F463224

General Info

Members Datasets Scaffolds Average Seq Length
556 243 1112 145

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10892317|Ga0268266_108923171
Length 155
Sequence MAFSVSNGNGSRSGLGRRRFGVGNGTLSEINIVPLVDVVLVXXIIFMLTAHVMEFGLEVQVPKVKQVKDSAEVLPVVTITRDGEVFLAEKPANVNSLAEEIRAKYPNAANAVYVRADKGTVWEPMAHVISALSEAKIDVRLVTQPEDEADKPRRR

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.9
Rhizosphere 97.66
Stem 0
Stem Tuber 0
Unclassified 8.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_10892317 3300028379 Bacteria 860
2 Ga0065707_10932408 3300005295 Unclassified 557
3 Ga0070658_10068122 3300005327 Bacteria 2909
4 Ga0070676_11122721 3300005328 Bacteria 595
5 Ga0070683_100145081 3300005329 Bacteria 2249
6 Ga0070683_100185009 3300005329 Bacteria 1977
7 Ga0070683_100613065 3300005329 Bacteria 1042
8 Ga0070683_101163229 3300005329 Bacteria 741
9 Ga0070690_100062895 3300005330 Bacteria 2394
10 Ga0070690_101292416 3300005330 Bacteria 584
11 Ga0070670_100479196 3300005331 Bacteria 1105
12 Ga0070666_10327792 3300005335 Bacteria 1093
13 Ga0070680_100254125 3300005336 Bacteria 1486
14 Ga0070680_100333646 3300005336 Bacteria 1288
15 Ga0068868_100058632 3300005338 Bacteria 3043
16 Ga0068868_100119955 3300005338 Bacteria 2144
17 Ga0070660_100005535 3300005339 Bacteria 8751
18 Ga0070660_100549830 3300005339 Bacteria 963
19 Ga0070689_100168326 3300005340 Unclassified 1775
20 Ga0070691_10202616 3300005341 Bacteria 1043
21 Ga0070661_100076181 3300005344 Bacteria 2472
22 Ga0070668_100770351 3300005347 Bacteria 853
23 Ga0070675_101158838 3300005354 Bacteria 711
24 Ga0070671_100376950 3300005355 Bacteria 1212
25 Ga0070674_100638122 3300005356 Bacteria 904
26 Ga0070674_100843309 3300005356 Bacteria 794
27 Ga0070673_101769810 3300005364 Bacteria 585
28 Ga0070688_101093970 3300005365 Unclassified 637
29 Ga0070688_101275300 3300005365 Unclassified 592
30 Ga0070667_100186073 3300005367 Bacteria 1838
31 Ga0070667_101416939 3300005367 Bacteria 652
32 Ga0070709_10055075 3300005434 Bacteria 2510
33 Ga0070709_10560878 3300005434 Bacteria 875
34 Ga0070709_10717708 3300005434 Bacteria 779
35 Ga0070714_100005407 3300005435 Bacteria 9747
36 Ga0070713_100011257 3300005436 Bacteria 6507
37 Ga0070713_100056316 3300005436 Bacteria 3271
38 Ga0070711_100027701 3300005439 Bacteria 3723
39 Ga0070708_100993190 3300005445 Bacteria 787
40 Ga0070708_101260252 3300005445 Unclassified 691
41 Ga0070678_100244156 3300005456 Bacteria 1503
42 Ga0070678_100346467 3300005456 Bacteria 1276
43 Ga0070678_101245893 3300005456 Bacteria 691
44 Ga0070681_10030481 3300005458 Bacteria 5412
45 Ga0070681_10057856 3300005458 Bacteria 3857
46 Ga0070681_10417849 3300005458 Bacteria 1253
47 Ga0070681_10522001 3300005458 Bacteria 1101
48 Ga0070681_10803635 3300005458 Bacteria 858
49 Ga0070681_10845226 3300005458 Bacteria 833
50 Ga0068867_100129202 3300005459 Bacteria 1962
51 Ga0068867_101487877 3300005459 Bacteria 630
52 Ga0070685_10065749 3300005466 Bacteria 2135
53 Ga0070685_10240416 3300005466 Bacteria 1195
54 Ga0070706_100194082 3300005467 Bacteria 1897
55 Ga0070698_100150998 3300005471 Bacteria 2271
56 Ga0070699_100085309 3300005518 Bacteria 2756
57 Ga0070684_100355027 3300005535 Bacteria 1349
58 Ga0070684_100396545 3300005535 Bacteria 1272
59 Ga0070684_100546516 3300005535 Bacteria 1075
60 Ga0070697_100140816 3300005536 Bacteria 2028
61 Ga0068853_100273187 3300005539 Bacteria 1557
62 Ga0068853_100339810 3300005539 Bacteria 1395
63 Ga0068853_101068984 3300005539 Bacteria 778
64 Ga0070686_101664529 3300005544 Bacteria 541
65 Ga0070696_100011499 3300005546 Bacteria 5928
66 Ga0070693_100663269 3300005547 Bacteria 760
67 Ga0070665_100060406 3300005548 Bacteria 3799
68 Ga0070665_100072450 3300005548 Bacteria 3453
69 Ga0070665_100302417 3300005548 Bacteria 1603
70 Ga0070665_100574335 3300005548 Bacteria 1140
71 Ga0070665_101033579 3300005548 Bacteria 834
72 Ga0068855_100115220 3300005563 Bacteria 3081
73 Ga0068855_100141840 3300005563 Bacteria 2738
74 Ga0068855_100452472 3300005563 Bacteria 1401
75 Ga0068855_101200002 3300005563 Bacteria 789
76 Ga0070664_100852752 3300005564 Bacteria 853
77 Ga0070664_100938392 3300005564 Bacteria 812
78 Ga0068857_100002833 3300005577 Bacteria 14260
79 Ga0068857_100022344 3300005577 Bacteria 5565
80 Ga0068857_100183847 3300005577 Bacteria 1902
81 Ga0068854_100478850 3300005578 Bacteria 1045
82 Ga0068856_100029477 3300005614 Bacteria 5361
83 Ga0068856_100056852 3300005614 Bacteria 3861
84 Ga0068856_100141233 3300005614 Bacteria 2415
85 Ga0068856_100216427 3300005614 Bacteria 1931
86 Ga0068852_100513694 3300005616 Bacteria 1194
87 Ga0068859_100545822 3300005617 Bacteria 1254
88 Ga0068859_100565796 3300005617 Bacteria 1231
89 Ga0068859_101054158 3300005617 Bacteria 894
90 Ga0068859_101456056 3300005617 Bacteria 756
91 Ga0068864_100028575 3300005618 Bacteria 4716
92 Ga0068864_100124148 3300005618 Bacteria 2312
93 Ga0068851_10170420 3300005834 Bacteria 1201
94 Ga0068870_10757396 3300005840 Bacteria 675
95 Ga0068863_100033555 3300005841 Bacteria 4890
96 Ga0068863_100033944 3300005841 Unclassified 4860
97 Ga0068863_100169313 3300005841 Bacteria 2095
98 Ga0068863_100194084 3300005841 Bacteria 1952
99 Ga0068863_100475705 3300005841 Bacteria 1228
100 Ga0068863_101682672 3300005841 Bacteria 644
101 Ga0068858_100019670 3300005842 Bacteria 6313
102 Ga0068858_100021243 3300005842 Bacteria 6063
103 Ga0068858_100520999 3300005842 Bacteria 1150
104 Ga0068858_100538395 3300005842 Bacteria 1130
105 Ga0068858_100604426 3300005842 Bacteria 1064
106 Ga0068860_100008713 3300005843 Bacteria 10103
107 Ga0068860_100456095 3300005843 Bacteria 1271
108 Ga0068860_102464441 3300005843 Unclassified 540
109 Ga0068862_100283792 3300005844 Bacteria 1518
110 Ga0070717_10003142 3300006028 Bacteria 11801
111 Ga0070717_10007583 3300006028 Bacteria 8063
112 Ga0070717_10011583 3300006028 Bacteria 6703
113 Ga0070717_10154977 3300006028 Unclassified 1984
114 Ga0070717_10425937 3300006028 Bacteria 1194
115 Ga0070717_11767484 3300006028 Bacteria 559
116 Ga0070717_12105375 3300006028 Bacteria 508
117 Ga0070715_10294992 3300006163 Bacteria 865
118 Ga0070716_100556856 3300006173 Bacteria 856
119 Ga0097621_100060842 3300006237 Bacteria 3096
120 Ga0097621_100115025 3300006237 Bacteria 2277
121 Ga0097621_100883543 3300006237 Bacteria 832
122 Ga0068871_100024156 3300006358 Bacteria 4710
123 Ga0068871_100037650 3300006358 Bacteria 3858
124 Ga0068871_100324329 3300006358 Bacteria 1357
125 Ga0068871_100532934 3300006358 Bacteria 1062
126 Ga0068871_100747239 3300006358 Bacteria 899
127 Ga0068871_100778313 3300006358 Unclassified 881
128 Ga0068871_101601936 3300006358 Bacteria 616
129 Ga0075433_10169339 3300006852 Bacteria 1944
130 Ga0068865_101527036 3300006881 Bacteria 599
131 Ga0075436_100005255 3300006914 Bacteria 8911
132 Ga0075436_100070003 3300006914 Bacteria 2425
133 Ga0097620_100545788 3300006931 Bacteria 1254
134 Ga0097620_100565780 3300006931 Bacteria 1231
135 Ga0097620_101054174 3300006931 Bacteria 894
136 Ga0097620_101455997 3300006931 Bacteria 756
137 Ga0075435_100847844 3300007076 Bacteria 796
138 Ga0075435_100931488 3300007076 Bacteria 758
139 Ga0075435_101581334 3300007076 Unclassified 575
140 Ga0099794_10403102 3300007265 Bacteria 714
141 Ga0105240_10005220 3300009093 Bacteria 19434
142 Ga0105240_10059384 3300009093 Bacteria 4773
143 Ga0105240_10075899 3300009093 Bacteria 4145
144 Ga0105240_10079345 3300009093 Bacteria 4039
145 Ga0105240_10137496 3300009093 Bacteria 2925
146 Ga0105240_10255045 3300009093 Bacteria 2026
147 Ga0105240_10342624 3300009093 Bacteria 1698
148 Ga0105240_10567358 3300009093 Bacteria 1254
149 Ga0105240_11231488 3300009093 Bacteria 792
150 Ga0111539_10425277 3300009094 Bacteria 1547
151 Ga0111539_11374522 3300009094 Unclassified 819
152 Ga0105245_10072904 3300009098 Bacteria 3121
153 Ga0105245_10146228 3300009098 Bacteria 2230
154 Ga0105245_10195164 3300009098 Bacteria 1941
155 Ga0105245_10230329 3300009098 Bacteria 1792
156 Ga0105245_10249184 3300009098 Bacteria 1725
157 Ga0105245_10944415 3300009098 Bacteria 905
158 Ga0105245_11340735 3300009098 Unclassified 765
159 Ga0105247_10069279 3300009101 Bacteria 2201
160 Ga0105247_10244971 3300009101 Bacteria 1223
161 Ga0105243_10191119 3300009148 Bacteria 1788
162 Ga0105243_10329620 3300009148 Bacteria 1394
163 Ga0105243_11222780 3300009148 Unclassified 765
164 Ga0105243_12724406 3300009148 Bacteria 535
165 Ga0105241_10015214 3300009174 Bacteria 5635
166 Ga0105241_10146571 3300009174 Bacteria 1927
167 Ga0105241_10527971 3300009174 Bacteria 1056
168 Ga0105241_10670608 3300009174 Bacteria 944
169 Ga0105241_11492964 3300009174 Bacteria 650
170 Ga0105242_10017620 3300009176 Bacteria 5570
171 Ga0105242_10042853 3300009176 Bacteria 3658
172 Ga0105242_10248574 3300009176 Bacteria 1602
173 Ga0105242_10461128 3300009176 Bacteria 1200
174 Ga0105242_10464093 3300009176 Bacteria 1196
175 Ga0105242_12600604 3300009176 Bacteria 555
176 Ga0105248_10004133 3300009177 Bacteria 16062
177 Ga0105248_10086586 3300009177 Bacteria 3525
178 Ga0105248_10239222 3300009177 Bacteria 2044
179 Ga0105248_10241200 3300009177 Bacteria 2035
180 Ga0105248_10417681 3300009177 Bacteria 1510
181 Ga0105248_10581005 3300009177 Bacteria 1264
182 Ga0105248_10761637 3300009177 Bacteria 1092
183 Ga0105248_10994863 3300009177 Bacteria 947
184 Ga0105248_11412924 3300009177 Bacteria 787
185 Ga0105248_11973530 3300009177 Unclassified 663
186 Ga0105237_10009261 3300009545 Bacteria 10555
187 Ga0105237_10034341 3300009545 Bacteria 5136
188 Ga0105237_10065687 3300009545 Bacteria 3623
189 Ga0105237_10080804 3300009545 Bacteria 3241
190 Ga0105237_10194339 3300009545 Bacteria 2029
191 Ga0105237_10575524 3300009545 Bacteria 1133
192 Ga0105237_10944106 3300009545 Bacteria 869
193 Ga0105237_12218662 3300009545 Unclassified 559
194 Ga0105238_10027108 3300009551 Bacteria 5840
195 Ga0105238_10032675 3300009551 Bacteria 5295
196 Ga0105238_10041418 3300009551 Bacteria 4664
197 Ga0105238_10089280 3300009551 Bacteria 3069
198 Ga0105238_10578785 3300009551 Bacteria 1129
199 Ga0105238_12419997 3300009551 Unclassified 561
200 Ga0105249_10019060 3300009553 Bacteria 6119
201 Ga0105239_10025480 3300010375 Bacteria 6512
202 Ga0105239_10028598 3300010375 Bacteria 6129
203 Ga0105239_10035929 3300010375 Bacteria 5440
204 Ga0105239_10051546 3300010375 Bacteria 4512
205 Ga0105239_11406894 3300010375 Bacteria 805
206 Ga0105239_13140785 3300010375 Bacteria 538
207 Ga0105246_10209911 3300011119 Bacteria 1519
208 Ga0157370_10010079 3300013104 Bacteria 9989
209 Ga0157370_10052283 3300013104 Bacteria 3900
210 Ga0157370_10176648 3300013104 Bacteria 1985
211 Ga0157370_10179999 3300013104 Bacteria 1965
212 Ga0157370_10305403 3300013104 Bacteria 1468
213 Ga0157369_10209133 3300013105 Bacteria 2045
214 Ga0157369_10594894 3300013105 Bacteria 1142
215 Ga0157374_10520888 3300013296 Bacteria 1195
216 Ga0157374_11357775 3300013296 Bacteria 733
217 Ga0157374_11809993 3300013296 Bacteria 636
218 Ga0157374_12247922 3300013296 Bacteria 572
219 Ga0157378_10109419 3300013297 Bacteria 2531
220 Ga0157378_10169299 3300013297 Bacteria 2048
221 Ga0157378_10361321 3300013297 Bacteria 1421
222 Ga0157378_10404056 3300013297 Bacteria 1347
223 Ga0157378_10574184 3300013297 Bacteria 1136
224 Ga0157378_10916131 3300013297 Bacteria 908
225 Ga0163162_10008676 3300013306 Bacteria 9891
226 Ga0163162_10196423 3300013306 Bacteria 2146
227 Ga0163162_10784767 3300013306 Unclassified 1071
228 Ga0163162_10910373 3300013306 Bacteria 992
229 Ga0163162_10933575 3300013306 Bacteria 979
230 Ga0157372_10013279 3300013307 Bacteria 8790
231 Ga0157372_10152403 3300013307 Bacteria 2669
232 Ga0157372_10231465 3300013307 Bacteria 2142
233 Ga0157372_10657817 3300013307 Bacteria 1220
234 Ga0157375_10023293 3300013308 Bacteria 5712
235 Ga0157375_10168104 3300013308 Bacteria 2339
236 Ga0157375_10332859 3300013308 Bacteria 1683
237 Ga0157375_10769912 3300013308 Bacteria 1113
238 Ga0157375_11186837 3300013308 Bacteria 895
239 Ga0157375_11533655 3300013308 Bacteria 787
240 Ga0163163_10005804 3300014325 Bacteria 10726
241 Ga0163163_10013429 3300014325 Bacteria 7501
242 Ga0163163_10131462 3300014325 Bacteria 2543
243 Ga0163163_10136210 3300014325 Unclassified 2497
244 Ga0163163_11732324 3300014325 Bacteria 685
245 Ga0157380_10476771 3300014326 Bacteria 1206
246 Ga0157380_11800415 3300014326 Bacteria 671
247 Ga0157380_12486426 3300014326 Bacteria 583
248 Ga0157379_10040531 3300014968 Bacteria 4157
249 Ga0157379_10182694 3300014968 Bacteria 1895
250 Ga0157376_10093710 3300014969 Bacteria 2608
251 Ga0157376_10158939 3300014969 Bacteria 2046
252 Ga0157376_10321197 3300014969 Bacteria 1472
253 Ga0157376_10370689 3300014969 Bacteria 1376
254 Ga0157376_10725024 3300014969 Bacteria 1001
255 Ga0157376_10853768 3300014969 Bacteria 926
256 Ga0157376_11097146 3300014969 Unclassified 821
257 Ga0206350_10550624 3300020080 Unclassified 774
258 Ga0213876_10495586 3300021384 Bacteria 650
259 Ga0213875_10013156 3300021388 Bacteria 4069
260 Ga0224712_10560543 3300022467 Bacteria 556
261 Ga0207656_10151654 3300025321 Bacteria 1098
262 Ga0207710_10164716 3300025900 Bacteria 1081
263 Ga0207685_10298680 3300025905 Bacteria 796
264 Ga0207699_10180312 3300025906 Bacteria 1419
265 Ga0207699_10302748 3300025906 Bacteria 1117
266 Ga0207705_10076293 3300025909 Bacteria 2436
267 Ga0207684_10160497 3300025910 Bacteria 1936
268 Ga0207654_10327412 3300025911 Bacteria 1049
269 Ga0207654_10417763 3300025911 Bacteria 935
270 Ga0207654_10516789 3300025911 Unclassified 845
271 Ga0207707_10012312 3300025912 Bacteria 7434
272 Ga0207707_10060444 3300025912 Bacteria 3296
273 Ga0207695_10001974 3300025913 Bacteria 31730
274 Ga0207695_10007975 3300025913 Bacteria 13353
275 Ga0207695_10063104 3300025913 Bacteria 3820
276 Ga0207695_10075569 3300025913 Bacteria 3428
277 Ga0207695_10077409 3300025913 Bacteria 3378
278 Ga0207695_10310264 3300025913 Bacteria 1468
279 Ga0207695_10339738 3300025913 Bacteria 1389
280 Ga0207671_10013226 3300025914 Bacteria 6584
281 Ga0207671_10130839 3300025914 Bacteria 1926
282 Ga0207671_10158602 3300025914 Bacteria 1751
283 Ga0207671_10205786 3300025914 Bacteria 1538
284 Ga0207671_10767010 3300025914 Unclassified 766
285 Ga0207671_10876654 3300025914 Bacteria 710
286 Ga0207671_11322158 3300025914 Bacteria 561
287 Ga0207663_11172905 3300025916 Unclassified 618
288 Ga0207660_10183578 3300025917 Bacteria 1626
289 Ga0207660_10320940 3300025917 Bacteria 1237
290 Ga0207657_10061218 3300025919 Bacteria 3228
291 Ga0207657_10213284 3300025919 Bacteria 1549
292 Ga0207652_10107333 3300025921 Unclassified 2473
293 Ga0207694_10045357 3300025924 Bacteria 3396
294 Ga0207694_10059441 3300025924 Bacteria 2973
295 Ga0207694_10073110 3300025924 Bacteria 2682
296 Ga0207694_10158560 3300025924 Bacteria 1827
297 Ga0207694_10426229 3300025924 Bacteria 1105
298 Ga0207687_10014671 3300025927 Bacteria 5129
299 Ga0207687_10048164 3300025927 Bacteria 2957
300 Ga0207687_10175957 3300025927 Bacteria 1654
301 Ga0207687_10224767 3300025927 Bacteria 1480
302 Ga0207687_10884044 3300025927 Bacteria 764
303 Ga0207687_10986701 3300025927 Bacteria 722
304 Ga0207700_10013362 3300025928 Bacteria 5339
305 Ga0207664_10000909 3300025929 Bacteria 19988
306 Ga0207644_10273574 3300025931 Bacteria 1354
307 Ga0207686_10003336 3300025934 Bacteria 8621
308 Ga0207686_10014328 3300025934 Bacteria 4411
309 Ga0207686_10071425 3300025934 Bacteria 2234
310 Ga0207686_10212779 3300025934 Bacteria 1391
311 Ga0207686_11135614 3300025934 Bacteria 638
312 Ga0207709_10688675 3300025935 Bacteria 817
313 Ga0207670_11115550 3300025936 Bacteria 666
314 Ga0207669_10647258 3300025937 Bacteria 864
315 Ga0207704_10117950 3300025938 Bacteria 1809
316 Ga0207704_11514661 3300025938 Bacteria 576
317 Ga0207665_10564942 3300025939 Bacteria 885
318 Ga0207691_11438896 3300025940 Bacteria 565
319 Ga0207711_10106917 3300025941 Bacteria 2483
320 Ga0207711_10227375 3300025941 Bacteria 1708
321 Ga0207711_10776542 3300025941 Bacteria 893
322 Ga0207711_10938599 3300025941 Bacteria 804
323 Ga0207711_11628594 3300025941 Unclassified 589
324 Ga0207689_10742794 3300025942 Bacteria 828
325 Ga0207661_10120474 3300025944 Bacteria 2233
326 Ga0207661_10284394 3300025944 Bacteria 1479
327 Ga0207679_10395295 3300025945 Bacteria 1215
328 Ga0207679_11154457 3300025945 Bacteria 711
329 Ga0207667_10047143 3300025949 Bacteria 4562
330 Ga0207667_10161159 3300025949 Bacteria 2307
331 Ga0207667_10658882 3300025949 Bacteria 1052
332 Ga0207712_11142788 3300025961 Unclassified 694
333 Ga0207640_10300980 3300025981 Bacteria 1269
334 Ga0207658_10192980 3300025986 Bacteria 1695
335 Ga0207658_10832550 3300025986 Bacteria 839
336 Ga0207677_10072775 3300026023 Bacteria 2431
337 Ga0207677_11020654 3300026023 Bacteria 751
338 Ga0207703_10166566 3300026035 Bacteria 1934
339 Ga0207703_10188953 3300026035 Bacteria 1823
340 Ga0207703_10468664 3300026035 Bacteria 1179
341 Ga0207703_10765701 3300026035 Bacteria 920
342 Ga0207639_10062986 3300026041 Bacteria 2870
343 Ga0207639_11143265 3300026041 Bacteria 730
344 Ga0207678_11089522 3300026067 Bacteria 707
345 Ga0207708_10174121 3300026075 Bacteria 1706
346 Ga0207702_10028717 3300026078 Bacteria 4625
347 Ga0207702_10054599 3300026078 Bacteria 3386
348 Ga0207702_10646000 3300026078 Bacteria 1040
349 Ga0207641_10023202 3300026088 Bacteria 5113
350 Ga0207641_10025344 3300026088 Bacteria 4890
351 Ga0207641_10114011 3300026088 Bacteria 2401
352 Ga0207641_10138389 3300026088 Bacteria 2194
353 Ga0207641_10822963 3300026088 Bacteria 919
354 Ga0207648_10031650 3300026089 Bacteria 4676
355 Ga0207648_10309492 3300026089 Bacteria 1418
356 Ga0207648_10375685 3300026089 Bacteria 1284
357 Ga0207676_10166640 3300026095 Bacteria 1915
358 Ga0207674_10005946 3300026116 Bacteria 14434
359 Ga0207674_10037354 3300026116 Bacteria 5052
360 Ga0207674_10038710 3300026116 Bacteria 4945
361 Ga0207674_10884482 3300026116 Bacteria 861
362 Ga0207674_11233082 3300026116 Bacteria 717
363 Ga0207683_10180301 3300026121 Bacteria 1915
364 Ga0207683_10622601 3300026121 Bacteria 999
365 Ga0207683_10845836 3300026121 Unclassified 849
366 Ga0207683_10990188 3300026121 Bacteria 780
367 Ga0207698_10256864 3300026142 Bacteria 1603
368 Ga0207698_11263779 3300026142 Bacteria 753
369 Ga0268266_10097579 3300028379 Bacteria 2584
370 Ga0268266_10145858 3300028379 Bacteria 2128
371 Ga0268266_10166829 3300028379 Bacteria 1996
372 Ga0268266_11105462 3300028379 Bacteria 767
373 Ga0268264_10026130 3300028381 Bacteria 4768
374 Ga0268264_10291380 3300028381 Bacteria 1533
375 Ga0268264_11820979 3300028381 Unclassified 619
376 Ga0265323_10000466 3300028653 Bacteria 22887
377 Ga0265336_10024215 3300028666 Bacteria 1920
378 Ga0265338_10093792 3300028800 Bacteria 2472
379 Ga0265760_10094868 3300031090 Bacteria 938
380 Ga0265330_10029716 3300031235 Bacteria 2456
381 Ga0265330_10060578 3300031235 Bacteria 1647
382 Ga0265330_10227291 3300031235 Bacteria 787
383 Ga0265332_10027776 3300031238 Bacteria 2478
384 Ga0265329_10024841 3300031242 Bacteria 1986
385 Ga0265339_10107802 3300031249 Bacteria 1444
386 Ga0265331_10010992 3300031250 Bacteria 4969
387 Ga0265331_10098330 3300031250 Bacteria 1349
388 Ga0265316_10006522 3300031344 Bacteria 11130
389 Ga0265316_10010609 3300031344 Bacteria 8381
390 Ga0265316_10023912 3300031344 Bacteria 5131
391 Ga0265316_10049167 3300031344 Bacteria 3323
392 Ga0265316_10107222 3300031344 Bacteria 2118
393 Ga0265316_10484699 3300031344 Bacteria 884
394 Ga0265316_10535680 3300031344 Bacteria 834
395 Ga0265316_11224136 3300031344 Bacteria 519
396 Ga0265313_10110548 3300031595 Bacteria 1209
397 Ga0265314_10011228 3300031711 Bacteria 7413
398 Ga0265314_10042976 3300031711 Unclassified 3218
399 Ga0265314_10112756 3300031711 Bacteria 1725
400 Ga0265314_10191377 3300031711 Bacteria 1217
401 Ga0265342_10032319 3300031712 Bacteria 3228
402 Ga0265342_10079972 3300031712 Bacteria 1890
403 Ga0373926_0041594 3300035083 Bacteria 1642
404 Ga0373934_0007674 3300035086 Bacteria 4008
405 Ga0373934_0263094 3300035086 Bacteria 714
406 Ga0373923_0005012 3300035111 Bacteria 4457
407 Ga0373945_0039903 3300035116 Bacteria 1694
408 Ga0373953_0038066 3300035117 Bacteria 1901
409 Ga0373954_0010217 3300035118 Bacteria 4138
410 Ga0373954_0081319 3300035118 Unclassified 1548
411 Ga0373954_0318462 3300035118 Unclassified 768
412 Ga0373956_0150630 3300035119 Bacteria 1095
413 Ga0373946_0112135 3300035171 Unclassified 1236
414 Ga0373955_0025689 3300035172 Bacteria 3028
415 Ga0373935_0059040 3300035692 Bacteria 2451
416 Ga0373927_0002296 3300035695 Bacteria 13989
417 Ga0373927_0003041 3300035695 Bacteria 12161
418 Ga0373927_0419054 3300035695 Bacteria 884
419 Ga0373927_1089621 3300035695 Unclassified 527
420 Ga0373933_0141219 3300035724 Bacteria 1520
421 Ga0373933_0190232 3300035724 Bacteria 1311
422 Ga0373947_0004332 3300035725 Bacteria 8335
423 Ga0373947_0016419 3300035725 Bacteria 4255
424 Ga0373947_0160204 3300035725 Bacteria 1455
425 Ga0373937_0038135 3300036401 Bacteria 4380
426 Ga0373937_0088991 3300036401 Bacteria 2859
427 Ga0373937_1332386 3300036401 Bacteria 666
428 Ga0373925_0346164 3300037068 Bacteria 1206
429 Ga0373925_0496403 3300037068 Bacteria 1002
430 Ga0395905_0190470 3300037471 Bacteria 1924
431 Ga0436364_0235014 3300037853 Bacteria 8156
432 Ga0436364_0699063 3300037853 Unclassified 1005
433 Ga0436365_0285773 3300039437 Bacteria 1958
434 Ga0436365_0376854 3300039437 Bacteria 650
435 Ga0436365_0506144 3300039437 Unclassified 939
436 Ga0436365_1125637 3300039437 Bacteria 2081
437 Ga0453683_0057592 3300044673 Bacteria 2431
438 Ga0466961_0372325 3300044693 Bacteria 868
439 Ga0466963_0214836 3300044694 Bacteria 1346
440 Ga0453684_0174604 3300044712 Bacteria 2529
441 Ga0453684_1432018 3300044712 Bacteria 715
442 Ga0451576_0148834 3300045051 Bacteria 2442
443 Ga0466967_0224150 3300045976 Bacteria 1788
444 Ga0495592_0033454 3300046454 Bacteria 3877
445 Ga0495651_0017183 3300046462 Bacteria 5605
446 Ga0495651_0023102 3300046462 Bacteria 4837
447 Ga0495580_0000411 3300046472 Bacteria 35418
448 Ga0495580_0003198 3300046472 Bacteria 14027
449 Ga0495580_0009872 3300046472 Bacteria 7478
450 Ga0495580_0031442 3300046472 Bacteria 3836
451 Ga0495580_0233974 3300046472 Bacteria 1261
452 Ga0495580_0268979 3300046472 Bacteria 1164
453 Ga0495580_0374123 3300046472 Bacteria 963
454 Ga0495580_0568912 3300046472 Bacteria 751
455 Ga0495639_0694862 3300046475 Bacteria 525
456 Ga0495662_0097099 3300046476 Bacteria 1440
457 Ga0495662_0114582 3300046476 Bacteria 1322
458 Ga0495664_0018435 3300046477 Bacteria 3999
459 Ga0495664_0117891 3300046477 Bacteria 1605
460 Ga0495664_0167252 3300046477 Bacteria 1334
461 Ga0495594_0192209 3300046499 Bacteria 1163
462 Ga0495594_0659160 3300046499 Bacteria 592
463 Ga0495608_0216716 3300046511 Bacteria 1202
464 Ga0495618_0152125 3300046514 Bacteria 1478
465 Ga0495628_0051462 3300046516 Bacteria 3256
466 Ga0495628_0391895 3300046516 Bacteria 1016
467 Ga0495630_0138664 3300046517 Bacteria 1848
468 Ga0495630_0985429 3300046517 Bacteria 641
469 Ga0495652_0439647 3300046529 Bacteria 915
470 Ga0495652_0516602 3300046529 Bacteria 826
471 Ga0495640_0033299 3300046533 Bacteria 3662
472 Ga0495640_0094581 3300046533 Bacteria 1968
473 Ga0495586_0105075 3300046535 Bacteria 1570
474 Ga0495586_0694071 3300046535 Bacteria 588
475 Ga0495587_0112346 3300046536 Bacteria 1564
476 Ga0495645_0001905 3300046543 Bacteria 14174
477 Ga0495645_0028139 3300046543 Bacteria 4084
478 Ga0495645_0043732 3300046543 Bacteria 3268
479 Ga0495645_0130063 3300046543 Unclassified 1765
480 Ga0495645_0148308 3300046543 Bacteria 1632
481 Ga0495667_0014695 3300046559 Bacteria 5291
482 Ga0495667_0096478 3300046559 Bacteria 1914
483 Ga0495635_0023820 3300046663 Bacteria 4266
484 Ga0495635_0099759 3300046663 Bacteria 1985
485 Ga0495635_0282500 3300046663 Bacteria 1115
486 Ga0495635_0795331 3300046663 Bacteria 610
487 Ga0495599_0016489 3300046678 Bacteria 4587
488 Ga0495599_0240597 3300046678 Bacteria 1104
489 Ga0495623_0039832 3300046679 Bacteria 3002
490 Ga0495623_0166264 3300046679 Bacteria 1292
491 Ga0495646_0092677 3300046680 Bacteria 1742
492 Ga0495669_0669110 3300046684 Unclassified 505
493 Ga0495613_0051571 3300046689 Bacteria 3032
494 Ga0495613_0200114 3300046689 Bacteria 1409
495 Ga0495604_0040660 3300047317 Bacteria 3650
496 Ga0495604_0392748 3300047317 Bacteria 915
497 Ga0495604_0541126 3300047317 Bacteria 752
498 Ga0495604_0601050 3300047317 Unclassified 705
499 Ga0495674_0012933 3300047319 Bacteria 7859
500 Ga0495674_0015760 3300047319 Bacteria 7055
501 Ga0495674_0344837 3300047319 Bacteria 1210
502 Ga0495674_0490656 3300047319 Bacteria 983
503 Ga0495674_0501449 3300047319 Unclassified 971
504 Ga0495674_0549505 3300047319 Bacteria 919
505 Ga0495674_1239362 3300047319 Unclassified 562
506 Ga0495680_0114712 3300047322 Bacteria 1994
507 Ga0495680_0445528 3300047322 Unclassified 887
508 Ga0495675_0231111 3300047444 Bacteria 1116
509 Ga0495684_0000951 3300047471 Bacteria 23573
510 Ga0495684_0057019 3300047471 Bacteria 2977
511 Ga0495684_0088237 3300047471 Bacteria 2350
512 Ga0495684_0140397 3300047471 Bacteria 1811
513 Ga0495593_0121233 3300047673 Unclassified 1331
514 Ga0495593_0321362 3300047673 Bacteria 774
515 Ga0495602_0227631 3300048088 Bacteria 1403
516 Ga0495602_0243765 3300048088 Bacteria 1343
517 Ga0495602_0547212 3300048088 Bacteria 803
518 Ga0495614_0184377 3300048089 Bacteria 940
519 Ga0496101_0812693 3300048904 Bacteria 737
520 Ga0496104_0937080 3300048907 Bacteria 771
521 Ga0496111_0373476 3300048914 Unclassified 1055
522 Ga0496112_0685837 3300048915 Bacteria 953
523 Ga0496115_0047983 3300048918 Bacteria 3416
524 Ga0501031_0015306 3300049568 Bacteria 4982
525 Ga0501032_0003219 3300049569 Bacteria 12559
526 Ga0501034_0005315 3300049571 Bacteria 14116
527 Ga0501036_0000166 3300049572 Bacteria 43443
528 Ga0501037_0000725 3300049573 Bacteria 24969
529 Ga0501038_0001071 3300049574 Bacteria 24706
530 Ga0501039_0005223 3300049575 Bacteria 9835
531 Ga0501043_0158914 3300049579 Bacteria 1766
532 Ga0501046_0003212 3300049580 Bacteria 15037
533 Ga0501047_0317014 3300049581 Bacteria 1399
534 Ga0501067_0001114 3300049583 Bacteria 14534
535 Ga0501068_0001612 3300049584 Bacteria 12016
536 Ga0501068_0291695 3300049584 Bacteria 1043
537 Ga0501070_0057672 3300049586 Bacteria 3219
538 Ga0501072_0001111 3300049588 Bacteria 20026
539 Ga0501073_0003073 3300049589 Bacteria 12513
540 Ga0501074_0222835 3300049590 Bacteria 1342
541 Ga0501076_0035191 3300049592 Bacteria 3919
542 Ga0501077_0015628 3300049593 Bacteria 4780
543 Ga0501079_0004621 3300049741 Bacteria 10196
544 Ga0501080_0000927 3300049742 Bacteria 23952
545 Ga0501081_0453365 3300049743 Bacteria 953
546 Ga0501035_0088205 3300049822 Bacteria 2733
547 Ga0501044_0083937 3300049823 Bacteria 3219
548 Ga0501045_0161528 3300049824 Bacteria 1668
549 nmdc:mga08y16_1125877_c1 3300050511 Bacteria 759
550 nmdc:mga08y16_2001232_c1 3300050511 Unclassified 528
551 nmdc:mga0rr50_1441960_c1 3300050513 Unclassified 582
552 nmdc:mga08x19_39145_c1 3300050514 Bacteria 3014
553 nmdc:mga08x19_91011_c1 3300050514 Bacteria 2013
554 Ga0495619_0390813 3300053085 Bacteria 961
555 Ga0501084_0104441 3300054114 Bacteria 2379
556 Ga0501082_0061918 3300060353 Bacteria 3220
557 Ga0268266_10892317
558 Ga0065707_10932408
559 Ga0070658_10068122
560 Ga0070676_11122721
561 Ga0070683_100145081
562 Ga0070683_100185009
563 Ga0070683_100613065
564 Ga0070683_101163229
565 Ga0070690_100062895
566 Ga0070690_101292416
567 Ga0070670_100479196
568 Ga0070666_10327792
569 Ga0070680_100254125
570 Ga0070680_100333646
571 Ga0068868_100058632
572 Ga0068868_100119955
573 Ga0070660_100005535
574 Ga0070660_100549830
575 Ga0070689_100168326
576 Ga0070691_10202616
577 Ga0070661_100076181
578 Ga0070668_100770351
579 Ga0070675_101158838
580 Ga0070671_100376950
581 Ga0070674_100638122
582 Ga0070674_100843309
583 Ga0070673_101769810
584 Ga0070688_101093970
585 Ga0070688_101275300
586 Ga0070667_100186073
587 Ga0070667_101416939
588 Ga0070709_10055075
589 Ga0070709_10560878
590 Ga0070709_10717708
591 Ga0070714_100005407
592 Ga0070713_100011257
593 Ga0070713_100056316
594 Ga0070711_100027701
595 Ga0070708_100993190
596 Ga0070708_101260252
597 Ga0070678_100244156
598 Ga0070678_100346467
599 Ga0070678_101245893
600 Ga0070681_10030481
601 Ga0070681_10057856
602 Ga0070681_10417849
603 Ga0070681_10522001
604 Ga0070681_10803635
605 Ga0070681_10845226
606 Ga0068867_100129202
607 Ga0068867_101487877
608 Ga0070685_10065749
609 Ga0070685_10240416
610 Ga0070706_100194082
611 Ga0070698_100150998
612 Ga0070699_100085309
613 Ga0070684_100355027
614 Ga0070684_100396545
615 Ga0070684_100546516
616 Ga0070697_100140816
617 Ga0068853_100273187
618 Ga0068853_100339810
619 Ga0068853_101068984
620 Ga0070686_101664529
621 Ga0070696_100011499
622 Ga0070693_100663269
623 Ga0070665_100060406
624 Ga0070665_100072450
625 Ga0070665_100302417
626 Ga0070665_100574335
627 Ga0070665_101033579
628 Ga0068855_100115220
629 Ga0068855_100141840
630 Ga0068855_100452472
631 Ga0068855_101200002
632 Ga0070664_100852752
633 Ga0070664_100938392
634 Ga0068857_100002833
635 Ga0068857_100022344
636 Ga0068857_100183847
637 Ga0068854_100478850
638 Ga0068856_100029477
639 Ga0068856_100056852
640 Ga0068856_100141233
641 Ga0068856_100216427
642 Ga0068852_100513694
643 Ga0068859_100545822
644 Ga0068859_100565796
645 Ga0068859_101054158
646 Ga0068859_101456056
647 Ga0068864_100028575
648 Ga0068864_100124148
649 Ga0068851_10170420
650 Ga0068870_10757396
651 Ga0068863_100033555
652 Ga0068863_100033944
653 Ga0068863_100169313
654 Ga0068863_100194084
655 Ga0068863_100475705
656 Ga0068863_101682672
657 Ga0068858_100019670
658 Ga0068858_100021243
659 Ga0068858_100520999
660 Ga0068858_100538395
661 Ga0068858_100604426
662 Ga0068860_100008713
663 Ga0068860_100456095
664 Ga0068860_102464441
665 Ga0068862_100283792
666 Ga0070717_10003142
667 Ga0070717_10007583
668 Ga0070717_10011583
669 Ga0070717_10154977
670 Ga0070717_10425937
671 Ga0070717_11767484
672 Ga0070717_12105375
673 Ga0070715_10294992
674 Ga0070716_100556856
675 Ga0097621_100060842
676 Ga0097621_100115025
677 Ga0097621_100883543
678 Ga0068871_100024156
679 Ga0068871_100037650
680 Ga0068871_100324329
681 Ga0068871_100532934
682 Ga0068871_100747239
683 Ga0068871_100778313
684 Ga0068871_101601936
685 Ga0075433_10169339
686 Ga0068865_101527036
687 Ga0075436_100005255
688 Ga0075436_100070003
689 Ga0097620_100545788
690 Ga0097620_100565780
691 Ga0097620_101054174
692 Ga0097620_101455997
693 Ga0075435_100847844
694 Ga0075435_100931488
695 Ga0075435_101581334
696 Ga0099794_10403102
697 Ga0105240_10005220
698 Ga0105240_10059384
699 Ga0105240_10075899
700 Ga0105240_10079345
701 Ga0105240_10137496
702 Ga0105240_10255045
703 Ga0105240_10342624
704 Ga0105240_10567358
705 Ga0105240_11231488
706 Ga0111539_10425277
707 Ga0111539_11374522
708 Ga0105245_10072904
709 Ga0105245_10146228
710 Ga0105245_10195164
711 Ga0105245_10230329
712 Ga0105245_10249184
713 Ga0105245_10944415
714 Ga0105245_11340735
715 Ga0105247_10069279
716 Ga0105247_10244971
717 Ga0105243_10191119
718 Ga0105243_10329620
719 Ga0105243_11222780
720 Ga0105243_12724406
721 Ga0105241_10015214
722 Ga0105241_10146571
723 Ga0105241_10527971
724 Ga0105241_10670608
725 Ga0105241_11492964
726 Ga0105242_10017620
727 Ga0105242_10042853
728 Ga0105242_10248574
729 Ga0105242_10461128
730 Ga0105242_10464093
731 Ga0105242_12600604
732 Ga0105248_10004133
733 Ga0105248_10086586
734 Ga0105248_10239222
735 Ga0105248_10241200
736 Ga0105248_10417681
737 Ga0105248_10581005
738 Ga0105248_10761637
739 Ga0105248_10994863
740 Ga0105248_11412924
741 Ga0105248_11973530
742 Ga0105237_10009261
743 Ga0105237_10034341
744 Ga0105237_10065687
745 Ga0105237_10080804
746 Ga0105237_10194339
747 Ga0105237_10575524
748 Ga0105237_10944106
749 Ga0105237_12218662
750 Ga0105238_10027108
751 Ga0105238_10032675
752 Ga0105238_10041418
753 Ga0105238_10089280
754 Ga0105238_10578785
755 Ga0105238_12419997
756 Ga0105249_10019060
757 Ga0105239_10025480
758 Ga0105239_10028598
759 Ga0105239_10035929
760 Ga0105239_10051546
761 Ga0105239_11406894
762 Ga0105239_13140785
763 Ga0105246_10209911
764 Ga0157370_10010079
765 Ga0157370_10052283
766 Ga0157370_10176648
767 Ga0157370_10179999
768 Ga0157370_10305403
769 Ga0157369_10209133
770 Ga0157369_10594894
771 Ga0157374_10520888
772 Ga0157374_11357775
773 Ga0157374_11809993
774 Ga0157374_12247922
775 Ga0157378_10109419
776 Ga0157378_10169299
777 Ga0157378_10361321
778 Ga0157378_10404056
779 Ga0157378_10574184
780 Ga0157378_10916131
781 Ga0163162_10008676
782 Ga0163162_10196423
783 Ga0163162_10784767
784 Ga0163162_10910373
785 Ga0163162_10933575
786 Ga0157372_10013279
787 Ga0157372_10152403
788 Ga0157372_10231465
789 Ga0157372_10657817
790 Ga0157375_10023293
791 Ga0157375_10168104
792 Ga0157375_10332859
793 Ga0157375_10769912
794 Ga0157375_11186837
795 Ga0157375_11533655
796 Ga0163163_10005804
797 Ga0163163_10013429
798 Ga0163163_10131462
799 Ga0163163_10136210
800 Ga0163163_11732324
801 Ga0157380_10476771
802 Ga0157380_11800415
803 Ga0157380_12486426
804 Ga0157379_10040531
805 Ga0157379_10182694
806 Ga0157376_10093710
807 Ga0157376_10158939
808 Ga0157376_10321197
809 Ga0157376_10370689
810 Ga0157376_10725024
811 Ga0157376_10853768
812 Ga0157376_11097146
813 Ga0206350_10550624
814 Ga0213876_10495586
815 Ga0213875_10013156
816 Ga0224712_10560543
817 Ga0207656_10151654
818 Ga0207710_10164716
819 Ga0207685_10298680
820 Ga0207699_10180312
821 Ga0207699_10302748
822 Ga0207705_10076293
823 Ga0207684_10160497
824 Ga0207654_10327412
825 Ga0207654_10417763
826 Ga0207654_10516789
827 Ga0207707_10012312
828 Ga0207707_10060444
829 Ga0207695_10001974
830 Ga0207695_10007975
831 Ga0207695_10063104
832 Ga0207695_10075569
833 Ga0207695_10077409
834 Ga0207695_10310264
835 Ga0207695_10339738
836 Ga0207671_10013226
837 Ga0207671_10130839
838 Ga0207671_10158602
839 Ga0207671_10205786
840 Ga0207671_10767010
841 Ga0207671_10876654
842 Ga0207671_11322158
843 Ga0207663_11172905
844 Ga0207660_10183578
845 Ga0207660_10320940
846 Ga0207657_10061218
847 Ga0207657_10213284
848 Ga0207652_10107333
849 Ga0207694_10045357
850 Ga0207694_10059441
851 Ga0207694_10073110
852 Ga0207694_10158560
853 Ga0207694_10426229
854 Ga0207687_10014671
855 Ga0207687_10048164
856 Ga0207687_10175957
857 Ga0207687_10224767
858 Ga0207687_10884044
859 Ga0207687_10986701
860 Ga0207700_10013362
861 Ga0207664_10000909
862 Ga0207644_10273574
863 Ga0207686_10003336
864 Ga0207686_10014328
865 Ga0207686_10071425
866 Ga0207686_10212779
867 Ga0207686_11135614
868 Ga0207709_10688675
869 Ga0207670_11115550
870 Ga0207669_10647258
871 Ga0207704_10117950
872 Ga0207704_11514661
873 Ga0207665_10564942
874 Ga0207691_11438896
875 Ga0207711_10106917
876 Ga0207711_10227375
877 Ga0207711_10776542
878 Ga0207711_10938599
879 Ga0207711_11628594
880 Ga0207689_10742794
881 Ga0207661_10120474
882 Ga0207661_10284394
883 Ga0207679_10395295
884 Ga0207679_11154457
885 Ga0207667_10047143
886 Ga0207667_10161159
887 Ga0207667_10658882
888 Ga0207712_11142788
889 Ga0207640_10300980
890 Ga0207658_10192980
891 Ga0207658_10832550
892 Ga0207677_10072775
893 Ga0207677_11020654
894 Ga0207703_10166566
895 Ga0207703_10188953
896 Ga0207703_10468664
897 Ga0207703_10765701
898 Ga0207639_10062986
899 Ga0207639_11143265
900 Ga0207678_11089522
901 Ga0207708_10174121
902 Ga0207702_10028717
903 Ga0207702_10054599
904 Ga0207702_10646000
905 Ga0207641_10023202
906 Ga0207641_10025344
907 Ga0207641_10114011
908 Ga0207641_10138389
909 Ga0207641_10822963
910 Ga0207648_10031650
911 Ga0207648_10309492
912 Ga0207648_10375685
913 Ga0207676_10166640
914 Ga0207674_10005946
915 Ga0207674_10037354
916 Ga0207674_10038710
917 Ga0207674_10884482
918 Ga0207674_11233082
919 Ga0207683_10180301
920 Ga0207683_10622601
921 Ga0207683_10845836
922 Ga0207683_10990188
923 Ga0207698_10256864
924 Ga0207698_11263779
925 Ga0268266_10097579
926 Ga0268266_10145858
927 Ga0268266_10166829
928 Ga0268266_11105462
929 Ga0268264_10026130
930 Ga0268264_10291380
931 Ga0268264_11820979
932 Ga0265323_10000466
933 Ga0265336_10024215
934 Ga0265338_10093792
935 Ga0265760_10094868
936 Ga0265330_10029716
937 Ga0265330_10060578
938 Ga0265330_10227291
939 Ga0265332_10027776
940 Ga0265329_10024841
941 Ga0265339_10107802
942 Ga0265331_10010992
943 Ga0265331_10098330
944 Ga0265316_10006522
945 Ga0265316_10010609
946 Ga0265316_10023912
947 Ga0265316_10049167
948 Ga0265316_10107222
949 Ga0265316_10484699
950 Ga0265316_10535680
951 Ga0265316_11224136
952 Ga0265313_10110548
953 Ga0265314_10011228
954 Ga0265314_10042976
955 Ga0265314_10112756
956 Ga0265314_10191377
957 Ga0265342_10032319
958 Ga0265342_10079972
959 Ga0373926_0041594
960 Ga0373934_0007674
961 Ga0373934_0263094
962 Ga0373923_0005012
963 Ga0373945_0039903
964 Ga0373953_0038066
965 Ga0373954_0010217
966 Ga0373954_0081319
967 Ga0373954_0318462
968 Ga0373956_0150630
969 Ga0373946_0112135
970 Ga0373955_0025689
971 Ga0373935_0059040
972 Ga0373927_0002296
973 Ga0373927_0003041
974 Ga0373927_0419054
975 Ga0373927_1089621
976 Ga0373933_0141219
977 Ga0373933_0190232
978 Ga0373947_0004332
979 Ga0373947_0016419
980 Ga0373947_0160204
981 Ga0373937_0038135
982 Ga0373937_0088991
983 Ga0373937_1332386
984 Ga0373925_0346164
985 Ga0373925_0496403
986 Ga0395905_0190470
987 Ga0436364_0235014
988 Ga0436364_0699063
989 Ga0436365_0285773
990 Ga0436365_0376854
991 Ga0436365_0506144
992 Ga0436365_1125637
993 Ga0453683_0057592
994 Ga0466961_0372325
995 Ga0466963_0214836
996 Ga0453684_0174604
997 Ga0453684_1432018
998 Ga0451576_0148834
999 Ga0466967_0224150
1000 Ga0495592_0033454
1001 Ga0495651_0017183
1002 Ga0495651_0023102
1003 Ga0495580_0000411
1004 Ga0495580_0003198
1005 Ga0495580_0009872
1006 Ga0495580_0031442
1007 Ga0495580_0233974
1008 Ga0495580_0268979
1009 Ga0495580_0374123
1010 Ga0495580_0568912
1011 Ga0495639_0694862
1012 Ga0495662_0097099
1013 Ga0495662_0114582
1014 Ga0495664_0018435
1015 Ga0495664_0117891
1016 Ga0495664_0167252
1017 Ga0495594_0192209
1018 Ga0495594_0659160
1019 Ga0495608_0216716
1020 Ga0495618_0152125
1021 Ga0495628_0051462
1022 Ga0495628_0391895
1023 Ga0495630_0138664
1024 Ga0495630_0985429
1025 Ga0495652_0439647
1026 Ga0495652_0516602
1027 Ga0495640_0033299
1028 Ga0495640_0094581
1029 Ga0495586_0105075
1030 Ga0495586_0694071
1031 Ga0495587_0112346
1032 Ga0495645_0001905
1033 Ga0495645_0028139
1034 Ga0495645_0043732
1035 Ga0495645_0130063
1036 Ga0495645_0148308
1037 Ga0495667_0014695
1038 Ga0495667_0096478
1039 Ga0495635_0023820
1040 Ga0495635_0099759
1041 Ga0495635_0282500
1042 Ga0495635_0795331
1043 Ga0495599_0016489
1044 Ga0495599_0240597
1045 Ga0495623_0039832
1046 Ga0495623_0166264
1047 Ga0495646_0092677
1048 Ga0495669_0669110
1049 Ga0495613_0051571
1050 Ga0495613_0200114
1051 Ga0495604_0040660
1052 Ga0495604_0392748
1053 Ga0495604_0541126
1054 Ga0495604_0601050
1055 Ga0495674_0012933
1056 Ga0495674_0015760
1057 Ga0495674_0344837
1058 Ga0495674_0490656
1059 Ga0495674_0501449
1060 Ga0495674_0549505
1061 Ga0495674_1239362
1062 Ga0495680_0114712
1063 Ga0495680_0445528
1064 Ga0495675_0231111
1065 Ga0495684_0000951
1066 Ga0495684_0057019
1067 Ga0495684_0088237
1068 Ga0495684_0140397
1069 Ga0495593_0121233
1070 Ga0495593_0321362
1071 Ga0495602_0227631
1072 Ga0495602_0243765
1073 Ga0495602_0547212
1074 Ga0495614_0184377
1075 Ga0496101_0812693
1076 Ga0496104_0937080
1077 Ga0496111_0373476
1078 Ga0496112_0685837
1079 Ga0496115_0047983
1080 Ga0501031_0015306
1081 Ga0501032_0003219
1082 Ga0501034_0005315
1083 Ga0501036_0000166
1084 Ga0501037_0000725
1085 Ga0501038_0001071
1086 Ga0501039_0005223
1087 Ga0501043_0158914
1088 Ga0501046_0003212
1089 Ga0501047_0317014
1090 Ga0501067_0001114
1091 Ga0501068_0001612
1092 Ga0501068_0291695
1093 Ga0501070_0057672
1094 Ga0501072_0001111
1095 Ga0501073_0003073
1096 Ga0501074_0222835
1097 Ga0501076_0035191
1098 Ga0501077_0015628
1099 Ga0501079_0004621
1100 Ga0501080_0000927
1101 Ga0501081_0453365
1102 Ga0501035_0088205
1103 Ga0501044_0083937
1104 Ga0501045_0161528
1105 nmdc:mga08y16_1125877_c1
1106 nmdc:mga08y16_2001232_c1
1107 nmdc:mga0rr50_1441960_c1
1108 nmdc:mga08x19_39145_c1
1109 nmdc:mga08x19_91011_c1
1110 Ga0495619_0390813
1111 Ga0501084_0104441
1112 Ga0501082_0061918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

24

146

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8739 52 117
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.7884 52 117
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.7596 48 113
3do6-assembly1.cif.gz_A crystal structure of putative formyltetrahydrofolate synthetase (tm1766) from thermotoga maritima at 1.85 a resolution 0.7541 71 116
3vth-assembly2.cif.gz_B crystal structure of full-length hypf in the phosphate- and nucleotide-bound form 0.7477 73 118
ID Description Score Start End Superfamily
1jpuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8115 71 118 3.40.50.1970
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7596 48 113 3.30.420.270
3vthA04 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.736 72 118 3.30.420.40
af_Q9VVU7_1_266_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7358 71 128 3.40.50.2300
af_M0R4J5_193_384_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7244 85 124 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V8U299-F1-model_v4 Biopolymer transporter ExbD 0.8654 33 129 GO:0005886
GO:0015031
GO:0022857
AF-A0A7C4PQF0-F1-model_v4 Biopolymer transporter ExbD 0.8639 33 125 GO:0005886
GO:0015031
GO:0022857
AF-A0A7V3UWM1-F1-model_v4 Biopolymer transporter ExbD 0.8531 53 123 GO:0005886
GO:0015031
GO:0022857
AF-A0A2V6FCB5-F1-model_v4 Biopolymer transporter ExbD 0.8469 33 123 GO:0005886
GO:0015031
GO:0022857
AF-A0A7C6F4B1-F1-model_v4 Biopolymer transporter ExbD 0.8448 56 127 GO:0005886
GO:0015031
GO:0022857

Map