162689
405	Ga0496121_0002893	3300048924	Bacteria	25260
406	Ga0496121_0033733	3300048924	Bacteria	4626
407	Ga0496121_0085647	3300048924	Bacteria	2480
408	Ga0496121_0131500	3300048924	Bacteria	1872
409	Ga0496122_0000582	3300048925	Bacteria	74845
410	Ga0496122_0001471	3300048925	Bacteria	37928
411	Ga0496122_0007162	3300048925	Bacteria	12498
412	Ga0496122_0015691	3300048925	Bacteria	7223
413	Ga0496122_0037220	3300048925	Bacteria	3921
414	Ga0496122_0057826	3300048925	Bacteria	2875
415	Ga0496123_0000479	3300048926	Bacteria	69250
416	Ga0496123_0000567	3300048926	Bacteria	63083
417	Ga0496123_0011618	3300048926	Bacteria	7604
418	Ga0496123_0027734	3300048926	Bacteria	4211
419	Ga0496123_0049241	3300048926	Bacteria	2827
420	Ga0496123_0056638	3300048926	Bacteria	2559
421	Ga0496124_0000004	3300048927	Bacteria	976131
422	Ga0496124_0002662	3300048927	Bacteria	22911
423	Ga0496124_0006230	3300048927	Bacteria	13068
424	Ga0496124_0014560	3300048927	Bacteria	7597
425	Ga0496124_0020299	3300048927	Bacteria	6146
426	Ga0496124_0113985	3300048927	Bacteria	2172
427	Ga0496124_0141063	3300048927	Bacteria	1901
428	Ga0496124_0154058	3300048927	Bacteria	1799
429	Ga0496125_0000107	3300048928	Bacteria	197483
430	Ga0496125_0000190	3300048928	Bacteria	132540
431	Ga0496125_0000359	3300048928	Bacteria	86115
432	Ga0496125_0018820	3300048928	Bacteria	6541
433	Ga0496125_0023580	3300048928	Bacteria	5676
434	Ga0496126_0010554	3300048929	Bacteria	9665
435	Ga0496126_0176981	3300048929	Bacteria	1814
436	Ga0495678_000416	3300049459	Bacteria	42950
437	Ga0495678_001316	3300049459	Bacteria	19961
438	Ga0495678_003565	3300049459	Bacteria	9537
439	Ga0495678_005277	3300049459	Bacteria	7174
440	Ga0495678_007873	3300049459	Bacteria	5473
441	Ga0495678_009629	3300049459	Bacteria	4760
442	Ga0495678_071915	3300049459	Bacteria	1265
443	Ga0495682_0000071	3300049460	Bacteria	93349
444	Ga0495682_0017924	3300049460	Bacteria	2667
445	Ga0501032_0000005	3300049569	Bacteria	262926
446	Ga0501033_0021647	3300049570	Bacteria	4851
447	Ga0501033_0064019	3300049570	Bacteria	2706
448	Ga0501033_0091476	3300049570	Bacteria	2225
449	Ga0501034_0000027	3300049571	Bacteria	260512
450	Ga0501034_0075960	3300049571	Bacteria	3367
451	Ga0501034_0136488	3300049571	Bacteria	2434
452	Ga0501037_0000125	3300049573	Bacteria	71187
453	Ga0501038_0000053	3300049574	Bacteria	94583
454	Ga0501038_0008256	3300049574	Bacteria	9584
455	Ga0501038_0084551	3300049574	Bacteria	2669
456	Ga0501039_0004313	3300049575	Bacteria	10722
457	Ga0501043_0000011	3300049579	Bacteria	198958
458	Ga0501047_0103509	3300049581	Bacteria	2727
459	Ga0501070_0019926	3300049586	Bacteria	5625
460	Ga0501035_0279533	3300049822	Bacteria	1411
461	Ga0501044_0004931	3300049823	Bacteria	14922
462	Ga0501044_0276217	3300049823	Bacteria	1615
463	nmdc:mga00v17_1134_c1	3300050491	Bacteria	13998
464	nmdc:mga00v17_145214_c1	3300050491	Bacteria	1522
465	nmdc:mga07m45_185306_c1	3300050496	Bacteria	1210
466	nmdc:mga0n895_310257_c1	3300050512	Bacteria	1599
467	Ga0500562_004848	3300053108	Bacteria	3389
468	Ga0500659_0000087	3300053135	Bacteria	46315
469	Ga0500616_0072010	3300053153	Bacteria	1758
470	Ga0500622_0030493	3300053156	Bacteria	2831
471	Ga0500627_0076882	3300053158	Bacteria	1484
472	Ga0500634_0000001	3300053161	Bacteria	258285
473	Ga0501082_0024908	3300060353	Bacteria	5156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042016	Ga0439463_044974	Ga0439463_044974_56_898	267
2	3300013308	Ga0157375_10006979	Ga0157375_100069795	268
3	3300042009	Ga0439451_000266	Ga0439451_000266_8873_9760	268
4	3300046458	Ga0495591_001526	Ga0495591_001526_3177_4061	270
5	3300046665	Ga0495661_0002697	Ga0495661_0002697_5517_6401	270
6	3300046692	Ga0495671_0007392	Ga0495671_0007392_1589_2473	270
7	3300047469	Ga0495673_0008177	Ga0495673_0008177_1633_2517	270
8	3300047470	Ga0495681_0025622	Ga0495681_0025622_1149_2033	270
9	3300005466	Ga0070685_10237889	Ga0070685_102378892	271
10	3300006173	Ga0070716_100229692	Ga0070716_1002296922	271
11	3300006871	Ga0075434_100013855	Ga0075434_1000138558	271
12	3300013105	Ga0157369_10081574	Ga0157369_100815743	271
13	3300025927	Ga0207687_10175779	Ga0207687_101757793	271
14	3300025939	Ga0207665_10038804	Ga0207665_100388042	271
15	3300046471	Ga0495650_0000488	Ga0495650_0000488_18325_19209	271
16	3300046474	Ga0495605_0004720	Ga0495605_0004720_3917_4801	271
17	3300046491	Ga0495584_0000020	Ga0495584_0000020_41049_41933	271
18	3300046492	Ga0495585_0019774	Ga0495585_0019774_2843_3727	271
19	3300046507	Ga0495606_0000300	Ga0495606_0000300_62534_63418	271
20	3300046665	Ga0495661_0000001	Ga0495661_0000001_560542_561426	271
21	3300046810	Ga0495660_0001904	Ga0495660_0001904_1216_2100	271
22	3300047320	Ga0495672_0077236	Ga0495672_0077236_126_1010	271
23	3300047469	Ga0495673_0030343	Ga0495673_0030343_865_1749	271
24	3300047469	Ga0495673_0031005	Ga0495673_0031005_569_1453	271
25	3300047470	Ga0495681_0000217	Ga0495681_0000217_31049_31933	271
26	3300048903	Ga0496100_0203771	Ga0496100_0203771_240_1076	271
27	3300048905	Ga0496102_0068506	Ga0496102_0068506_666_1502	271
28	3300048906	Ga0496103_0017936	Ga0496103_0017936_444_1280	271
29	3300048908	Ga0496105_0151375	Ga0496105_0151375_586_1422	271
30	3300048909	Ga0496106_0213550	Ga0496106_0213550_530_1366	271
31	3300048910	Ga0496107_0129277	Ga0496107_0129277_462_1298	271
32	3300048911	Ga0496108_0064670	Ga0496108_0064670_1601_2437	271
33	3300048912	Ga0496109_0012887	Ga0496109_0012887_5855_6691	271
34	3300048913	Ga0496110_0408596	Ga0496110_0408596_213_1049	271
35	3300048916	Ga0496113_0056558	Ga0496113_0056558_1267_2103	271
36	3300048917	Ga0496114_0337482	Ga0496114_0337482_172_1008	271
37	3300048918	Ga0496115_0009472	Ga0496115_0009472_4686_5522	271
38	3300049459	Ga0495678_007873	Ga0495678_007873_3769_4653	271
39	3300049460	Ga0495682_0000071	Ga0495682_0000071_31736_32620	271
40	3300050512	nmdc:mga0n895_310257_c1	nmdc:mga0n895_310257_c1_603_1439	271
41	iso_pu_bacteria	2622736626	2623589889	271
42	3300005458	Ga0070681_10379035	Ga0070681_103790352	272
43	3300005563	Ga0068855_100698277	Ga0068855_1006982771	272
44	3300014325	Ga0163163_10250312	Ga0163163_102503122	272
45	3300028379	Ga0268266_10431235	Ga0268266_104312352	272
46	3300041451	Ga0451791_1411515	Ga0451791_1411515_639_1505	272
47	3300049574	Ga0501038_0084551	Ga0501038_0084551_11_844	272
48	3300039437	Ga0436365_0839014	Ga0436365_0839014_2157_2978	273
49	3300005539	Ga0068853_100017999	Ga0068853_1000179996	274
50	3300005842	Ga0068858_100139409	Ga0068858_1001394093	274
51	3300009551	Ga0105238_10019812	Ga0105238_100198125	274
52	3300025912	Ga0207707_10231166	Ga0207707_102311662	274
53	3300025924	Ga0207694_10090826	Ga0207694_100908262	274
54	3300026035	Ga0207703_10381796	Ga0207703_103817962	274
55	3300026041	Ga0207639_10014389	Ga0207639_100143892	274
56	3300046506	Ga0495583_0048136	Ga0495583_0048136_27_869	274
57	3300046519	Ga0495632_0030087	Ga0495632_0030087_27_869	274
58	iso_pu_bacteria	2929160207	2929167100	274
59	3300031852	Ga0307410_10016458	Ga0307410_100164584	275
60	3300031903	Ga0307407_10189679	Ga0307407_101896792	275
61	3300031995	Ga0307409_100106844	Ga0307409_1001068443	275
62	3300032002	Ga0307416_100022616	Ga0307416_1000226162	275
63	3300046542	Ga0495597_0001573	Ga0495597_0001573_2051_2938	275
64	3300047470	Ga0495681_0000082	Ga0495681_0000082_1351_2238	275
65	iso_pu_bacteria	2773857763	2774398814	275
66	iso_pu_bacteria	2852677369	2852680862	275
67	3300005288	Ga0065714_10064524	Ga0065714_1006452429	276
68	3300009011	Ga0105251_10008446	Ga0105251_100084466	276
69	3300009036	Ga0105244_10017137	Ga0105244_100171372	276
70	3300013104	Ga0157370_10004581	Ga0157370_100045818	276
71	3300014497	Ga0182008_10015968	Ga0182008_100159682	276
72	3300014497	Ga0182008_10022982	Ga0182008_100229822	276
73	3300015261	Ga0182006_1002540	Ga0182006_10025402	276
74	3300015265	Ga0182005_1000508	Ga0182005_100050813	276
75	3300017792	Ga0163161_10042114	Ga0163161_100421143	276
76	3300025230	Ga0209563_100227	Ga0209563_10022714	276
77	3300025292	Ga0209676_1003721	Ga0209676_10037217	276
78	3300025298	Ga0209050_1001226	Ga0209050_100122627	276
79	3300025303	Ga0209051_1004027	Ga0209051_10040273	276
80	3300031824	Ga0307413_10052714	Ga0307413_100527142	276
81	3300032002	Ga0307416_100659444	Ga0307416_1006594442	276
82	3300042115	Ga0450911_000974	Ga0450911_000974_5218_6102	276
83	3300046453	Ga0495627_010757	Ga0495627_010757_11_901	276
84	3300046457	Ga0495590_0001239	Ga0495590_0001239_9121_10011	276
85	3300046457	Ga0495590_0002653	Ga0495590_0002653_1620_2504	276
86	3300046460	Ga0495638_0000770	Ga0495638_0000770_17970_18854	276
87	3300046460	Ga0495638_0002104	Ga0495638_0002104_6433_7317	276
88	3300046460	Ga0495638_0017064	Ga0495638_0017064_1562_2452	276
89	3300046463	Ga0495653_0003254	Ga0495653_0003254_2389_3279	276
90	3300046471	Ga0495650_0000771	Ga0495650_0000771_2548_3432	276
91	3300046474	Ga0495605_0001602	Ga0495605_0001602_11338_12222	276
92	3300046491	Ga0495584_0003534	Ga0495584_0003534_5910_6794	276
93	3300046491	Ga0495584_0028313	Ga0495584_0028313_1636_2520	276
94	3300046491	Ga0495584_0034794	Ga0495584_0034794_1284_2174	276
95	3300046492	Ga0495585_0000120	Ga0495585_0000120_53432_54316	276
96	3300046500	Ga0495596_0016132	Ga0495596_0016132_614_1489	276
97	3300046501	Ga0495607_0002116	Ga0495607_0002116_9848_10738	276
98	3300046506	Ga0495583_0000297	Ga0495583_0000297_62427_63302	276
99	3300046506	Ga0495583_0002722	Ga0495583_0002722_2459_3343	276
100	3300046507	Ga0495606_0018066	Ga0495606_0018066_3142_4026	276
101	3300046507	Ga0495606_0018113	Ga0495606_0018113_3144_4019	276
102	3300046507	Ga0495606_0039399	Ga0495606_0039399_1085_1969	276
103	3300046512	Ga0495610_0002570	Ga0495610_0002570_566_1450	276
104	3300046512	Ga0495610_0002897	Ga0495610_0002897_1276_2160	276
105	3300046513	Ga0495616_0007055	Ga0495616_0007055_4729_5619	276
106	3300046513	Ga0495616_0059374	Ga0495616_0059374_63_947	276
107	3300046515	Ga0495620_0023526	Ga0495620_0023526_139_1029	276
108	3300046519	Ga0495632_0002536	Ga0495632_0002536_11321_12205	276
109	3300046519	Ga0495632_0036739	Ga0495632_0036739_666_1556	276
110	3300046519	Ga0495632_0062728	Ga0495632_0062728_809_1693	276
111	3300046520	Ga0495637_0001236	Ga0495637_0001236_7293_8177	276
112	3300046520	Ga0495637_0004494	Ga0495637_0004494_1217_2101	276
113	3300046522	Ga0495643_0000177	Ga0495643_0000177_43044_43934	276
114	3300046522	Ga0495643_0007104	Ga0495643_0007104_1557_2441	276
115	3300046523	Ga0495644_0000025	Ga0495644_0000025_58693_59583	276
116	3300046523	Ga0495644_0000168	Ga0495644_0000168_24544_25428	276
117	3300046524	Ga0495648_0083252	Ga0495648_0083252_844_1734	276
118	3300046530	Ga0495654_0000112	Ga0495654_0000112_15660_16535	276
119	3300046530	Ga0495654_0006385	Ga0495654_0006385_4882_5772	276
120	3300046542	Ga0495597_0001880	Ga0495597_0001880_2179_3063	276
121	3300046542	Ga0495597_0004976	Ga0495597_0004976_1966_2850	276
122	3300046542	Ga0495597_0047520	Ga0495597_0047520_927_1817	276
123	3300046665	Ga0495661_0000299	Ga0495661_0000299_46419_47303	276
124	3300046679	Ga0495623_0090159	Ga0495623_0090159_240_1130	276
125	3300046692	Ga0495671_0000459	Ga0495671_0000459_15224_16114	276
126	3300046692	Ga0495671_0002669	Ga0495671_0002669_2903_3787	276
127	3300046692	Ga0495671_0035324	Ga0495671_0035324_332_1222	276
128	3300046694	Ga0495649_0001930	Ga0495649_0001930_11821_12705	276
129	3300046694	Ga0495649_0002529	Ga0495649_0002529_5909_6799	276
130	3300046809	Ga0495600_0005345	Ga0495600_0005345_4219_5109	276
131	3300046810	Ga0495660_0001768	Ga0495660_0001768_11277_12161	276
132	3300046810	Ga0495660_0010023	Ga0495660_0010023_3478_4368	276
133	3300046810	Ga0495660_0058657	Ga0495660_0058657_885_1769	276
134	3300047317	Ga0495604_0040008	Ga0495604_0040008_2692_3576	276
135	3300047320	Ga0495672_0000247	Ga0495672_0000247_16192_17082	276
136	3300047320	Ga0495672_0043853	Ga0495672_0043853_784_1668	276
137	3300047322	Ga0495680_0001784	Ga0495680_0001784_3342_4232	276
138	3300047323	Ga0495683_0000674	Ga0495683_0000674_12943_13833	276
139	3300047444	Ga0495675_0000016	Ga0495675_0000016_84427_85311	276
140	3300047444	Ga0495675_0002600	Ga0495675_0002600_7126_8016	276
141	3300047469	Ga0495673_0002077	Ga0495673_0002077_11456_12340	276
142	3300047470	Ga0495681_0002018	Ga0495681_0002018_6413_7303	276
143	3300047470	Ga0495681_0002226	Ga0495681_0002226_6539_7423	276
144	3300047470	Ga0495681_0027819	Ga0495681_0027819_933_1838	276
145	3300047471	Ga0495684_0007396	Ga0495684_0007396_2071_2955	276
146	3300047472	Ga0495686_0000653	Ga0495686_0000653_45195_46079	276
147	3300048091	Ga0495626_0000503	Ga0495626_0000503_38256_39140	276
148	3300048091	Ga0495626_0001953	Ga0495626_0001953_11991_12875	276
149	3300048091	Ga0495626_0014409	Ga0495626_0014409_61_936	276
150	3300048927	Ga0496124_0006230	Ga0496124_0006230_11386_12270	276
151	3300049459	Ga0495678_003565	Ga0495678_003565_3330_4220	276
152	3300049459	Ga0495678_005277	Ga0495678_005277_2511_3395	276
153	3300049459	Ga0495678_009629	Ga0495678_009629_2910_3794	276
154	3300049459	Ga0495678_071915	Ga0495678_071915_92_982	276
155	3300005618	Ga0068864_100294320	Ga0068864_1002943202	277
156	3300005841	Ga0068863_100034823	Ga0068863_1000348235	277
157	3300009176	Ga0105242_10078858	Ga0105242_100788582	277
158	3300026095	Ga0207676_10365325	Ga0207676_103653251	277
159	iso_pu_bacteria	2889914905	2889919724	277
160	3300049571	Ga0501034_0136488	Ga0501034_0136488_668_1540	278
161	3300049823	Ga0501044_0276217	Ga0501044_0276217_63_953	278
162	iso_pu_bacteria	2508501127	2509145469	278
163	iso_pu_bacteria	2808606377	2808931006	278
164	iso_pu_bacteria	2808606381	2808953128	278
165	iso_pu_bacteria	2958071322	2958077067	278
166	iso_pu_bacteria	2977971508	2977971968	278
167	iso_pu_bacteria	3004334049	3004341695	278
168	3300005347	Ga0070668_100134617	Ga0070668_1001346172	279
169	3300025972	Ga0207668_10214484	Ga0207668_102144842	279
170	3300031901	Ga0307406_10000335	Ga0307406_100003356	279
171	iso_pu_bacteria	2929138655	2929142301	279
172	iso_pu_bacteria	8055034563	8055035214	279
173	3300003775	Ga0055524_1002447	Ga0055524_10024472	280
174	3300005289	Ga0065704_10163562	Ga0065704_101635621	280
175	3300013250	Ga0171462_1029	Ga0171462_102994	280
176	3300025299	Ga0209256_1000286	Ga0209256_100028627	280
177	iso_pu_bacteria	2643221557	2643807916	280
178	iso_pu_bacteria	2643221668	2644378257	280
179	iso_pu_bacteria	2844163670	2844169911	280
180	3300015265	Ga0182005_1004160	Ga0182005_10041606	281
181	3300046452	Ga0495617_025317	Ga0495617_025317_1029_1913	281
182	3300046453	Ga0495627_006784	Ga0495627_006784_440_1324	281
183	3300046458	Ga0495591_024712	Ga0495591_024712_510_1394	281
184	3300046474	Ga0495605_0000194	Ga0495605_0000194_43468_44352	281
185	3300046501	Ga0495607_0011413	Ga0495607_0011413_2743_3627	281
186	3300046515	Ga0495620_0000098	Ga0495620_0000098_31741_32625	281
187	3300046518	Ga0495631_0019026	Ga0495631_0019026_2234_3118	281
188	3300046520	Ga0495637_0000118	Ga0495637_0000118_16058_16942	281
189	3300046522	Ga0495643_0004223	Ga0495643_0004223_7238_8122	281
190	3300046523	Ga0495644_0000256	Ga0495644_0000256_7532_8416	281
191	3300046616	Ga0495668_0036027	Ga0495668_0036027_1581_2465	281
192	3300046648	Ga0495611_0018510	Ga0495611_0018510_1968_2852	281
193	3300046692	Ga0495671_0044367	Ga0495671_0044367_358_1242	281
194	3300046694	Ga0495649_0006695	Ga0495649_0006695_4870_5754	281
195	3300047446	Ga0495679_000174	Ga0495679_000174_41076_41960	281
196	iso_pu_bacteria	2599185292	2599904115	281
197	iso_pu_bacteria	2599185302	2599944463	281
198	iso_pu_bacteria	2599185304	2599954935	281
199	iso_pu_bacteria	2599185309	2599984136	281
200	iso_pu_bacteria	2599185310	2599988801	281
201	iso_pu_bacteria	2599185312	2600001295	281
202	iso_pu_bacteria	2599185320	2600049065	281
203	iso_pu_bacteria	2643221569	2643863403	281
204	iso_pu_bacteria	2643221594	2643982759	281
205	iso_pu_bacteria	2643221621	2644120822	281
206	iso_pu_bacteria	2808606395	2809034868	281
207	iso_pu_bacteria	2834578030	2834581395	281
208	iso_pu_bacteria	2857537821	2857542036	281
209	iso_pu_bacteria	2858950400	2858956780	281
210	iso_pu_bacteria	2888343758	2888346105	281
211	iso_pu_bacteria	2941479691	2941480670	281
212	3300014497	Ga0182008_10003476	Ga0182008_100034764	282
213	3300015261	Ga0182006_1008622	Ga0182006_10086222	282
214	3300015262	Ga0182007_10007769	Ga0182007_100077693	282
215	3300015262	Ga0182007_10016817	Ga0182007_100168172	282
216	3300017792	Ga0163161_10002029	Ga0163161_100020299	282
217	3300041411	Ga0439466_0000427	Ga0439466_0000427_3235_4125	282
218	3300041411	Ga0439466_0013183	Ga0439466_0013183_1733_2623	282
219	3300042010	Ga0439452_005672	Ga0439452_005672_2068_2958	282
220	3300046460	Ga0495638_0002920	Ga0495638_0002920_9391_10278	282
221	3300046660	Ga0495625_0023207	Ga0495625_0023207_1237_2130	282
222	iso_pu_bacteria	2582581306	2585264894	282
223	iso_pu_bacteria	2582581865	2585386050	282
224	iso_pu_bacteria	8054002106	8054007286	282
225	3300003187	JGI25151J46595_10012460	JGI25151J46595_100124602	283
226	3300003214	JGI25165J46597_1000034	JGI25165J46597_10000347	283
227	3300005616	Ga0068852_100080376	Ga0068852_1000803763	283
228	3300006051	Ga0075364_10000118	Ga0075364_1000011810	283
229	3300009545	Ga0105237_10005925	Ga0105237_100059253	283
230	3300009551	Ga0105238_10004487	Ga0105238_100044879	283
231	3300013105	Ga0157369_10101267	Ga0157369_101012672	283
232	3300025261	Ga0209233_1000028	Ga0209233_100002811	283
233	3300025294	Ga0209025_1000079	Ga0209025_1000079158	283
234	3300025913	Ga0207695_10267335	Ga0207695_102673352	283
235	3300025914	Ga0207671_10320925	Ga0207671_103209252	283
236	3300041404	Ga0439436_0002149	Ga0439436_0002149_63_914	283
237	3300042145	Ga0450906_009924	Ga0450906_009924_620_1471	283
238	3300042435	Ga0439434_0033473	Ga0439434_0033473_242_1093	283
239	3300042531	Ga0450918_001497	Ga0450918_001497_3630_4481	283
240	3300048918	Ga0496115_0163091	Ga0496115_0163091_852_1751	283
241	3300048927	Ga0496124_0113985	Ga0496124_0113985_470_1354	283
242	3300048929	Ga0496126_0176981	Ga0496126_0176981_890_1789	283
243	3300049569	Ga0501032_0000005	Ga0501032_0000005_158867_159787	283
244	3300049570	Ga0501033_0021647	Ga0501033_0021647_2566_3486	283
245	3300049571	Ga0501034_0000027	Ga0501034_0000027_103139_104059	283
246	3300049573	Ga0501037_0000125	Ga0501037_0000125_28120_29040	283
247	3300049574	Ga0501038_0000053	Ga0501038_0000053_43310_44230	283
248	3300049574	Ga0501038_0008256	Ga0501038_0008256_7233_8162	283
249	3300049575	Ga0501039_0004313	Ga0501039_0004313_4058_4978	283
250	3300049579	Ga0501043_0000011	Ga0501043_0000011_156524_157444	283
251	3300053108	Ga0500562_004848	Ga0500562_004848_1406_2284	283
252	iso_pu_bacteria	2513237159	2514000550	283
253	iso_pu_bacteria	2551306089	2551714881	283
254	iso_pu_bacteria	2599185352	2600192889	283
255	iso_pu_bacteria	2842521101	2842523535	283
256	iso_pu_bacteria	2904541872	2904547659	283
257	iso_pu_bacteria	2970026789	2970028737	283
258	3300010375	Ga0105239_10022510	Ga0105239_100225101	284
259	3300013249	Ga0171463_1002	Ga0171463_1002818	284
260	3300015684	Ga0183365_10066	Ga0183365_100662	284
261	3300015690	Ga0183363_1075	Ga0183363_107510	284
262	3300025261	Ga0209233_1018275	Ga0209233_10182751	284
263	3300037418	Ga0395900_0259787	Ga0395900_0259787_501_1388	284
264	3300038443	Ga0395901_0173239	Ga0395901_0173239_501_1388	284
265	3300038443	Ga0395901_0217007	Ga0395901_0217007_738_1625	284
266	3300048906	Ga0496103_0112907	Ga0496103_0112907_524_1411	284
267	3300048921	Ga0496118_0132902	Ga0496118_0132902_591_1478	284
268	3300048925	Ga0496122_0007162	Ga0496122_0007162_4047_4973	284
269	3300048928	Ga0496125_0000359	Ga0496125_0000359_55188_56114	284
270	iso_pu_bacteria	2511231018	2511340526	284
271	iso_pu_bacteria	2511231019	2511345870	284
272	iso_pu_bacteria	2693429783	2694630794	284
273	iso_pu_bacteria	2693429784	2694634840	284
274	iso_pu_bacteria	2869162929	2869167727	284
275	iso_pu_bacteria	2876377896	2876382588	284
276	iso_pu_bacteria	2889010040	2889013311	284
277	iso_pu_bacteria	2906354277	2906357359	284
278	iso_pu_bacteria	2922185730	2922190296	284
279	iso_pu_bacteria	2938014810	2938017192	284
280	3300003758	Ga0055532_1000287	Ga0055532_100028719	285
281	3300003760	Ga0055527_1000193	Ga0055527_100019327	285
282	3300003761	Ga0055535_1000401	Ga0055535_100040127	285
283	3300003762	Ga0055542_1001329	Ga0055542_10013293	285
284	3300003763	Ga0055529_1001541	Ga0055529_10015416	285
285	3300003781	Ga0055536_1028900	Ga0055536_10289002	285
286	3300003791	Ga0055530_10005549	Ga0055530_100055495	285
287	3300003841	Ga0055541_1004899	Ga0055541_10048992	285
288	3300005331	Ga0070670_100000097	Ga0070670_10000009765	285
289	3300005339	Ga0070660_100000019	Ga0070660_10000001956	285
290	3300005347	Ga0070668_100000312	Ga0070668_10000031211	285
291	3300005347	Ga0070668_100006759	Ga0070668_1000067593	285
292	3300005366	Ga0070659_100000012	Ga0070659_10000001253	285
293	3300005367	Ga0070667_100000169	Ga0070667_10000016924	285
294	3300005548	Ga0070665_100000610	Ga0070665_10000061029	285
295	3300005617	Ga0068859_100060114	Ga0068859_1000601142	285
296	3300005719	Ga0068861_100195231	Ga0068861_1001952312	285
297	3300005841	Ga0068863_100000185	Ga0068863_10000018553	285
298	3300005842	Ga0068858_100008637	Ga0068858_1000086373	285
299	3300005843	Ga0068860_100000211	Ga0068860_10000021124	285
300	3300005844	Ga0068862_100000514	Ga0068862_10000051423	285
301	3300006353	Ga0075370_10189900	Ga0075370_101899002	285
302	3300006931	Ga0097620_100060110	Ga0097620_1000601102	285
303	3300009036	Ga0105244_10001460	Ga0105244_100014606	285
304	3300009092	Ga0105250_10002161	Ga0105250_100021617	285
305	3300009092	Ga0105250_10004853	Ga0105250_100048535	285
306	3300009101	Ga0105247_10145262	Ga0105247_101452622	285
307	3300009177	Ga0105248_10064649	Ga0105248_100646493	285
308	3300009545	Ga0105237_10003361	Ga0105237_1000336114	285
309	3300009551	Ga0105238_10002329	Ga0105238_100023295	285
310	3300009553	Ga0105249_10000855	Ga0105249_1000085518	285
311	3300010375	Ga0105239_10001477	Ga0105239_1000147711	285
312	3300013100	Ga0157373_10000173	Ga0157373_1000017326	285
313	3300013102	Ga0157371_10000084	Ga0157371_1000008493	285
314	3300013105	Ga0157369_10003281	Ga0157369_100032817	285
315	3300014497	Ga0182008_10000401	Ga0182008_1000040113	285
316	3300014497	Ga0182008_10000806	Ga0182008_100008063	285
317	3300014497	Ga0182008_10001539	Ga0182008_100015397	285
318	3300014497	Ga0182008_10036717	Ga0182008_100367173	285
319	3300014968	Ga0157379_10042615	Ga0157379_100426152	285
320	3300015262	Ga0182007_10000263	Ga0182007_1000026327	285
321	3300015262	Ga0182007_10000547	Ga0182007_100005474	285
322	3300015265	Ga0182005_1000555	Ga0182005_100055514	285
323	3300017792	Ga0163161_10005559	Ga0163161_100055595	285
324	3300025225	Ga0209566_100243	Ga0209566_10024327	285
325	3300025226	Ga0209674_101231	Ga0209674_1012312	285
326	3300025228	Ga0209672_100059	Ga0209672_10005910	285
327	3300025229	Ga0209147_100072	Ga0209147_10007210	285
328	3300025242	Ga0209258_100102	Ga0209258_10010210	285
329	3300025254	Ga0209148_1000916	Ga0209148_10009168	285
330	3300025272	Ga0209455_1000375	Ga0209455_100037510	285
331	3300025292	Ga0209676_1001421	Ga0209676_10014218	285
332	3300025292	Ga0209676_1003837	Ga0209676_100383710	285
333	3300025294	Ga0209025_1000026	Ga0209025_1000026258	285
334	3300025298	Ga0209050_1000155	Ga0209050_100015512	285
335	3300025298	Ga0209050_1015319	Ga0209050_10153193	285
336	3300025303	Ga0209051_1012849	Ga0209051_10128492	285
337	3300025711	Ga0207696_1000784	Ga0207696_10007846	285
338	3300025728	Ga0207655_1000445	Ga0207655_100044547	285
339	3300025735	Ga0207713_1002802	Ga0207713_10028026	285
340	3300025904	Ga0207647_10018890	Ga0207647_100188902	285
341	3300025914	Ga0207671_10004094	Ga0207671_1000409412	285
342	3300025919	Ga0207657_10000013	Ga0207657_1000001399	285
343	3300025924	Ga0207694_10012896	Ga0207694_100128962	285
344	3300025925	Ga0207650_10000160	Ga0207650_1000016069	285
345	3300025932	Ga0207690_10000048	Ga0207690_1000004855	285
346	3300025941	Ga0207711_10061917	Ga0207711_100619172	285
347	3300025961	Ga0207712_10000203	Ga0207712_1000020342	285
348	3300025972	Ga0207668_10000414	Ga0207668_1000041422	285
349	3300025972	Ga0207668_10002809	Ga0207668_100028095	285
350	3300025986	Ga0207658_10000341	Ga0207658_1000034122	285
351	3300026035	Ga0207703_10006632	Ga0207703_100066327	285
352	3300026088	Ga0207641_10001171	Ga0207641_1000117122	285
353	3300026118	Ga0207675_100142053	Ga0207675_1001420532	285
354	3300028379	Ga0268266_10002265	Ga0268266_1000226513	285
355	3300028380	Ga0268265_10000779	Ga0268265_1000077922	285
356	3300028381	Ga0268264_10000270	Ga0268264_1000027068	285
357	3300028800	Ga0265338_10010503	Ga0265338_100105036	285
358	3300031548	Ga0307408_100063379	Ga0307408_1000633794	285
359	3300031911	Ga0307412_10000199	Ga0307412_1000019924	285
360	3300032004	Ga0307414_10113903	Ga0307414_101139032	285
361	3300037471	Ga0395905_0047123	Ga0395905_0047123_3036_3926	285
362	3300037471	Ga0395905_0080748	Ga0395905_0080748_309_1250	285
363	3300041405	Ga0439438_000053	Ga0439438_000053_51958_52845	285
364	3300041405	Ga0439438_000154	Ga0439438_000154_27053_27940	285
365	3300041405	Ga0439438_003911	Ga0439438_003911_2065_2952	285
366	3300041407	Ga0439447_000015	Ga0439447_000015_27983_28870	285
367	3300041407	Ga0439447_000034	Ga0439447_000034_20980_21867	285
368	3300041411	Ga0439466_0000108	Ga0439466_0000108_26992_27879	285
369	3300041411	Ga0439466_0000130	Ga0439466_0000130_9551_10438	285
370	3300042006	Ga0439432_000074	Ga0439432_000074_21550_22437	285
371	3300042006	Ga0439432_012758	Ga0439432_012758_1464_2351	285
372	3300042009	Ga0439451_000609	Ga0439451_000609_1810_2697	285
373	3300042010	Ga0439452_000148	Ga0439452_000148_11779_12666	285
374	3300042013	Ga0439456_000054	Ga0439456_000054_18331_19218	285
375	3300042146	Ga0450907_001452	Ga0450907_001452_697_1584	285
376	3300042156	Ga0439446_0012246	Ga0439446_0012246_1058_1945	285
377	3300042185	Ga0450909_003180	Ga0450909_003180_489_1376	285
378	3300042435	Ga0439434_0000013	Ga0439434_0000013_22073_22960	285
379	3300046452	Ga0495617_000825	Ga0495617_000825_7982_8869	285
380	3300046453	Ga0495627_006865	Ga0495627_006865_2312_3199	285
381	3300046458	Ga0495591_000123	Ga0495591_000123_31729_32616	285
382	3300046460	Ga0495638_0000554	Ga0495638_0000554_5339_6226	285
383	3300046460	Ga0495638_0003662	Ga0495638_0003662_1920_2807	285
384	3300046460	Ga0495638_0007210	Ga0495638_0007210_5194_6081	285
385	3300046460	Ga0495638_0008017	Ga0495638_0008017_341_1228	285
386	3300046460	Ga0495638_0092155	Ga0495638_0092155_663_1550	285
387	3300046471	Ga0495650_0000673	Ga0495650_0000673_23757_24644	285
388	3300046474	Ga0495605_0000864	Ga0495605_0000864_193_1080	285
389	3300046491	Ga0495584_0011933	Ga0495584_0011933_705_1592	285
390	3300046491	Ga0495584_0019179	Ga0495584_0019179_1926_2813	285
391	3300046492	Ga0495585_0000509	Ga0495585_0000509_15086_15973	285
392	3300046506	Ga0495583_0000163	Ga0495583_0000163_86397_87284	285
393	3300046506	Ga0495583_0000297	Ga0495583_0000297_41951_42838	285
394	3300046507	Ga0495606_0002362	Ga0495606_0002362_20321_21208	285
395	3300046507	Ga0495606_0002782	Ga0495606_0002782_952_1839	285
396	3300046512	Ga0495610_0000223	Ga0495610_0000223_25283_26170	285
397	3300046512	Ga0495610_0001575	Ga0495610_0001575_8970_9857	285
398	3300046519	Ga0495632_0000543	Ga0495632_0000543_14534_15421	285
399	3300046519	Ga0495632_0012799	Ga0495632_0012799_2932_3819	285
400	3300046519	Ga0495632_0016854	Ga0495632_0016854_1012_1899	285
401	3300046520	Ga0495637_0000191	Ga0495637_0000191_46254_47141	285
402	3300046520	Ga0495637_0008704	Ga0495637_0008704_237_1124	285
403	3300046522	Ga0495643_0005789	Ga0495643_0005789_5591_6478	285
404	3300046522	Ga0495643_0016362	Ga0495643_0016362_852_1739	285
405	3300046523	Ga0495644_0000052	Ga0495644_0000052_34166_35053	285
406	3300046524	Ga0495648_0038952	Ga0495648_0038952_875_1762	285
407	3300046526	Ga0495666_0000093	Ga0495666_0000093_21989_22876	285
408	3300046526	Ga0495666_0001369	Ga0495666_0001369_10889_11776	285
409	3300046530	Ga0495654_0000112	Ga0495654_0000112_36123_37010	285
410	3300046530	Ga0495654_0000311	Ga0495654_0000311_739_1626	285
411	3300046530	Ga0495654_0001562	Ga0495654_0001562_1066_1953	285
412	3300046530	Ga0495654_0002430	Ga0495654_0002430_2280_3167	285
413	3300046542	Ga0495597_0000816	Ga0495597_0000816_4984_5871	285
414	3300046542	Ga0495597_0001410	Ga0495597_0001410_5032_5919	285
415	3300046558	Ga0495633_0001257	Ga0495633_0001257_9802_10677	285
416	3300046660	Ga0495625_0003013	Ga0495625_0003013_11168_12055	285
417	3300046665	Ga0495661_0000299	Ga0495661_0000299_19575_20462	285
418	3300046692	Ga0495671_0000229	Ga0495671_0000229_25181_26068	285
419	3300046692	Ga0495671_0002874	Ga0495671_0002874_4099_4986	285
420	3300046692	Ga0495671_0003295	Ga0495671_0003295_5421_6308	285
421	3300046694	Ga0495649_0001366	Ga0495649_0001366_3447_4334	285
422	3300046810	Ga0495660_0000720	Ga0495660_0000720_20545_21432	285
423	3300047317	Ga0495604_0010177	Ga0495604_0010177_3992_4879	285
424	3300047319	Ga0495674_0000199	Ga0495674_0000199_35213_36100	285
425	3300047320	Ga0495672_0000506	Ga0495672_0000506_17244_18131	285
426	3300047322	Ga0495680_0008003	Ga0495680_0008003_8413_9300	285
427	3300047444	Ga0495675_0000016	Ga0495675_0000016_38609_39496	285
428	3300047446	Ga0495679_000324	Ga0495679_000324_23335_24222	285
429	3300047469	Ga0495673_0000659	Ga0495673_0000659_18420_19307	285
430	3300047470	Ga0495681_0000082	Ga0495681_0000082_21798_22685	285
431	3300047470	Ga0495681_0003556	Ga0495681_0003556_5108_5995	285
432	3300047470	Ga0495681_0006981	Ga0495681_0006981_2345_3232	285
433	3300047472	Ga0495686_0000599	Ga0495686_0000599_33496_34383	285
434	3300047673	Ga0495593_0000090	Ga0495593_0000090_21548_22435	285
435	3300048091	Ga0495626_0000429	Ga0495626_0000429_17244_18131	285
436	3300048904	Ga0496101_0008551	Ga0496101_0008551_1133_2002	285
437	3300048905	Ga0496102_0086925	Ga0496102_0086925_1831_2724	285
438	3300048907	Ga0496104_0000930	Ga0496104_0000930_4403_5272	285
439	3300048908	Ga0496105_0052590	Ga0496105_0052590_1799_2668	285
440	3300048915	Ga0496112_0025314	Ga0496112_0025314_1011_1880	285
441	3300048916	Ga0496113_0204717	Ga0496113_0204717_608_1477	285
442	3300048917	Ga0496114_0006795	Ga0496114_0006795_1293_2171	285
443	3300048919	Ga0496116_0003463	Ga0496116_0003463_6454_7311	285
444	3300048920	Ga0496117_0009256	Ga0496117_0009256_3671_4540	285
445	3300048920	Ga0496117_0013415	Ga0496117_0013415_1074_1952	285
446	3300048920	Ga0496117_0015415	Ga0496117_0015415_1544_2428	285
447	3300048920	Ga0496117_0021205	Ga0496117_0021205_3794_4651	285
448	3300048920	Ga0496117_0029913	Ga0496117_0029913_3156_4013	285
449	3300048921	Ga0496118_0000752	Ga0496118_0000752_46565_47443	285
450	3300048921	Ga0496118_0006489	Ga0496118_0006489_7946_8815	285
451	3300048921	Ga0496118_0015438	Ga0496118_0015438_4963_5820	285
452	3300048921	Ga0496118_0021890	Ga0496118_0021890_2288_3145	285
453	3300048921	Ga0496118_0033890	Ga0496118_0033890_2621_3478	285
454	3300048922	Ga0496119_0004110	Ga0496119_0004110_11984_12841	285
455	3300048922	Ga0496119_0007370	Ga0496119_0007370_3969_4826	285
456	3300048922	Ga0496119_0011502	Ga0496119_0011502_4656_5513	285
457	3300048923	Ga0496120_0002947	Ga0496120_0002947_2971_3828	285
458	3300048923	Ga0496120_0003169	Ga0496120_0003169_14426_15316	285
459	3300048923	Ga0496120_0006186	Ga0496120_0006186_4068_4925	285
460	3300048924	Ga0496121_0000005	Ga0496121_0000005_440620_441477	285
461	3300048924	Ga0496121_0000140	Ga0496121_0000140_23908_24765	285
462	3300048924	Ga0496121_0002893	Ga0496121_0002893_4742_5611	285
463	3300048924	Ga0496121_0033733	Ga0496121_0033733_2037_2918	285
464	3300048924	Ga0496121_0085647	Ga0496121_0085647_480_1358	285
465	3300048924	Ga0496121_0131500	Ga0496121_0131500_139_1017	285
466	3300048925	Ga0496122_0000582	Ga0496122_0000582_49891_50748	285
467	3300048925	Ga0496122_0001471	Ga0496122_0001471_7445_8323	285
468	3300048925	Ga0496122_0015691	Ga0496122_0015691_2629_3498	285
469	3300048925	Ga0496122_0037220	Ga0496122_0037220_612_1496	285
470	3300048925	Ga0496122_0057826	Ga0496122_0057826_1977_2834	285
471	3300048926	Ga0496123_0000479	Ga0496123_0000479_23597_24454	285
472	3300048926	Ga0496123_0000567	Ga0496123_0000567_12254_13132	285
473	3300048926	Ga0496123_0011618	Ga0496123_0011618_4501_5370	285
474	3300048926	Ga0496123_0027734	Ga0496123_0027734_2272_3129	285
475	3300048926	Ga0496123_0049241	Ga0496123_0049241_1911_2795	285
476	3300048926	Ga0496123_0056638	Ga0496123_0056638_1661_2518	285
477	3300048927	Ga0496124_0000004	Ga0496124_0000004_562772_563653	285
478	3300048927	Ga0496124_0002662	Ga0496124_0002662_5183_6061	285
479	3300048927	Ga0496124_0014560	Ga0496124_0014560_5386_6243	285
480	3300048927	Ga0496124_0020299	Ga0496124_0020299_5228_6097	285
481	3300048927	Ga0496124_0141063	Ga0496124_0141063_1003_1860	285
482	3300048927	Ga0496124_0154058	Ga0496124_0154058_917_1774	285
483	3300048928	Ga0496125_0000107	Ga0496125_0000107_119179_120036	285
484	3300048928	Ga0496125_0000190	Ga0496125_0000190_113163_114020	285
485	3300048928	Ga0496125_0018820	Ga0496125_0018820_2891_3748	285
486	3300048928	Ga0496125_0023580	Ga0496125_0023580_254_1123	285
487	3300048929	Ga0496126_0010554	Ga0496126_0010554_5472_6329	285
488	3300049459	Ga0495678_000416	Ga0495678_000416_20445_21332	285
489	3300049459	Ga0495678_001316	Ga0495678_001316_2508_3395	285
490	3300049460	Ga0495682_0017924	Ga0495682_0017924_669_1556	285
491	3300049570	Ga0501033_0091476	Ga0501033_0091476_164_1021	285
492	3300049571	Ga0501034_0075960	Ga0501034_0075960_352_1209	285
493	3300049581	Ga0501047_0103509	Ga0501047_0103509_610_1467	285
494	3300049823	Ga0501044_0004931	Ga0501044_0004931_2743_3600	285
495	3300050491	nmdc:mga00v17_1134_c1	nmdc:mga00v17_1134_c1_10216_11073	285
496	3300050491	nmdc:mga00v17_145214_c1	nmdc:mga00v17_145214_c1_81_938	285
497	3300050496	nmdc:mga07m45_185306_c1	nmdc:mga07m45_185306_c1_234_1115	285
498	3300053135	Ga0500659_0000087	Ga0500659_0000087_6488_7366	285
499	3300053156	Ga0500622_0030493	Ga0500622_0030493_389_1273	285
500	3300053161	Ga0500634_0000001	Ga0500634_0000001_105477_106334	285
501	iso_pu_bacteria	2501025502	2501079752	285
502	iso_pu_bacteria	2508501125	2509128939	285
503	iso_pu_bacteria	2510917013	2511094090	285
504	iso_pu_bacteria	2511231012	2511303177	285
505	iso_pu_bacteria	2511231012	2511304278	285
506	iso_pu_bacteria	2511231018	2511340893	285
507	iso_pu_bacteria	2511231021	2511358479	285
508	iso_pu_bacteria	2511231021	2511358501	285
509	iso_pu_bacteria	2599185239	2599741904	285
510	iso_pu_bacteria	2808606382	2808958122	285
511	iso_pu_bacteria	2917699015	2917703522	285
512	iso_pu_bacteria	2945961074	2945963622	285
513	iso_pu_bacteria	2977971508	2977978673	285
514	iso_pu_bacteria	643348564	643603287	285
515	iso_pu_bacteria	8056125926	8056128930	285
516	iso_pu_bacteria	8056177738	8056181653	285
517	iso_pu_bacteria	8056177738	8056182411	285
518	3300049570	Ga0501033_0064019	Ga0501033_0064019_1795_2682	286
519	3300049822	Ga0501035_0279533	Ga0501035_0279533_305_1192	286
520	3300053158	Ga0500627_0076882	Ga0500627_0076882_262_1152	286
521	iso_pu_bacteria	650716007	650741365	286
522	3300002987	JGI25159J45721_1000042	JGI25159J45721_100004235	287
523	3300003354	JGI25160J50197_1000139	JGI25160J50197_100013933	287
524	3300003374	JGI25161J50226_1000837	JGI25161J50226_100083715	287
525	3300003775	Ga0055524_1000604	Ga0055524_10006049	287
526	3300003790	Ga0055528_1000637	Ga0055528_100063716	287
527	3300003791	Ga0055530_10044301	Ga0055530_100443011	287
528	3300004625	Ga0055543_1000268	Ga0055543_100026820	287
529	3300005262	Ga0065165_1000443	Ga0065165_100044333	287
530	3300006946	Ga0079104_1000693	Ga0079104_10006935	287
531	3300022739	Ga0228711_1006984	Ga0228711_10069842	287
532	3300022740	Ga0228710_1002664	Ga0228710_10026642	287
533	3300025208	Ga0209436_100065	Ga0209436_10006523	287
534	3300025273	Ga0209673_1000965	Ga0209673_100096512	287
535	3300025284	Ga0209130_1000115	Ga0209130_100011532	287
536	3300025292	Ga0209676_1001168	Ga0209676_100116816	287
537	3300025294	Ga0209025_1000470	Ga0209025_100047019	287
538	3300025295	Ga0209564_1000682	Ga0209564_100068245	287
539	3300025298	Ga0209050_1005171	Ga0209050_10051717	287
540	3300025299	Ga0209256_1000357	Ga0209256_100035745	287
541	3300025302	Ga0207426_1000226	Ga0207426_100022632	287
542	3300025303	Ga0209051_1045028	Ga0209051_10450282	287
543	3300025304	Ga0209257_1007792	Ga0209257_10077927	287
544	3300027111	Ga0209281_1000766	Ga0209281_10007664	287
545	3300049586	Ga0501070_0019926	Ga0501070_0019926_683_1579	287
546	3300053153	Ga0500616_0072010	Ga0500616_0072010_557_1537	287
547	3300060353	Ga0501082_0024908	Ga0501082_0024908_212_1105	287
548	iso_pu_bacteria	2643221723	2644672283	287
549	iso_pu_bacteria	2855839649	2855845087	287
550	iso_pu_bacteria	2921250672	2921252430	287
551	iso_pu_bacteria	2937029754	2937032115	287
552	iso_pu_bacteria	2937049772	2937055415	287
553	iso_pu_bacteria	2970026789	2970030299	287
554	iso_pu_bacteria	2970040964	2970044839	287
555	iso_pu_bacteria	2970116247	2970121681	287
556	iso_pu_bacteria	2977579622	2977580056	287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

61

327

0.9 PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

154

245

0.87 PF00676

E1_dh

Dehydrogenase E1 component

149

290

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6yak-assembly1.cif.gz_CCC	split gene transketolase, active alpha2beta2 heterotetramer	0.9469	9	281
3ooy-assembly1.cif.gz_A	crystal structure of human transketolase (tkt)	0.9298	9	280
6rjb-assembly1.cif.gz_A	human transketolase variant t382e	0.924	3	287
4kxw-assembly1.cif.gz_A	human transketolase in covalent complex with donor ketose d-xylulose-5-phosphate, crystal 2	0.9239	3	287
8cip-assembly2.cif.gz_D	crystal structure of transketolase from geobacillus stearothermophilus	0.9181	16	283

ID	Description	Score	Start	End	Superfamily
af_Q58094_1_274_3.40.50.970	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains	0.9517	13	282	3.40.50.970
af_Q6PHI8_1_298_3.40.50.970	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains	0.9299	6	287	3.40.50.970
af_Q58094_1_274_3.40.50.970	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains	0.9283	13	282	3.40.50.970
af_C6KSV3_9_337_3.40.50.970	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains	0.9018	17	285	3.40.50.970
af_Q6PHI8_1_298_3.40.50.970	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains	0.8988	6	287	3.40.50.970

ID	Description	Score	Start	End
AF-A0A371XJP2-F1-model_v4	Transketolase	0.9812	6	284
AF-A0A5A9GPC7-F1-model_v4	Transketolase	0.9788	6	283
AF-A0A527KPL3-F1-model_v4	Transketolase	0.9774	7	285
AF-A0A1S7RD18-F1-model_v4	deleted	0.9751	4	248
AF-A0A529MBE2-F1-model_v4	Transketolase	0.9732	42	281

Feature Viewer

pLDDT	pTM	Quality
89.63	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F463267

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

61

327

0.9

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

154

245

0.87

PF00676

E1_dh

Dehydrogenase E1 component

149

290

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map