F463237

General Info

Members Datasets Scaffolds Average Seq Length
556 292 1112 148

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0022772|Ga0495592_0022772_685_1137
Length 150
Sequence VPRRAPETSDAPIGRGFAFKDLRVGFRFRTHRRTVREADLVAFMNLTGLTEELFSVKREKQLVPGALVYSLAEGLLLPSMQDTGVAFLGATLDIKAATYVDDTIHVECEVIEHRLTSKGDRGLVRFFNSVRNQNGETVLEYNPLRLLKKE

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
155 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
167 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
168 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
176 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
201 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
271 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 0
Rhizosphere 99.46
Stem 0
Stem Tuber 0
Unclassified 7.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0022772 3300046454 Bacteria 4764
2 Ga0065704_10182312 3300005289 Bacteria 1230
3 Ga0065707_10020838 3300005295 Bacteria 2084
4 Ga0065707_10437792 3300005295 Unclassified 810
5 Ga0070676_10331372 3300005328 Bacteria 1041
6 Ga0070690_100002266 3300005330 Bacteria 10303
7 Ga0070690_100057208 3300005330 Bacteria 2502
8 Ga0070690_100332288 3300005330 Bacteria 1098
9 Ga0070690_101120058 3300005330 Unclassified 625
10 Ga0068869_100021701 3300005334 Bacteria 4419
11 Ga0070666_10879242 3300005335 Bacteria 662
12 Ga0070680_100000721 3300005336 Bacteria 22998
13 Ga0070680_100462681 3300005336 Bacteria 1084
14 Ga0070680_101109103 3300005336 Bacteria 684
15 Ga0070682_100002017 3300005337 Bacteria 11348
16 Ga0068868_100004853 3300005338 Bacteria 9443
17 Ga0070689_100012149 3300005340 Bacteria 6193
18 Ga0070689_100070456 3300005340 Bacteria 2730
19 Ga0070689_100142100 3300005340 Bacteria 1931
20 Ga0070691_10008100 3300005341 Bacteria 4812
21 Ga0070687_100000778 3300005343 Bacteria 10608
22 Ga0070687_100360025 3300005343 Bacteria 941
23 Ga0070687_100455185 3300005343 Bacteria 852
24 Ga0070692_10006855 3300005345 Bacteria 4977
25 Ga0070668_100048031 3300005347 Bacteria 3282
26 Ga0070669_100006224 3300005353 Bacteria 8618
27 Ga0070675_100124311 3300005354 Bacteria 2194
28 Ga0070674_100124925 3300005356 Bacteria 1909
29 Ga0070674_100375472 3300005356 Bacteria 1155
30 Ga0070673_100735289 3300005364 Bacteria 908
31 Ga0070673_101383296 3300005364 Bacteria 662
32 Ga0070688_100104044 3300005365 Bacteria 1877
33 Ga0070667_100445903 3300005367 Bacteria 1182
34 Ga0070703_10025288 3300005406 Bacteria 1760
35 Ga0070703_10112629 3300005406 Bacteria 976
36 Ga0070709_11142383 3300005434 Bacteria 624
37 Ga0070714_100195558 3300005435 Bacteria 1847
38 Ga0070713_100312577 3300005436 Bacteria 1449
39 Ga0070713_100760603 3300005436 Unclassified 927
40 Ga0070710_10183639 3300005437 Unclassified 1311
41 Ga0070701_10001015 3300005438 Bacteria 10219
42 Ga0070701_10238508 3300005438 Bacteria 1093
43 Ga0070705_100000157 3300005440 Bacteria 40183
44 Ga0070705_100019927 3300005440 Bacteria 3538
45 Ga0070705_100083355 3300005440 Bacteria 1970
46 Ga0070705_100215654 3300005440 Bacteria 1326
47 Ga0070705_100224875 3300005440 Bacteria 1302
48 Ga0070700_100015122 3300005441 Bacteria 4369
49 Ga0070700_100426779 3300005441 Bacteria 1003
50 Ga0070694_100001988 3300005444 Bacteria 12142
51 Ga0070694_100126727 3300005444 Bacteria 1839
52 Ga0070694_100133733 3300005444 Unclassified 1795
53 Ga0070694_100349877 3300005444 Bacteria 1144
54 Ga0070694_100492918 3300005444 Bacteria 974
55 Ga0070708_100529151 3300005445 Bacteria 1112
56 Ga0070681_10552770 3300005458 Bacteria 1065
57 Ga0070681_10738039 3300005458 Bacteria 901
58 Ga0070681_11234642 3300005458 Unclassified 670
59 Ga0068867_100004756 3300005459 Bacteria 9561
60 Ga0070706_100478105 3300005467 Bacteria 1159
61 Ga0070706_101064324 3300005467 Unclassified 745
62 Ga0070707_100383379 3300005468 Bacteria 1365
63 Ga0070707_100433112 3300005468 Bacteria 1275
64 Ga0070707_100691196 3300005468 Unclassified 983
65 Ga0070698_100005865 3300005471 Bacteria 13420
66 Ga0070699_100056970 3300005518 Bacteria 3385
67 Ga0070679_100101428 3300005530 Bacteria 2865
68 Ga0070684_100223848 3300005535 Bacteria 1717
69 Ga0070684_100450098 3300005535 Bacteria 1190
70 Ga0070697_100333263 3300005536 Bacteria 1308
71 Ga0068853_100212917 3300005539 Bacteria 1762
72 Ga0070686_100000463 3300005544 Bacteria 24565
73 Ga0070686_100118961 3300005544 Bacteria 1811
74 Ga0070686_100555511 3300005544 Bacteria 899
75 Ga0070695_100000269 3300005545 Bacteria 26219
76 Ga0070695_100014071 3300005545 Bacteria 4817
77 Ga0070696_100000099 3300005546 Bacteria 43704
78 Ga0070696_100070458 3300005546 Bacteria 2459
79 Ga0070696_100078622 3300005546 Bacteria 2332
80 Ga0070696_100083260 3300005546 Bacteria 2269
81 Ga0070696_100189320 3300005546 Unclassified 1531
82 Ga0070696_100577361 3300005546 Bacteria 904
83 Ga0070693_100000073 3300005547 Bacteria 41317
84 Ga0070693_100113095 3300005547 Bacteria 1673
85 Ga0070693_100211061 3300005547 Bacteria 1267
86 Ga0070704_100000023 3300005549 Bacteria 51399
87 Ga0070704_100007141 3300005549 Bacteria 6633
88 Ga0070704_100354494 3300005549 Bacteria 1239
89 Ga0068855_100033265 3300005563 Bacteria 6154
90 Ga0068855_100876173 3300005563 Bacteria 950
91 Ga0068854_100253563 3300005578 Bacteria 1406
92 Ga0068856_100024672 3300005614 Bacteria 5855
93 Ga0070702_100000431 3300005615 Bacteria 14922
94 Ga0070702_100145708 3300005615 Bacteria 1514
95 Ga0068859_100008340 3300005617 Bacteria 10499
96 Ga0068859_100809032 3300005617 Bacteria 1024
97 Ga0068859_101029164 3300005617 Bacteria 905
98 Ga0068864_100912124 3300005618 Bacteria 868
99 Ga0068864_102127004 3300005618 Bacteria 568
100 Ga0068866_10000066 3300005718 Bacteria 41226
101 Ga0068866_10719201 3300005718 Bacteria 687
102 Ga0068861_100002311 3300005719 Bacteria 12385
103 Ga0068861_100003879 3300005719 Bacteria 9995
104 Ga0068861_100848277 3300005719 Bacteria 861
105 Ga0068863_100499701 3300005841 Bacteria 1197
106 Ga0068863_100762717 3300005841 Bacteria 964
107 Ga0068858_100006844 3300005842 Bacteria 11084
108 Ga0068858_100132746 3300005842 Bacteria 2336
109 Ga0068858_100175277 3300005842 Bacteria 2023
110 Ga0068860_100009194 3300005843 Bacteria 9821
111 Ga0068862_100004410 3300005844 Bacteria 11878
112 Ga0068862_100007495 3300005844 Bacteria 9042
113 Ga0081539_10000308 3300005985 Bacteria 109598
114 Ga0070715_10151346 3300006163 Bacteria 1137
115 Ga0070715_10241632 3300006163 Bacteria 939
116 Ga0070715_10300694 3300006163 Unclassified 858
117 Ga0070716_100747398 3300006173 Unclassified 752
118 Ga0075366_10206572 3300006195 Bacteria 1195
119 Ga0097621_100002382 3300006237 Bacteria 12887
120 Ga0097621_100078801 3300006237 Bacteria 2737
121 Ga0068871_100031783 3300006358 Bacteria 4165
122 Ga0068871_100197525 3300006358 Bacteria 1735
123 Ga0068871_100811609 3300006358 Bacteria 863
124 Ga0068871_101339382 3300006358 Unclassified 674
125 Ga0075428_100000181 3300006844 Bacteria 58935
126 Ga0075428_100023206 3300006844 Bacteria 6862
127 Ga0075428_100391619 3300006844 Bacteria 1489
128 Ga0075430_100035345 3300006846 Bacteria 4239
129 Ga0075430_100195280 3300006846 Bacteria 1681
130 Ga0075430_100251146 3300006846 Bacteria 1465
131 Ga0075431_100001959 3300006847 Bacteria 19641
132 Ga0075431_100816835 3300006847 Bacteria 905
133 Ga0075433_10008488 3300006852 Bacteria 8198
134 Ga0075433_10178658 3300006852 Bacteria 1888
135 Ga0075433_10588687 3300006852 Bacteria 977
136 Ga0075434_100000030 3300006871 Bacteria 64435
137 Ga0075434_100005182 3300006871 Bacteria 11834
138 Ga0075434_100132672 3300006871 Bacteria 2510
139 Ga0075434_100151711 3300006871 Bacteria 2338
140 Ga0075434_101482603 3300006871 Bacteria 688
141 Ga0075429_100000435 3300006880 Bacteria 31131
142 Ga0075429_100000544 3300006880 Bacteria 28752
143 Ga0068865_100000102 3300006881 Bacteria 44224
144 Ga0068865_100087949 3300006881 Bacteria 2247
145 Ga0068865_100309145 3300006881 Bacteria 1268
146 Ga0075436_100000267 3300006914 Bacteria 32669
147 Ga0075436_100001501 3300006914 Bacteria 15919
148 Ga0075436_100013917 3300006914 Bacteria 5509
149 Ga0075436_100015140 3300006914 Bacteria 5286
150 Ga0075436_100037479 3300006914 Bacteria 3347
151 Ga0075436_100090770 3300006914 Bacteria 2124
152 Ga0075436_100105951 3300006914 Bacteria 1961
153 Ga0075436_100304486 3300006914 Bacteria 1143
154 Ga0097620_100008340 3300006931 Bacteria 10499
155 Ga0097620_100809062 3300006931 Bacteria 1024
156 Ga0097620_101029217 3300006931 Bacteria 905
157 Ga0075435_100001621 3300007076 Bacteria 14556
158 Ga0075435_100002107 3300007076 Bacteria 13088
159 Ga0075435_100002995 3300007076 Bacteria 11369
160 Ga0075435_100775013 3300007076 Bacteria 835
161 Ga0099794_10209323 3300007265 Bacteria 1000
162 Ga0105250_10051142 3300009092 Bacteria 1658
163 Ga0111539_10028346 3300009094 Bacteria 6833
164 Ga0111539_10041148 3300009094 Bacteria 5557
165 Ga0111539_10305986 3300009094 Bacteria 1850
166 Ga0111539_10429918 3300009094 Bacteria 1537
167 Ga0111539_10536120 3300009094 Bacteria 1364
168 Ga0111539_10865001 3300009094 Bacteria 1052
169 Ga0111539_10973479 3300009094 Bacteria 986
170 Ga0111539_11732945 3300009094 Bacteria 724
171 Ga0105245_10055213 3300009098 Bacteria 3567
172 Ga0114129_10000190 3300009147 Bacteria 69084
173 Ga0114129_10010148 3300009147 Bacteria 13428
174 Ga0114129_10211609 3300009147 Bacteria 2621
175 Ga0114129_10722903 3300009147 Bacteria 1278
176 Ga0114129_11115346 3300009147 Bacteria 987
177 Ga0114129_11507509 3300009147 Bacteria 826
178 Ga0114129_11788786 3300009147 Bacteria 748
179 Ga0105243_10000706 3300009148 Bacteria 32176
180 Ga0105242_10000306 3300009176 Bacteria 39217
181 Ga0105242_10086630 3300009176 Bacteria 2629
182 Ga0105242_10764817 3300009176 Bacteria 952
183 Ga0105249_10016658 3300009553 Bacteria 6523
184 Ga0105249_10370377 3300009553 Bacteria 1456
185 Ga0105249_10690228 3300009553 Bacteria 1080
186 Ga0099796_10260729 3300010159 Bacteria 723
187 Ga0105239_10218173 3300010375 Bacteria 2139
188 Ga0157371_10535161 3300013102 Bacteria 867
189 Ga0157378_10000211 3300013297 Bacteria 56039
190 Ga0157378_10366130 3300013297 Bacteria 1412
191 Ga0163162_10037360 3300013306 Bacteria 4846
192 Ga0157372_10442571 3300013307 Bacteria 1515
193 Ga0157375_10422481 3300013308 Bacteria 1499
194 Ga0157380_10053736 3300014326 Bacteria 3195
195 Ga0157377_10054967 3300014745 Bacteria 2255
196 Ga0157377_10233447 3300014745 Bacteria 1184
197 Ga0157379_10283026 3300014968 Bacteria 1509
198 Ga0157376_10036299 3300014969 Bacteria 3993
199 Ga0157376_10089297 3300014969 Bacteria 2664
200 Ga0207653_10020803 3300025885 Bacteria 2079
201 Ga0207653_10028475 3300025885 Bacteria 1797
202 Ga0207692_10084477 3300025898 Unclassified 1706
203 Ga0207642_10001369 3300025899 Bacteria 7563
204 Ga0207642_10021196 3300025899 Bacteria 2554
205 Ga0207688_10083050 3300025901 Bacteria 1831
206 Ga0207680_10371339 3300025903 Unclassified 1007
207 Ga0207680_10715260 3300025903 Bacteria 718
208 Ga0207699_10061091 3300025906 Bacteria 2266
209 Ga0207699_10496311 3300025906 Bacteria 881
210 Ga0207645_10171177 3300025907 Unclassified 1423
211 Ga0207643_10086492 3300025908 Bacteria 1822
212 Ga0207707_10041942 3300025912 Bacteria 3995
213 Ga0207707_10164557 3300025912 Bacteria 1939
214 Ga0207660_10004471 3300025917 Bacteria 9116
215 Ga0207660_10101146 3300025917 Bacteria 2153
216 Ga0207662_10000080 3300025918 Bacteria 44291
217 Ga0207662_10075469 3300025918 Bacteria 2048
218 Ga0207662_10146151 3300025918 Bacteria 1501
219 Ga0207662_10362908 3300025918 Bacteria 975
220 Ga0207652_10155657 3300025921 Bacteria 2047
221 Ga0207652_10340680 3300025921 Bacteria 1353
222 Ga0207646_10359575 3300025922 Bacteria 1315
223 Ga0207646_10525449 3300025922 Bacteria 1065
224 Ga0207646_11316560 3300025922 Unclassified 630
225 Ga0207681_10005021 3300025923 Bacteria 8133
226 Ga0207687_10002107 3300025927 Bacteria 13597
227 Ga0207687_10032942 3300025927 Bacteria 3513
228 Ga0207700_10744314 3300025928 Bacteria 876
229 Ga0207706_10327618 3300025933 Bacteria 1332
230 Ga0207686_10014978 3300025934 Bacteria 4328
231 Ga0207686_10135783 3300025934 Bacteria 1693
232 Ga0207709_10001290 3300025935 Bacteria 17883
233 Ga0207709_10175382 3300025935 Bacteria 1509
234 Ga0207670_10008457 3300025936 Bacteria 5816
235 Ga0207669_10174177 3300025937 Bacteria 1535
236 Ga0207669_10319313 3300025937 Bacteria 1188
237 Ga0207704_10005551 3300025938 Bacteria 5813
238 Ga0207704_10021458 3300025938 Bacteria 3440
239 Ga0207704_10945231 3300025938 Bacteria 727
240 Ga0207665_11364319 3300025939 Unclassified 565
241 Ga0207691_10047410 3300025940 Bacteria 3943
242 Ga0207689_10000972 3300025942 Bacteria 27502
243 Ga0207689_10359732 3300025942 Bacteria 1210
244 Ga0207661_10275990 3300025944 Bacteria 1501
245 Ga0207667_10071692 3300025949 Bacteria 3601
246 Ga0207651_10563460 3300025960 Bacteria 992
247 Ga0207651_11302781 3300025960 Bacteria 653
248 Ga0207712_10008364 3300025961 Bacteria 6538
249 Ga0207712_10138887 3300025961 Bacteria 1862
250 Ga0207712_10595654 3300025961 Bacteria 956
251 Ga0207668_10020424 3300025972 Bacteria 4208
252 Ga0207640_10224620 3300025981 Bacteria 1440
253 Ga0207658_11253191 3300025986 Bacteria 678
254 Ga0207677_10002533 3300026023 Bacteria 9581
255 Ga0207703_10190956 3300026035 Bacteria 1814
256 Ga0207703_10254045 3300026035 Bacteria 1586
257 Ga0207703_10411688 3300026035 Bacteria 1256
258 Ga0207639_10152707 3300026041 Bacteria 1936
259 Ga0207708_10000309 3300026075 Bacteria 38568
260 Ga0207708_10004105 3300026075 Bacteria 10715
261 Ga0207708_10073003 3300026075 Bacteria 2630
262 Ga0207708_10772467 3300026075 Bacteria 826
263 Ga0207702_10095825 3300026078 Bacteria 2608
264 Ga0207702_10102362 3300026078 Bacteria 2531
265 Ga0207641_10337989 3300026088 Bacteria 1432
266 Ga0207648_10000201 3300026089 Bacteria 63324
267 Ga0207648_10012174 3300026089 Bacteria 8060
268 Ga0207648_10516139 3300026089 Bacteria 1094
269 Ga0207676_11059706 3300026095 Bacteria 800
270 Ga0207674_10298275 3300026116 Bacteria 1561
271 Ga0207675_100005863 3300026118 Bacteria 11731
272 Ga0207675_100030170 3300026118 Bacteria 5050
273 Ga0207675_102154332 3300026118 Bacteria 573
274 Ga0207698_10061726 3300026142 Bacteria 2923
275 Ga0209969_1001487 3300027360 Bacteria 3234
276 Ga0209967_1000705 3300027364 Bacteria 4309
277 Ga0209981_1017222 3300027378 Bacteria 1019
278 Ga0209996_1002177 3300027395 Bacteria 2418
279 Ga0210000_1001031 3300027462 Bacteria 3888
280 Ga0209995_1005013 3300027471 Bacteria 2125
281 Ga0209968_1001859 3300027526 Bacteria 3207
282 Ga0209999_1005264 3300027543 Bacteria 2326
283 Ga0210002_1013187 3300027617 Bacteria 1288
284 Ga0209983_1017108 3300027665 Bacteria 1499
285 Ga0209588_1104182 3300027671 Unclassified 912
286 Ga0209966_1026233 3300027695 Bacteria 1160
287 Ga0207428_10000488 3300027907 Bacteria 47436
288 Ga0207428_10043575 3300027907 Bacteria 3623
289 Ga0207428_10086191 3300027907 Bacteria 2444
290 Ga0268265_10008297 3300028380 Bacteria 7016
291 Ga0268265_10018115 3300028380 Bacteria 4875
292 Ga0268264_10014601 3300028381 Bacteria 6452
293 Ga0268264_10084978 3300028381 Bacteria 2715
294 Ga0268264_10467092 3300028381 Bacteria 1225
295 Ga0307509_10678013 3300031507 Bacteria 698
296 Ga0307408_100469761 3300031548 Bacteria 1095
297 Ga0307408_100512715 3300031548 Bacteria 1052
298 Ga0316575_10003825 3300031665 Bacteria 5246
299 Ga0316575_10019413 3300031665 Bacteria 2599
300 Ga0316579_10006874 3300031691 Bacteria 4668
301 Ga0316578_10015296 3300031728 Bacteria 4122
302 Ga0307405_10476784 3300031731 Unclassified 995
303 Ga0307406_10573035 3300031901 Bacteria 927
304 Ga0307412_10268786 3300031911 Bacteria 1333
305 Ga0307409_100809962 3300031995 Bacteria 945
306 Ga0307409_100852412 3300031995 Bacteria 922
307 Ga0307416_100087565 3300032002 Bacteria 2659
308 Ga0307416_101565669 3300032002 Bacteria 765
309 Ga0307416_102110057 3300032002 Bacteria 665
310 Ga0307416_102736060 3300032002 Bacteria 590
311 Ga0307411_10214362 3300032005 Bacteria 1489
312 Ga0307415_101381314 3300032126 Bacteria 670
313 Ga0316583_10007590 3300032133 Bacteria 3905
314 Ga0373930_0003129 3300034816 Bacteria 2608
315 Ga0373948_0010188 3300034817 Bacteria 1637
316 Ga0373950_0020204 3300034818 Bacteria 1170
317 Ga0373958_0031986 3300034819 Bacteria 1037
318 Ga0373959_0086200 3300034820 Bacteria 730
319 Ga0373938_0002744 3300034957 Bacteria 2843
320 Ga0373929_0018097 3300035085 Bacteria 1397
321 Ga0373934_0138462 3300035086 Unclassified 995
322 Ga0373940_0063054 3300035088 Bacteria 1064
323 Ga0373944_0005579 3300035089 Bacteria 3317
324 Ga0373949_0007903 3300035090 Bacteria 2330
325 Ga0373949_0210426 3300035090 Bacteria 587
326 Ga0373951_0041918 3300035091 Bacteria 1106
327 Ga0373951_0053325 3300035091 Bacteria 999
328 Ga0373923_0068092 3300035111 Bacteria 1524
329 Ga0373932_0071955 3300035112 Bacteria 1074
330 Ga0373936_0019063 3300035113 Bacteria 2656
331 Ga0373939_0013359 3300035114 Bacteria 2111
332 Ga0373941_0014374 3300035115 Bacteria 2113
333 Ga0373941_0037651 3300035115 Bacteria 1477
334 Ga0373941_0093089 3300035115 Bacteria 1037
335 Ga0373945_0005526 3300035116 Bacteria 4049
336 Ga0373953_0019007 3300035117 Bacteria 2551
337 Ga0373954_0000122 3300035118 Bacteria 26268
338 Ga0373954_0295309 3300035118 Bacteria 799
339 Ga0373960_0008200 3300035121 Bacteria 2497
340 Ga0373960_0016137 3300035121 Bacteria 1917
341 Ga0373960_0020423 3300035121 Bacteria 1751
342 Ga0373960_0123655 3300035121 Bacteria 861
343 Ga0373943_0177989 3300035170 Bacteria 1167
344 Ga0373946_0024756 3300035171 Bacteria 2355
345 Ga0373955_0040645 3300035172 Bacteria 2488
346 Ga0373955_0114165 3300035172 Bacteria 1564
347 Ga0373942_0002546 3300035207 Bacteria 4410
348 Ga0373942_0004554 3300035207 Bacteria 3215
349 Ga0373942_0073765 3300035207 Bacteria 1001
350 Ga0373961_0005386 3300035241 Bacteria 3075
351 Ga0373961_0326186 3300035241 Unclassified 574
352 Ga0373962_0025346 3300035242 Bacteria 1592
353 Ga0316574_0000711 3300035398 Bacteria 14209
354 Ga0373924_0035686 3300035410 Bacteria 2017
355 Ga0373931_0001278 3300035691 Bacteria 10741
356 Ga0373931_0001293 3300035691 Bacteria 10707
357 Ga0373931_0023160 3300035691 Bacteria 3134
358 Ga0373931_0026328 3300035691 Bacteria 2960
359 Ga0373931_0030060 3300035691 Bacteria 2794
360 Ga0373931_0159185 3300035691 Bacteria 1322
361 Ga0373931_0786391 3300035691 Unclassified 634
362 Ga0373935_0056703 3300035692 Bacteria 2498
363 Ga0373927_0025615 3300035695 Bacteria 3856
364 Ga0373933_0008724 3300035724 Bacteria 5528
365 Ga0373937_0001354 3300036401 Bacteria 20511
366 Ga0373937_0026477 3300036401 Bacteria 5241
367 Ga0373937_0492971 3300036401 Bacteria 1164
368 Ga0373937_0897869 3300036401 Bacteria 835
369 Ga0316582_0032834 3300036647 Bacteria 3183
370 Ga0316581_0013328 3300037588 Bacteria 2329
371 Ga0439461_0003859 3300041410 Bacteria 2480
372 Ga0439466_0073643 3300041411 Bacteria 1085
373 Ga0450910_058415 3300042147 Bacteria 648
374 Ga0439446_0014794 3300042156 Bacteria 2158
375 Ga0439434_0000433 3300042435 Bacteria 11919
376 Ga0439435_0000369 3300042436 Bacteria 6881
377 Ga0439444_0174832 3300042437 Bacteria 530
378 Ga0451577_0782164 3300042876 Bacteria 862
379 Ga0451577_0990324 3300042876 Bacteria 755
380 Ga0451577_1841467 3300042876 Unclassified 531
381 Ga0466968_0043022 3300044735 Bacteria 1911
382 Ga0451576_0000926 3300045051 Bacteria 55382
383 Ga0451576_0003728 3300045051 Bacteria 20610
384 Ga0451576_0018686 3300045051 Bacteria 7583
385 Ga0451576_0025473 3300045051 Bacteria 6371
386 Ga0451576_0069538 3300045051 Bacteria 3664
387 Ga0451576_0526092 3300045051 Bacteria 1242
388 Ga0451576_1950980 3300045051 Bacteria 605
389 Ga0495603_0010132 3300046455 Bacteria 5704
390 Ga0495651_0201810 3300046462 Unclassified 1391
391 Ga0495651_0211382 3300046462 Bacteria 1350
392 Ga0495653_0278764 3300046463 Bacteria 1098
393 Ga0495580_0003339 3300046472 Bacteria 13722
394 Ga0495582_0060711 3300046473 Bacteria 2086
395 Ga0495582_0398949 3300046473 Bacteria 793
396 Ga0495639_0018592 3300046475 Bacteria 3027
397 Ga0495608_0017362 3300046511 Bacteria 4979
398 Ga0495608_0623459 3300046511 Bacteria 646
399 Ga0495628_0027266 3300046516 Bacteria 4650
400 Ga0495628_0678821 3300046516 Unclassified 729
401 Ga0495630_0110797 3300046517 Bacteria 2079
402 Ga0495630_0587618 3300046517 Bacteria 854
403 Ga0495666_0028992 3300046526 Bacteria 2723
404 Ga0495666_0037346 3300046526 Bacteria 2363
405 Ga0495642_0052995 3300046528 Bacteria 1671
406 Ga0495642_0283970 3300046528 Unclassified 725
407 Ga0495652_0684910 3300046529 Viruses 691
408 Ga0495640_0020736 3300046533 Bacteria 4833
409 Ga0495586_0006427 3300046535 Bacteria 6278
410 Ga0495586_0014038 3300046535 Bacteria 4253
411 Ga0495586_0115881 3300046535 Bacteria 1494
412 Ga0495587_0148156 3300046536 Bacteria 1338
413 Ga0495598_0037006 3300046537 Bacteria 1406
414 Ga0495598_0141090 3300046537 Bacteria 834
415 Ga0495609_0179373 3300046538 Bacteria 892
416 Ga0495621_0018603 3300046539 Bacteria 2258
417 Ga0495667_0260196 3300046559 Bacteria 1104
418 Ga0495667_0343206 3300046559 Bacteria 944
419 Ga0495656_0655298 3300046615 Unclassified 564
420 Ga0495634_0018076 3300046642 Bacteria 5023
421 Ga0495635_0081950 3300046663 Bacteria 2208
422 Ga0495635_0102692 3300046663 Bacteria 1954
423 Ga0495588_0008932 3300046674 Bacteria 4614
424 Ga0495646_0220899 3300046680 Bacteria 1025
425 Ga0495647_0013009 3300046681 Bacteria 2875
426 Ga0495647_0209192 3300046681 Unclassified 858
427 Ga0495658_0002651 3300046683 Bacteria 8997
428 Ga0495658_0106936 3300046683 Bacteria 1677
429 Ga0495658_0500161 3300046683 Bacteria 777
430 Ga0495669_0012443 3300046684 Bacteria 3622
431 Ga0495613_0075185 3300046689 Bacteria 2459
432 Ga0495581_0483904 3300047315 Bacteria 720
433 Ga0495604_0162246 3300047317 Bacteria 1578
434 Ga0495674_0143370 3300047319 Bacteria 2007
435 Ga0495676_0027464 3300047321 Bacteria 4878
436 Ga0495680_0004158 3300047322 Bacteria 13914
437 Ga0495680_0091373 3300047322 Bacteria 2282
438 Ga0495675_0195663 3300047444 Bacteria 1233
439 Ga0495684_0149234 3300047471 Bacteria 1749
440 Ga0495684_0372937 3300047471 Bacteria 1008
441 Ga0495615_0285791 3300048090 Bacteria 531
442 Ga0501031_0078129 3300049568 Bacteria 2156
443 Ga0501032_0258930 3300049569 Bacteria 1128
444 Ga0501033_0123755 3300049570 Bacteria 1875
445 Ga0501036_0000578 3300049572 Bacteria 26441
446 Ga0501036_0244458 3300049572 Bacteria 1505
447 Ga0501036_0528153 3300049572 Bacteria 981
448 Ga0501037_0558087 3300049573 Unclassified 772
449 Ga0501038_0000612 3300049574 Bacteria 31789
450 Ga0501039_0000577 3300049575 Bacteria 26507
451 Ga0501040_0017964 3300049576 Bacteria 4694
452 Ga0501040_0295736 3300049576 Bacteria 1157
453 Ga0501041_0000488 3300049577 Bacteria 20258
454 Ga0501041_0039739 3300049577 Bacteria 2855
455 Ga0501042_0077979 3300049578 Bacteria 2372
456 Ga0501043_0047835 3300049579 Bacteria 3363
457 Ga0501046_0000987 3300049580 Bacteria 27829
458 Ga0501047_0643114 3300049581 Bacteria 880
459 Ga0501068_0079304 3300049584 Bacteria 2013
460 Ga0501068_0150729 3300049584 Unclassified 1461
461 Ga0501068_0317074 3300049584 Bacteria 999
462 Ga0501069_0235727 3300049585 Unclassified 1066
463 Ga0501069_0577338 3300049585 Bacteria 674
464 Ga0501070_0242250 3300049586 Bacteria 1476
465 Ga0501070_0333340 3300049586 Unclassified 1233
466 Ga0501071_0038461 3300049587 Bacteria 3419
467 Ga0501071_0101930 3300049587 Bacteria 2116
468 Ga0501071_0145189 3300049587 Bacteria 1768
469 Ga0501072_0013248 3300049588 Bacteria 6315
470 Ga0501073_0125047 3300049589 Bacteria 1783
471 Ga0501073_0751006 3300049589 Bacteria 673
472 Ga0501074_0012046 3300049590 Bacteria 6282
473 Ga0501074_0257339 3300049590 Unclassified 1241
474 Ga0501075_0000175 3300049591 Bacteria 33306
475 Ga0501075_0063517 3300049591 Bacteria 2784
476 Ga0501076_0010092 3300049592 Bacteria 6991
477 Ga0501076_0437570 3300049592 Bacteria 1076
478 Ga0501076_0473862 3300049592 Bacteria 1031
479 Ga0501077_0003314 3300049593 Bacteria 9691
480 Ga0501077_0306130 3300049593 Bacteria 1013
481 Ga0501077_0364272 3300049593 Bacteria 923
482 Ga0501199_039359 3300049650 Bacteria 608
483 Ga0501233_023973 3300049668 Bacteria 1331
484 Ga0501079_0004509 3300049741 Bacteria 10327
485 Ga0501079_0159664 3300049741 Unclassified 1758
486 Ga0501079_0342902 3300049741 Bacteria 1170
487 Ga0501080_0029506 3300049742 Bacteria 5106
488 Ga0501080_0763765 3300049742 Bacteria 849
489 Ga0501080_1064503 3300049742 Unclassified 699
490 Ga0501081_0297417 3300049743 Bacteria 1184
491 Ga0501081_0657956 3300049743 Bacteria 785
492 Ga0501083_0185453 3300049744 Unclassified 1358
493 Ga0501035_0084080 3300049822 Bacteria 2807
494 Ga0501045_0005542 3300049824 Bacteria 8730
495 Ga0501045_0051863 3300049824 Bacteria 2994
496 nmdc:mga0k408_504710_c1 3300050493 Bacteria 716
497 nmdc:mga05p37_1041540_c1 3300050507 Unclassified 864
498 nmdc:mga05p37_152115_c1 3300050507 Bacteria 2829
499 nmdc:mga05p37_159_c1 3300050507 Bacteria 65013
500 nmdc:mga05p37_1623500_c1 3300050507 Bacteria 635
501 nmdc:mga05p37_456_c1 3300050507 Bacteria 44536
502 nmdc:mga05p37_839336_c1 3300050507 Bacteria 999
503 nmdc:mga05p37_859270_c1 3300050507 Bacteria 984
504 nmdc:mga09592_176692_c1 3300050508 Bacteria 1847
505 nmdc:mga09592_2078_c1 3300050508 Bacteria 16160
506 nmdc:mga09592_39391_c1 3300050508 Bacteria 3970
507 nmdc:mga09592_4316_c1 3300050508 Bacteria 11489
508 nmdc:mga0qj67_208963_c1 3300050509 Bacteria 1586
509 nmdc:mga0qj67_363888_c1 3300050509 Unclassified 1169
510 nmdc:mga0qj67_53874_c1 3300050509 Bacteria 3185
511 nmdc:mga06r32_1312543_c1 3300050510 Unclassified 667
512 nmdc:mga06r32_16288_c1 3300050510 Bacteria 6771
513 nmdc:mga06r32_274396_c1 3300050510 Bacteria 1674
514 nmdc:mga06r32_435438_c1 3300050510 Bacteria 1292
515 nmdc:mga08y16_149091_c1 3300050511 Bacteria 2432
516 nmdc:mga08y16_195671_c1 3300050511 Bacteria 2096
517 nmdc:mga08y16_250490_c1 3300050511 Bacteria 1830
518 nmdc:mga08y16_362327_c1 3300050511 Bacteria 1488
519 nmdc:mga08y16_7665_c1 3300050511 Bacteria 11298
520 nmdc:mga0n895_159202_c1 3300050512 Bacteria 2289
521 nmdc:mga0n895_2276_c1 3300050512 Bacteria 14895
522 nmdc:mga0n895_282_c1 3300050512 Bacteria 33514
523 nmdc:mga0n895_319014_c1 3300050512 Bacteria 1575
524 nmdc:mga0n895_940091_c1 3300050512 Bacteria 848
525 nmdc:mga0rr50_102680_c1 3300050513 Bacteria 2249
526 nmdc:mga0rr50_1259483_c1 3300050513 Unclassified 628
527 nmdc:mga0rr50_143041_c1 3300050513 Bacteria 1926
528 nmdc:mga0rr50_2724_c1 3300050513 Bacteria 10019
529 nmdc:mga0rr50_286288_c1 3300050513 Bacteria 1376
530 nmdc:mga0rr50_32486_c1 3300050513 Bacteria 3720
531 nmdc:mga0rr50_4021_c1 3300050513 Bacteria 8580
532 nmdc:mga0rr50_402301_c1 3300050513 Unclassified 1157
533 nmdc:mga08x19_118523_c1 3300050514 Bacteria 1772
534 nmdc:mga08x19_1585_c1 3300050514 Bacteria 14115
535 nmdc:mga08x19_18477_c1 3300050514 Bacteria 4272
536 nmdc:mga08x19_18558_c1 3300050514 Bacteria 4262
537 nmdc:mga08x19_322499_c1 3300050514 Unclassified 1075
538 nmdc:mga08x19_3796_c1 3300050514 Bacteria 8988
539 nmdc:mga08x19_412023_c1 3300050514 Bacteria 949
540 nmdc:mga0a205_115454_c1 3300050515 Bacteria 2583
541 nmdc:mga0a205_262421_c1 3300050515 Bacteria 1605
542 nmdc:mga0a205_274578_c1 3300050515 Bacteria 1562
543 nmdc:mga0a205_297135_c1 3300050515 Bacteria 1488
544 nmdc:mga0a205_299114_c1 3300050515 Bacteria 1482
545 nmdc:mga0a205_5582_c1 3300050515 Bacteria 11330
546 nmdc:mga0a205_685528_c1 3300050515 Bacteria 875
547 nmdc:mga0a205_923564_c1 3300050515 Unclassified 719
548 Ga0495619_0174240 3300053085 Bacteria 1488
549 Ga0501084_0022186 3300054114 Bacteria 5297
550 Ga0501084_0255358 3300054114 Bacteria 1480
551 Ga0590071_007995 3300059421 Bacteria 2498
552 Ga0501082_0184470 3300060353 Bacteria 1815
553 Ga0501082_0244536 3300060353 Bacteria 1561
554 Ga0501082_0777323 3300060353 Unclassified 838
555 Ga0530510_0094745 3300061734 Bacteria 2180
556 Ga0530510_0170561 3300061734 Bacteria 1612
557 Ga0495592_0022772
558 Ga0065704_10182312
559 Ga0065707_10020838
560 Ga0065707_10437792
561 Ga0070676_10331372
562 Ga0070690_100002266
563 Ga0070690_100057208
564 Ga0070690_100332288
565 Ga0070690_101120058
566 Ga0068869_100021701
567 Ga0070666_10879242
568 Ga0070680_100000721
569 Ga0070680_100462681
570 Ga0070680_101109103
571 Ga0070682_100002017
572 Ga0068868_100004853
573 Ga0070689_100012149
574 Ga0070689_100070456
575 Ga0070689_100142100
576 Ga0070691_10008100
577 Ga0070687_100000778
578 Ga0070687_100360025
579 Ga0070687_100455185
580 Ga0070692_10006855
581 Ga0070668_100048031
582 Ga0070669_100006224
583 Ga0070675_100124311
584 Ga0070674_100124925
585 Ga0070674_100375472
586 Ga0070673_100735289
587 Ga0070673_101383296
588 Ga0070688_100104044
589 Ga0070667_100445903
590 Ga0070703_10025288
591 Ga0070703_10112629
592 Ga0070709_11142383
593 Ga0070714_100195558
594 Ga0070713_100312577
595 Ga0070713_100760603
596 Ga0070710_10183639
597 Ga0070701_10001015
598 Ga0070701_10238508
599 Ga0070705_100000157
600 Ga0070705_100019927
601 Ga0070705_100083355
602 Ga0070705_100215654
603 Ga0070705_100224875
604 Ga0070700_100015122
605 Ga0070700_100426779
606 Ga0070694_100001988
607 Ga0070694_100126727
608 Ga0070694_100133733
609 Ga0070694_100349877
610 Ga0070694_100492918
611 Ga0070708_100529151
612 Ga0070681_10552770
613 Ga0070681_10738039
614 Ga0070681_11234642
615 Ga0068867_100004756
616 Ga0070706_100478105
617 Ga0070706_101064324
618 Ga0070707_100383379
619 Ga0070707_100433112
620 Ga0070707_100691196
621 Ga0070698_100005865
622 Ga0070699_100056970
623 Ga0070679_100101428
624 Ga0070684_100223848
625 Ga0070684_100450098
626 Ga0070697_100333263
627 Ga0068853_100212917
628 Ga0070686_100000463
629 Ga0070686_100118961
630 Ga0070686_100555511
631 Ga0070695_100000269
632 Ga0070695_100014071
633 Ga0070696_100000099
634 Ga0070696_100070458
635 Ga0070696_100078622
636 Ga0070696_100083260
637 Ga0070696_100189320
638 Ga0070696_100577361
639 Ga0070693_100000073
640 Ga0070693_100113095
641 Ga0070693_100211061
642 Ga0070704_100000023
643 Ga0070704_100007141
644 Ga0070704_100354494
645 Ga0068855_100033265
646 Ga0068855_100876173
647 Ga0068854_100253563
648 Ga0068856_100024672
649 Ga0070702_100000431
650 Ga0070702_100145708
651 Ga0068859_100008340
652 Ga0068859_100809032
653 Ga0068859_101029164
654 Ga0068864_100912124
655 Ga0068864_102127004
656 Ga0068866_10000066
657 Ga0068866_10719201
658 Ga0068861_100002311
659 Ga0068861_100003879
660 Ga0068861_100848277
661 Ga0068863_100499701
662 Ga0068863_100762717
663 Ga0068858_100006844
664 Ga0068858_100132746
665 Ga0068858_100175277
666 Ga0068860_100009194
667 Ga0068862_100004410
668 Ga0068862_100007495
669 Ga0081539_10000308
670 Ga0070715_10151346
671 Ga0070715_10241632
672 Ga0070715_10300694
673 Ga0070716_100747398
674 Ga0075366_10206572
675 Ga0097621_100002382
676 Ga0097621_100078801
677 Ga0068871_100031783
678 Ga0068871_100197525
679 Ga0068871_100811609
680 Ga0068871_101339382
681 Ga0075428_100000181
682 Ga0075428_100023206
683 Ga0075428_100391619
684 Ga0075430_100035345
685 Ga0075430_100195280
686 Ga0075430_100251146
687 Ga0075431_100001959
688 Ga0075431_100816835
689 Ga0075433_10008488
690 Ga0075433_10178658
691 Ga0075433_10588687
692 Ga0075434_100000030
693 Ga0075434_100005182
694 Ga0075434_100132672
695 Ga0075434_100151711
696 Ga0075434_101482603
697 Ga0075429_100000435
698 Ga0075429_100000544
699 Ga0068865_100000102
700 Ga0068865_100087949
701 Ga0068865_100309145
702 Ga0075436_100000267
703 Ga0075436_100001501
704 Ga0075436_100013917
705 Ga0075436_100015140
706 Ga0075436_100037479
707 Ga0075436_100090770
708 Ga0075436_100105951
709 Ga0075436_100304486
710 Ga0097620_100008340
711 Ga0097620_100809062
712 Ga0097620_101029217
713 Ga0075435_100001621
714 Ga0075435_100002107
715 Ga0075435_100002995
716 Ga0075435_100775013
717 Ga0099794_10209323
718 Ga0105250_10051142
719 Ga0111539_10028346
720 Ga0111539_10041148
721 Ga0111539_10305986
722 Ga0111539_10429918
723 Ga0111539_10536120
724 Ga0111539_10865001
725 Ga0111539_10973479
726 Ga0111539_11732945
727 Ga0105245_10055213
728 Ga0114129_10000190
729 Ga0114129_10010148
730 Ga0114129_10211609
731 Ga0114129_10722903
732 Ga0114129_11115346
733 Ga0114129_11507509
734 Ga0114129_11788786
735 Ga0105243_10000706
736 Ga0105242_10000306
737 Ga0105242_10086630
738 Ga0105242_10764817
739 Ga0105249_10016658
740 Ga0105249_10370377
741 Ga0105249_10690228
742 Ga0099796_10260729
743 Ga0105239_10218173
744 Ga0157371_10535161
745 Ga0157378_10000211
746 Ga0157378_10366130
747 Ga0163162_10037360
748 Ga0157372_10442571
749 Ga0157375_10422481
750 Ga0157380_10053736
751 Ga0157377_10054967
752 Ga0157377_10233447
753 Ga0157379_10283026
754 Ga0157376_10036299
755 Ga0157376_10089297
756 Ga0207653_10020803
757 Ga0207653_10028475
758 Ga0207692_10084477
759 Ga0207642_10001369
760 Ga0207642_10021196
761 Ga0207688_10083050
762 Ga0207680_10371339
763 Ga0207680_10715260
764 Ga0207699_10061091
765 Ga0207699_10496311
766 Ga0207645_10171177
767 Ga0207643_10086492
768 Ga0207707_10041942
769 Ga0207707_10164557
770 Ga0207660_10004471
771 Ga0207660_10101146
772 Ga0207662_10000080
773 Ga0207662_10075469
774 Ga0207662_10146151
775 Ga0207662_10362908
776 Ga0207652_10155657
777 Ga0207652_10340680
778 Ga0207646_10359575
779 Ga0207646_10525449
780 Ga0207646_11316560
781 Ga0207681_10005021
782 Ga0207687_10002107
783 Ga0207687_10032942
784 Ga0207700_10744314
785 Ga0207706_10327618
786 Ga0207686_10014978
787 Ga0207686_10135783
788 Ga0207709_10001290
789 Ga0207709_10175382
790 Ga0207670_10008457
791 Ga0207669_10174177
792 Ga0207669_10319313
793 Ga0207704_10005551
794 Ga0207704_10021458
795 Ga0207704_10945231
796 Ga0207665_11364319
797 Ga0207691_10047410
798 Ga0207689_10000972
799 Ga0207689_10359732
800 Ga0207661_10275990
801 Ga0207667_10071692
802 Ga0207651_10563460
803 Ga0207651_11302781
804 Ga0207712_10008364
805 Ga0207712_10138887
806 Ga0207712_10595654
807 Ga0207668_10020424
808 Ga0207640_10224620
809 Ga0207658_11253191
810 Ga0207677_10002533
811 Ga0207703_10190956
812 Ga0207703_10254045
813 Ga0207703_10411688
814 Ga0207639_10152707
815 Ga0207708_10000309
816 Ga0207708_10004105
817 Ga0207708_10073003
818 Ga0207708_10772467
819 Ga0207702_10095825
820 Ga0207702_10102362
821 Ga0207641_10337989
822 Ga0207648_10000201
823 Ga0207648_10012174
824 Ga0207648_10516139
825 Ga0207676_11059706
826 Ga0207674_10298275
827 Ga0207675_100005863
828 Ga0207675_100030170
829 Ga0207675_102154332
830 Ga0207698_10061726
831 Ga0209969_1001487
832 Ga0209967_1000705
833 Ga0209981_1017222
834 Ga0209996_1002177
835 Ga0210000_1001031
836 Ga0209995_1005013
837 Ga0209968_1001859
838 Ga0209999_1005264
839 Ga0210002_1013187
840 Ga0209983_1017108
841 Ga0209588_1104182
842 Ga0209966_1026233
843 Ga0207428_10000488
844 Ga0207428_10043575
845 Ga0207428_10086191
846 Ga0268265_10008297
847 Ga0268265_10018115
848 Ga0268264_10014601
849 Ga0268264_10084978
850 Ga0268264_10467092
851 Ga0307509_10678013
852 Ga0307408_100469761
853 Ga0307408_100512715
854 Ga0316575_10003825
855 Ga0316575_10019413
856 Ga0316579_10006874
857 Ga0316578_10015296
858 Ga0307405_10476784
859 Ga0307406_10573035
860 Ga0307412_10268786
861 Ga0307409_100809962
862 Ga0307409_100852412
863 Ga0307416_100087565
864 Ga0307416_101565669
865 Ga0307416_102110057
866 Ga0307416_102736060
867 Ga0307411_10214362
868 Ga0307415_101381314
869 Ga0316583_10007590
870 Ga0373930_0003129
871 Ga0373948_0010188
872 Ga0373950_0020204
873 Ga0373958_0031986
874 Ga0373959_0086200
875 Ga0373938_0002744
876 Ga0373929_0018097
877 Ga0373934_0138462
878 Ga0373940_0063054
879 Ga0373944_0005579
880 Ga0373949_0007903
881 Ga0373949_0210426
882 Ga0373951_0041918
883 Ga0373951_0053325
884 Ga0373923_0068092
885 Ga0373932_0071955
886 Ga0373936_0019063
887 Ga0373939_0013359
888 Ga0373941_0014374
889 Ga0373941_0037651
890 Ga0373941_0093089
891 Ga0373945_0005526
892 Ga0373953_0019007
893 Ga0373954_0000122
894 Ga0373954_0295309
895 Ga0373960_0008200
896 Ga0373960_0016137
897 Ga0373960_0020423
898 Ga0373960_0123655
899 Ga0373943_0177989
900 Ga0373946_0024756
901 Ga0373955_0040645
902 Ga0373955_0114165
903 Ga0373942_0002546
904 Ga0373942_0004554
905 Ga0373942_0073765
906 Ga0373961_0005386
907 Ga0373961_0326186
908 Ga0373962_0025346
909 Ga0316574_0000711
910 Ga0373924_0035686
911 Ga0373931_0001278
912 Ga0373931_0001293
913 Ga0373931_0023160
914 Ga0373931_0026328
915 Ga0373931_0030060
916 Ga0373931_0159185
917 Ga0373931_0786391
918 Ga0373935_0056703
919 Ga0373927_0025615
920 Ga0373933_0008724
921 Ga0373937_0001354
922 Ga0373937_0026477
923 Ga0373937_0492971
924 Ga0373937_0897869
925 Ga0316582_0032834
926 Ga0316581_0013328
927 Ga0439461_0003859
928 Ga0439466_0073643
929 Ga0450910_058415
930 Ga0439446_0014794
931 Ga0439434_0000433
932 Ga0439435_0000369
933 Ga0439444_0174832
934 Ga0451577_0782164
935 Ga0451577_0990324
936 Ga0451577_1841467
937 Ga0466968_0043022
938 Ga0451576_0000926
939 Ga0451576_0003728
940 Ga0451576_0018686
941 Ga0451576_0025473
942 Ga0451576_0069538
943 Ga0451576_0526092
944 Ga0451576_1950980
945 Ga0495603_0010132
946 Ga0495651_0201810
947 Ga0495651_0211382
948 Ga0495653_0278764
949 Ga0495580_0003339
950 Ga0495582_0060711
951 Ga0495582_0398949
952 Ga0495639_0018592
953 Ga0495608_0017362
954 Ga0495608_0623459
955 Ga0495628_0027266
956 Ga0495628_0678821
957 Ga0495630_0110797
958 Ga0495630_0587618
959 Ga0495666_0028992
960 Ga0495666_0037346
961 Ga0495642_0052995
962 Ga0495642_0283970
963 Ga0495652_0684910
964 Ga0495640_0020736
965 Ga0495586_0006427
966 Ga0495586_0014038
967 Ga0495586_0115881
968 Ga0495587_0148156
969 Ga0495598_0037006
970 Ga0495598_0141090
971 Ga0495609_0179373
972 Ga0495621_0018603
973 Ga0495667_0260196
974 Ga0495667_0343206
975 Ga0495656_0655298
976 Ga0495634_0018076
977 Ga0495635_0081950
978 Ga0495635_0102692
979 Ga0495588_0008932
980 Ga0495646_0220899
981 Ga0495647_0013009
982 Ga0495647_0209192
983 Ga0495658_0002651
984 Ga0495658_0106936
985 Ga0495658_0500161
986 Ga0495669_0012443
987 Ga0495613_0075185
988 Ga0495581_0483904
989 Ga0495604_0162246
990 Ga0495674_0143370
991 Ga0495676_0027464
992 Ga0495680_0004158
993 Ga0495680_0091373
994 Ga0495675_0195663
995 Ga0495684_0149234
996 Ga0495684_0372937
997 Ga0495615_0285791
998 Ga0501031_0078129
999 Ga0501032_0258930
1000 Ga0501033_0123755
1001 Ga0501036_0000578
1002 Ga0501036_0244458
1003 Ga0501036_0528153
1004 Ga0501037_0558087
1005 Ga0501038_0000612
1006 Ga0501039_0000577
1007 Ga0501040_0017964
1008 Ga0501040_0295736
1009 Ga0501041_0000488
1010 Ga0501041_0039739
1011 Ga0501042_0077979
1012 Ga0501043_0047835
1013 Ga0501046_0000987
1014 Ga0501047_0643114
1015 Ga0501068_0079304
1016 Ga0501068_0150729
1017 Ga0501068_0317074
1018 Ga0501069_0235727
1019 Ga0501069_0577338
1020 Ga0501070_0242250
1021 Ga0501070_0333340
1022 Ga0501071_0038461
1023 Ga0501071_0101930
1024 Ga0501071_0145189
1025 Ga0501072_0013248
1026 Ga0501073_0125047
1027 Ga0501073_0751006
1028 Ga0501074_0012046
1029 Ga0501074_0257339
1030 Ga0501075_0000175
1031 Ga0501075_0063517
1032 Ga0501076_0010092
1033 Ga0501076_0437570
1034 Ga0501076_0473862
1035 Ga0501077_0003314
1036 Ga0501077_0306130
1037 Ga0501077_0364272
1038 Ga0501199_039359
1039 Ga0501233_023973
1040 Ga0501079_0004509
1041 Ga0501079_0159664
1042 Ga0501079_0342902
1043 Ga0501080_0029506
1044 Ga0501080_0763765
1045 Ga0501080_1064503
1046 Ga0501081_0297417
1047 Ga0501081_0657956
1048 Ga0501083_0185453
1049 Ga0501035_0084080
1050 Ga0501045_0005542
1051 Ga0501045_0051863
1052 nmdc:mga0k408_504710_c1
1053 nmdc:mga05p37_1041540_c1
1054 nmdc:mga05p37_152115_c1
1055 nmdc:mga05p37_159_c1
1056 nmdc:mga05p37_1623500_c1
1057 nmdc:mga05p37_456_c1
1058 nmdc:mga05p37_839336_c1
1059 nmdc:mga05p37_859270_c1
1060 nmdc:mga09592_176692_c1
1061 nmdc:mga09592_2078_c1
1062 nmdc:mga09592_39391_c1
1063 nmdc:mga09592_4316_c1
1064 nmdc:mga0qj67_208963_c1
1065 nmdc:mga0qj67_363888_c1
1066 nmdc:mga0qj67_53874_c1
1067 nmdc:mga06r32_1312543_c1
1068 nmdc:mga06r32_16288_c1
1069 nmdc:mga06r32_274396_c1
1070 nmdc:mga06r32_435438_c1
1071 nmdc:mga08y16_149091_c1
1072 nmdc:mga08y16_195671_c1
1073 nmdc:mga08y16_250490_c1
1074 nmdc:mga08y16_362327_c1
1075 nmdc:mga08y16_7665_c1
1076 nmdc:mga0n895_159202_c1
1077 nmdc:mga0n895_2276_c1
1078 nmdc:mga0n895_282_c1
1079 nmdc:mga0n895_319014_c1
1080 nmdc:mga0n895_940091_c1
1081 nmdc:mga0rr50_102680_c1
1082 nmdc:mga0rr50_1259483_c1
1083 nmdc:mga0rr50_143041_c1
1084 nmdc:mga0rr50_2724_c1
1085 nmdc:mga0rr50_286288_c1
1086 nmdc:mga0rr50_32486_c1
1087 nmdc:mga0rr50_4021_c1
1088 nmdc:mga0rr50_402301_c1
1089 nmdc:mga08x19_118523_c1
1090 nmdc:mga08x19_1585_c1
1091 nmdc:mga08x19_18477_c1
1092 nmdc:mga08x19_18558_c1
1093 nmdc:mga08x19_322499_c1
1094 nmdc:mga08x19_3796_c1
1095 nmdc:mga08x19_412023_c1
1096 nmdc:mga0a205_115454_c1
1097 nmdc:mga0a205_262421_c1
1098 nmdc:mga0a205_274578_c1
1099 nmdc:mga0a205_297135_c1
1100 nmdc:mga0a205_299114_c1
1101 nmdc:mga0a205_5582_c1
1102 nmdc:mga0a205_685528_c1
1103 nmdc:mga0a205_923564_c1
1104 Ga0495619_0174240
1105 Ga0501084_0022186
1106 Ga0501084_0255358
1107 Ga0590071_007995
1108 Ga0501082_0184470
1109 Ga0501082_0244536
1110 Ga0501082_0777323
1111 Ga0530510_0094745
1112 Ga0530510_0170561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gek-assembly2.cif.gz_A crystal structure of putative thioesterase yhda from lactococcus lactis. northeast structural genomics consortium target kr113 0.838 91 149
8hgn-assembly1.cif.gz_A crystal structure of meac (mesaconyl-coa hydratase) 0.8106 8 151
4e3e-assembly1.cif.gz_A crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl 0.809 8 151
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.7861 8 151
2bi0-assembly1.cif.gz_A rv0216, a conserved hypothetical protein from mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdogfold 0.7804 8 151
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8264 91 149 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8089 7 151 3.10.129.10
3cjyA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8077 91 151 2.40.160.210
af_O01913_702_992_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8014 105 149 3.90.190.10
af_A0A1D8PLR8_89_286_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8013 91 151 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2R6D4F7-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9546 82 151
AF-A0A3B9VNE7-F1-model_v4 Dehydratase 0.9515 82 149
AF-A0A355PPI8-F1-model_v4 Dehydratase 0.9351 82 151
AF-A0A4Q3NL72-F1-model_v4 deleted 0.9165 83 151
AF-A0A094Q109-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9008 61 149

Map