F463205

General Info

Members Datasets Scaffolds Average Seq Length
556 277 1112 69

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10206576|Ga0105245_102065763
Length 79
Sequence MSDPAAPATDPAASVPASLDVEVDPRLLEILVCPVTHGPLEYDRAKGELISRSARLAYPIRDGVPIMLPEEARELADGD

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
256 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
260 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
261 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
268 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
269 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
272 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
273 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
274 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
275 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
276 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
277 2857504554 Caulobacter sp. R-72291 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.19
Nodule 0.36
Rhizoplane 2.88
Rhizosphere 74.1
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10206576 3300009098 Bacteria 1888
2 Ga0055526_1063621 3300003771 Bacteria 775
3 Ga0055536_1012522 3300003781 Bacteria 3138
4 Ga0055536_1013219 3300003781 Bacteria 2999
5 Ga0055530_10008227 3300003791 Bacteria 4216
6 Ga0055530_10011679 3300003791 Bacteria 3134
7 Ga0055540_1031480 3300003792 Bacteria 1218
8 Ga0055531_10000947 3300003794 Bacteria 23329
9 Ga0070658_10170958 3300005327 Bacteria 1825
10 Ga0070658_10419669 3300005327 Bacteria 1150
11 Ga0070658_10432722 3300005327 Bacteria 1132
12 Ga0070670_100035149 3300005331 Bacteria 4314
13 Ga0070670_100791872 3300005331 Bacteria 856
14 Ga0068869_100259412 3300005334 Bacteria 1391
15 Ga0068869_101995018 3300005334 Bacteria 521
16 Ga0070666_10843640 3300005335 Bacteria 676
17 Ga0070666_11436101 3300005335 Bacteria 516
18 Ga0070680_100007014 3300005336 Bacteria 8587
19 Ga0070680_100034138 3300005336 Bacteria 4102
20 Ga0070680_101242240 3300005336 Bacteria 644
21 Ga0070660_100034919 3300005339 Bacteria 3802
22 Ga0070660_100141000 3300005339 Bacteria 1934
23 Ga0070660_101133149 3300005339 Bacteria 662
24 Ga0070660_101206305 3300005339 Bacteria 641
25 Ga0070691_10017047 3300005341 Bacteria 3342
26 Ga0070668_100002963 3300005347 Bacteria 12551
27 Ga0070668_100004810 3300005347 Bacteria 10014
28 Ga0070668_100005098 3300005347 Bacteria 9728
29 Ga0070671_100006295 3300005355 Bacteria 9463
30 Ga0070671_100207489 3300005355 Bacteria 1662
31 Ga0070673_101677447 3300005364 Bacteria 601
32 Ga0070688_101127641 3300005365 Bacteria 628
33 Ga0070659_100001009 3300005366 Bacteria 20680
34 Ga0070659_100363954 3300005366 Bacteria 1215
35 Ga0070667_100007531 3300005367 Bacteria 9031
36 Ga0070667_100073226 3300005367 Bacteria 2921
37 Ga0070667_100934452 3300005367 Bacteria 808
38 Ga0070663_101927979 3300005455 Bacteria 531
39 Ga0070678_101576608 3300005456 Bacteria 616
40 Ga0070681_10018764 3300005458 Bacteria 6922
41 Ga0070681_10024623 3300005458 Bacteria 6055
42 Ga0070681_11753621 3300005458 Bacteria 547
43 Ga0068867_101260353 3300005459 Bacteria 681
44 Ga0070706_100891049 3300005467 Bacteria 822
45 Ga0070679_100007148 3300005530 Bacteria 10420
46 Ga0070679_100081634 3300005530 Bacteria 3222
47 Ga0070679_100710222 3300005530 Bacteria 948
48 Ga0070679_101641120 3300005530 Bacteria 590
49 Ga0068853_100028340 3300005539 Bacteria 4710
50 Ga0068853_102078690 3300005539 Bacteria 551
51 Ga0068853_102116635 3300005539 Bacteria 546
52 Ga0070665_100000721 3300005548 Bacteria 44003
53 Ga0070665_100042525 3300005548 Bacteria 4567
54 Ga0070665_100767832 3300005548 Bacteria 977
55 Ga0070665_100782801 3300005548 Bacteria 967
56 Ga0068855_100119862 3300005563 Bacteria 3012
57 Ga0068855_100122236 3300005563 Bacteria 2979
58 Ga0068855_100443923 3300005563 Bacteria 1416
59 Ga0068855_100492709 3300005563 Bacteria 1333
60 Ga0068855_101111046 3300005563 Bacteria 826
61 Ga0070664_101289791 3300005564 Bacteria 690
62 Ga0068854_100143800 3300005578 Bacteria 1833
63 Ga0068854_101791684 3300005578 Bacteria 563
64 Ga0068856_100616422 3300005614 Bacteria 1106
65 Ga0068856_101481523 3300005614 Bacteria 693
66 Ga0068852_100157605 3300005616 Bacteria 2116
67 Ga0068852_100270822 3300005616 Bacteria 1634
68 Ga0068859_100001326 3300005617 Bacteria 25257
69 Ga0068859_100095192 3300005617 Bacteria 3030
70 Ga0068859_101084930 3300005617 Bacteria 880
71 Ga0068864_100000058 3300005618 Bacteria 125688
72 Ga0068864_100133519 3300005618 Bacteria 2233
73 Ga0068864_100670644 3300005618 Bacteria 1011
74 Ga0068864_101674623 3300005618 Bacteria 641
75 Ga0068861_100077518 3300005719 Bacteria 2593
76 Ga0068861_100210067 3300005719 Bacteria 1639
77 Ga0068863_100000290 3300005841 Bacteria 52019
78 Ga0068863_100017625 3300005841 Bacteria 6841
79 Ga0068863_101867919 3300005841 Bacteria 611
80 Ga0068863_102663436 3300005841 Bacteria 509
81 Ga0068858_100000006 3300005842 Bacteria 256011
82 Ga0068858_100050015 3300005842 Bacteria 3869
83 Ga0068860_100000066 3300005843 Bacteria 182836
84 Ga0068860_100057261 3300005843 Bacteria 3705
85 Ga0068860_100300965 3300005843 Bacteria 1571
86 Ga0068862_100033648 3300005844 Bacteria 4334
87 Ga0068862_100036703 3300005844 Bacteria 4154
88 Ga0068862_100843336 3300005844 Bacteria 898
89 Ga0070717_10938068 3300006028 Bacteria 788
90 Ga0075363_100016426 3300006048 Bacteria 3656
91 Ga0075363_100564138 3300006048 Bacteria 680
92 Ga0075364_10000415 3300006051 Bacteria 21345
93 Ga0070712_101582750 3300006175 Bacteria 573
94 Ga0075362_10158659 3300006177 Bacteria 1088
95 Ga0075362_10382364 3300006177 Bacteria 708
96 Ga0075367_10014430 3300006178 Bacteria 4277
97 Ga0075369_10052013 3300006186 Bacteria 1775
98 Ga0075366_10089838 3300006195 Bacteria 1840
99 Ga0075366_10120337 3300006195 Bacteria 1582
100 Ga0075366_10671994 3300006195 Bacteria 643
101 Ga0075370_10025765 3300006353 Bacteria 3254
102 Ga0075370_10728133 3300006353 Bacteria 603
103 Ga0068871_100682431 3300006358 Bacteria 940
104 Ga0068865_100002365 3300006881 Bacteria 11133
105 Ga0097620_100001326 3300006931 Bacteria 25257
106 Ga0097620_100095182 3300006931 Bacteria 3030
107 Ga0097620_101084923 3300006931 Bacteria 880
108 Ga0079104_1035835 3300006946 Bacteria 1195
109 Ga0105250_10017473 3300009092 Bacteria 2917
110 Ga0105240_10009648 3300009093 Bacteria 13651
111 Ga0105240_10066752 3300009093 Bacteria 4461
112 Ga0105240_10072348 3300009093 Bacteria 4261
113 Ga0105240_10103371 3300009093 Bacteria 3462
114 Ga0105240_10246291 3300009093 Bacteria 2069
115 Ga0105240_10298931 3300009093 Bacteria 1842
116 Ga0105240_10353751 3300009093 Bacteria 1666
117 Ga0105240_10601896 3300009093 Bacteria 1210
118 Ga0105240_10792808 3300009093 Bacteria 1027
119 Ga0105240_10844874 3300009093 Bacteria 989
120 Ga0105240_11383443 3300009093 Bacteria 740
121 Ga0105241_10584565 3300009174 Bacteria 1007
122 Ga0105241_12503345 3300009174 Bacteria 517
123 Ga0105242_10424231 3300009176 Bacteria 1247
124 Ga0105248_10000746 3300009177 Bacteria 36566
125 Ga0105248_10022274 3300009177 Bacteria 7025
126 Ga0105248_10190799 3300009177 Bacteria 2309
127 Ga0105248_10195394 3300009177 Bacteria 2279
128 Ga0105248_10698791 3300009177 Bacteria 1144
129 Ga0105237_10097435 3300009545 Bacteria 2931
130 Ga0105237_10536172 3300009545 Bacteria 1177
131 Ga0105237_11484983 3300009545 Bacteria 684
132 Ga0105237_11855793 3300009545 Bacteria 610
133 Ga0105238_10004776 3300009551 Bacteria 13411
134 Ga0105238_10057017 3300009551 Bacteria 3917
135 Ga0105238_10061827 3300009551 Bacteria 3747
136 Ga0105238_10097263 3300009551 Bacteria 2929
137 Ga0105238_10224180 3300009551 Bacteria 1856
138 Ga0105238_10231133 3300009551 Bacteria 1826
139 Ga0105238_10521457 3300009551 Bacteria 1191
140 Ga0105238_10591442 3300009551 Bacteria 1117
141 Ga0105238_10784014 3300009551 Bacteria 968
142 Ga0105238_10831175 3300009551 Bacteria 940
143 Ga0105238_11192783 3300009551 Bacteria 785
144 Ga0105238_12257035 3300009551 Bacteria 579
145 Ga0105249_10539025 3300009553 Bacteria 1216
146 Ga0105249_11104521 3300009553 Bacteria 863
147 Ga0105239_10191877 3300010375 Bacteria 2287
148 Ga0105239_10217570 3300010375 Bacteria 2142
149 Ga0105239_12900097 3300010375 Bacteria 559
150 Ga0157373_10728971 3300013100 Bacteria 728
151 Ga0157370_10242102 3300013104 Bacteria 1669
152 Ga0157370_12036001 3300013104 Bacteria 515
153 Ga0157369_10405508 3300013105 Bacteria 1414
154 Ga0157369_11307115 3300013105 Bacteria 739
155 Ga0157369_11406016 3300013105 Bacteria 710
156 Ga0157378_12537729 3300013297 Bacteria 565
157 Ga0163162_10171085 3300013306 Bacteria 2297
158 Ga0163162_10833962 3300013306 Bacteria 1038
159 Ga0163162_11364976 3300013306 Bacteria 806
160 Ga0157372_10199417 3300013307 Bacteria 2318
161 Ga0157372_10525895 3300013307 Bacteria 1379
162 Ga0157372_11918157 3300013307 Bacteria 681
163 Ga0157375_10837614 3300013308 Bacteria 1067
164 Ga0163163_10004890 3300014325 Bacteria 11523
165 Ga0163163_10074529 3300014325 Bacteria 3386
166 Ga0163163_10085374 3300014325 Bacteria 3165
167 Ga0163163_10270416 3300014325 Bacteria 1751
168 Ga0163163_10497850 3300014325 Bacteria 1280
169 Ga0163163_11661567 3300014325 Bacteria 699
170 Ga0157377_10807714 3300014745 Bacteria 692
171 Ga0157379_10003062 3300014968 Bacteria 14136
172 Ga0157379_10058260 3300014968 Bacteria 3453
173 Ga0157379_10736244 3300014968 Bacteria 927
174 Ga0157376_10756607 3300014969 Bacteria 981
175 Ga0163161_10467998 3300017792 Bacteria 1021
176 Ga0213873_10233299 3300021358 Bacteria 579
177 Ga0213872_10105467 3300021361 Bacteria 1254
178 Ga0213872_10179077 3300021361 Bacteria 916
179 Ga0213874_10216462 3300021377 Bacteria 694
180 Ga0213876_10000126 3300021384 Bacteria 83223
181 Ga0213876_10067296 3300021384 Bacteria 1892
182 Ga0213876_10647071 3300021384 Bacteria 562
183 Ga0213876_10731533 3300021384 Bacteria 526
184 Ga0213875_10053635 3300021388 Bacteria 1888
185 Ga0213875_10068107 3300021388 Bacteria 1662
186 Ga0213875_10479901 3300021388 Bacteria 596
187 Ga0213871_10085741 3300021441 Bacteria 907
188 Ga0209026_1000608 3300025250 Bacteria 23009
189 Ga0209148_1005975 3300025254 Bacteria 2700
190 Ga0209676_1000713 3300025292 Bacteria 45996
191 Ga0209676_1003719 3300025292 Bacteria 9084
192 Ga0209564_1030926 3300025295 Bacteria 1648
193 Ga0209050_1002131 3300025298 Bacteria 18032
194 Ga0209050_1015597 3300025298 Bacteria 3177
195 Ga0209256_1006940 3300025299 Bacteria 5784
196 Ga0209051_1041753 3300025303 Bacteria 1629
197 Ga0209257_1000282 3300025304 Bacteria 113789
198 Ga0209257_1012368 3300025304 Bacteria 3958
199 Ga0207696_1015498 3300025711 Bacteria 2582
200 Ga0207710_10354311 3300025900 Bacteria 748
201 Ga0207680_10895874 3300025903 Bacteria 636
202 Ga0207643_10499660 3300025908 Bacteria 777
203 Ga0207705_10051030 3300025909 Bacteria 2978
204 Ga0207705_10233256 3300025909 Bacteria 1400
205 Ga0207705_10406608 3300025909 Bacteria 1053
206 Ga0207654_11209482 3300025911 Bacteria 551
207 Ga0207707_10152178 3300025912 Bacteria 2022
208 Ga0207707_10395939 3300025912 Bacteria 1186
209 Ga0207707_10411608 3300025912 Bacteria 1160
210 Ga0207695_10000269 3300025913 Bacteria 130183
211 Ga0207695_10001168 3300025913 Bacteria 45314
212 Ga0207695_10048752 3300025913 Bacteria 4471
213 Ga0207695_10072490 3300025913 Bacteria 3513
214 Ga0207695_10140288 3300025913 Bacteria 2366
215 Ga0207695_10737746 3300025913 Bacteria 865
216 Ga0207695_11649013 3300025913 Bacteria 522
217 Ga0207671_10131504 3300025914 Bacteria 1921
218 Ga0207671_10455377 3300025914 Bacteria 1019
219 Ga0207671_11388758 3300025914 Bacteria 545
220 Ga0207660_10003585 3300025917 Bacteria 10109
221 Ga0207660_10090230 3300025917 Bacteria 2270
222 Ga0207660_10328998 3300025917 Bacteria 1221
223 Ga0207660_10330894 3300025917 Bacteria 1218
224 Ga0207660_11221649 3300025917 Bacteria 611
225 Ga0207657_10019403 3300025919 Bacteria 6456
226 Ga0207657_10136331 3300025919 Bacteria 2008
227 Ga0207657_10139062 3300025919 Bacteria 1985
228 Ga0207649_10074225 3300025920 Bacteria 2182
229 Ga0207649_10323871 3300025920 Bacteria 1133
230 Ga0207652_10017249 3300025921 Bacteria 5907
231 Ga0207652_10093743 3300025921 Bacteria 2643
232 Ga0207652_10823429 3300025921 Bacteria 823
233 Ga0207652_11038305 3300025921 Bacteria 719
234 Ga0207681_10027957 3300025923 Bacteria 3651
235 Ga0207694_10007003 3300025924 Bacteria 8559
236 Ga0207694_10057270 3300025924 Bacteria 3029
237 Ga0207694_10116052 3300025924 Bacteria 2133
238 Ga0207694_10146209 3300025924 Bacteria 1903
239 Ga0207694_10199738 3300025924 Bacteria 1626
240 Ga0207694_10429682 3300025924 Bacteria 1101
241 Ga0207694_10472369 3300025924 Bacteria 1048
242 Ga0207694_10634222 3300025924 Bacteria 900
243 Ga0207694_10675343 3300025924 Bacteria 871
244 Ga0207694_10818860 3300025924 Bacteria 787
245 Ga0207694_11282600 3300025924 Bacteria 619
246 Ga0207650_10139370 3300025925 Bacteria 1906
247 Ga0207650_10700029 3300025925 Bacteria 856
248 Ga0207650_10859353 3300025925 Bacteria 770
249 Ga0207687_10149878 3300025927 Bacteria 1778
250 Ga0207644_10024158 3300025931 Bacteria 4170
251 Ga0207644_11196163 3300025931 Bacteria 639
252 Ga0207690_10000031 3300025932 Bacteria 154724
253 Ga0207690_10039791 3300025932 Bacteria 3069
254 Ga0207690_10784216 3300025932 Bacteria 787
255 Ga0207690_11141059 3300025932 Bacteria 650
256 Ga0207704_10001150 3300025938 Bacteria 11768
257 Ga0207711_10001601 3300025941 Bacteria 20928
258 Ga0207711_10012879 3300025941 Bacteria 6947
259 Ga0207711_10382004 3300025941 Bacteria 1307
260 Ga0207689_10269032 3300025942 Bacteria 1411
261 Ga0207661_10166735 3300025944 Bacteria 1915
262 Ga0207661_10725278 3300025944 Bacteria 915
263 Ga0207667_10116455 3300025949 Bacteria 2754
264 Ga0207667_10150427 3300025949 Bacteria 2396
265 Ga0207667_10184287 3300025949 Bacteria 2143
266 Ga0207667_10817124 3300025949 Bacteria 928
267 Ga0207667_11335893 3300025949 Bacteria 692
268 Ga0207667_12161574 3300025949 Bacteria 514
269 Ga0207651_11509461 3300025960 Bacteria 605
270 Ga0207712_10789854 3300025961 Bacteria 834
271 Ga0207668_10003930 3300025972 Bacteria 8764
272 Ga0207640_10105006 3300025981 Bacteria 1990
273 Ga0207658_10031911 3300025986 Bacteria 3745
274 Ga0207658_10451103 3300025986 Bacteria 1139
275 Ga0207703_10000027 3300026035 Bacteria 209608
276 Ga0207703_10039905 3300026035 Bacteria 3754
277 Ga0207639_10628794 3300026041 Bacteria 992
278 Ga0207678_10250060 3300026067 Bacteria 1518
279 Ga0207702_10038796 3300026078 Bacteria 3990
280 Ga0207702_10213026 3300026078 Bacteria 1797
281 Ga0207702_11247197 3300026078 Bacteria 738
282 Ga0207702_11422205 3300026078 Bacteria 687
283 Ga0207641_10000003 3300026088 Bacteria 496984
284 Ga0207641_10001763 3300026088 Bacteria 20861
285 Ga0207641_12123035 3300026088 Bacteria 562
286 Ga0207676_10003810 3300026095 Bacteria 10658
287 Ga0207676_10601394 3300026095 Bacteria 1056
288 Ga0207676_10966013 3300026095 Bacteria 838
289 Ga0207674_11080845 3300026116 Bacteria 771
290 Ga0207674_11993381 3300026116 Bacteria 546
291 Ga0207675_102648258 3300026118 Bacteria 510
292 Ga0207683_10692104 3300026121 Bacteria 945
293 Ga0207698_10135132 3300026142 Bacteria 2115
294 Ga0207698_10419060 3300026142 Bacteria 1284
295 Ga0207698_10459995 3300026142 Bacteria 1230
296 Ga0207698_11883859 3300026142 Bacteria 613
297 Ga0209281_1051339 3300027111 Bacteria 657
298 Ga0209813_10284717 3300027866 Bacteria 638
299 Ga0268266_10000003 3300028379 Bacteria 1701703
300 Ga0268266_10021359 3300028379 Bacteria 5515
301 Ga0268266_10100326 3300028379 Bacteria 2550
302 Ga0268266_11088710 3300028379 Bacteria 773
303 Ga0268266_11548660 3300028379 Bacteria 638
304 Ga0268266_11824234 3300028379 Bacteria 583
305 Ga0268265_10578024 3300028380 Bacteria 1070
306 Ga0268265_11138787 3300028380 Bacteria 776
307 Ga0268264_10238775 3300028381 Bacteria 1682
308 Ga0268264_11013715 3300028381 Bacteria 837
309 Ga0265319_1279553 3300028563 Bacteria 508
310 Ga0265334_10320764 3300028573 Bacteria 530
311 Ga0265318_10140855 3300028577 Bacteria 885
312 Ga0307517_10096340 3300028786 Bacteria 2371
313 Ga0307517_10284738 3300028786 Unclassified 939
314 Ga0307515_10041561 3300028794 Bacteria 7223
315 Ga0307515_10079623 3300028794 Bacteria 4288
316 Ga0265338_10033070 3300028800 Bacteria 5028
317 Ga0265338_10540773 3300028800 Bacteria 816
318 Ga0265338_10555309 3300028800 Bacteria 803
319 Ga0265325_10442573 3300031241 Bacteria 567
320 Ga0265327_10088841 3300031251 Bacteria 1511
321 Ga0265313_10172232 3300031595 Bacteria 914
322 Ga0307508_10178507 3300031616 Bacteria 1726
323 Ga0265314_10050434 3300031711 Bacteria 2907
324 Ga0265342_10475132 3300031712 Bacteria 640
325 Ga0307516_10000338 3300031730 Bacteria 61339
326 Ga0307416_101977343 3300032002 Bacteria 686
327 Ga0307510_10023326 3300033180 Bacteria 7174
328 Ga0373936_0003245 3300035113 Bacteria 6098
329 Ga0373943_0520767 3300035170 Bacteria 696
330 Ga0373946_0035402 3300035171 Bacteria 2020
331 Ga0373946_0707594 3300035171 Bacteria 527
332 Ga0373935_0237790 3300035692 Bacteria 1270
333 Ga0373927_0000111 3300035695 Bacteria 62031
334 Ga0373933_1172646 3300035724 Bacteria 506
335 Ga0373947_0883762 3300035725 Bacteria 610
336 Ga0373937_0777671 3300036401 Bacteria 905
337 Ga0373937_0900200 3300036401 Bacteria 834
338 Ga0373937_0927233 3300036401 Bacteria 820
339 Ga0373937_1186210 3300036401 Bacteria 712
340 Ga0373925_0000209 3300037068 Bacteria 64086
341 Ga0373925_0033394 3300037068 Bacteria 3792
342 Ga0373925_0879018 3300037068 Bacteria 739
343 Ga0395899_0000018 3300037312 Bacteria 423194
344 Ga0395899_0109762 3300037312 Bacteria 1984
345 Ga0395899_0210453 3300037312 Bacteria 1351
346 Ga0395900_0083605 3300037418 Bacteria 3279
347 Ga0395900_0905315 3300037418 Bacteria 805
348 Ga0395900_0917708 3300037418 Bacteria 798
349 Ga0395900_0982795 3300037418 Bacteria 764
350 Ga0395898_0062040 3300037466 Bacteria 3631
351 Ga0395898_0150971 3300037466 Bacteria 2223
352 Ga0395898_0339030 3300037466 Bacteria 1433
353 Ga0395898_0529065 3300037466 Bacteria 1120
354 Ga0395905_0019172 3300037471 Bacteria 6487
355 Ga0395905_0075894 3300037471 Bacteria 3150
356 Ga0395905_0385061 3300037471 Bacteria 1296
357 Ga0395905_0546566 3300037471 Bacteria 1059
358 Ga0395905_0869423 3300037471 Bacteria 805
359 Ga0395905_1061592 3300037471 Bacteria 713
360 Ga0395905_1581833 3300037471 Bacteria 560
361 Ga0436364_0128536 3300037853 Bacteria 1411
362 Ga0436364_0156352 3300037853 Bacteria 6458
363 Ga0436364_0709125 3300037853 Bacteria 7310
364 Ga0436364_0921332 3300037853 Bacteria 1622
365 Ga0395901_0120021 3300038443 Bacteria 2763
366 Ga0395901_0210664 3300038443 Bacteria 2034
367 Ga0395901_1218958 3300038443 Bacteria 717
368 Ga0395901_1232468 3300038443 Bacteria 712
369 Ga0436365_0043364 3300039437 Bacteria 2364
370 Ga0436365_0593717 3300039437 Bacteria 12392
371 Ga0436365_0604316 3300039437 Bacteria 3459
372 Ga0436365_0609077 3300039437 Bacteria 3363
373 Ga0436365_1698968 3300039437 Bacteria 999
374 Ga0436365_1937184 3300039437 Bacteria 1523
375 Ga0436360_0367867 3300039438 Bacteria 507
376 Ga0436360_0435957 3300039438 Bacteria 6417
377 Ga0436361_1012460 3300039447 Bacteria 850
378 Ga0436361_1019684 3300039447 Bacteria 1715
379 Ga0436361_1187531 3300039447 Bacteria 599
380 Ga0436361_1207354 3300039447 Bacteria 7035
381 Ga0436363_0052366 3300039450 Bacteria 1738
382 Ga0436363_0720807 3300039450 Bacteria 561
383 Ga0436362_0288192 3300039453 Bacteria 588
384 Ga0436362_0545548 3300039453 Bacteria 3597
385 Ga0451804_0459622 3300041463 Bacteria 506
386 Ga0451807_0232979 3300041486 Bacteria 578
387 Ga0466972_0220818 3300044658 Bacteria 887
388 Ga0466966_0149928 3300044684 Bacteria 1423
389 Ga0466966_0969539 3300044684 Bacteria 513
390 Ga0466968_0423087 3300044735 Bacteria 655
391 Ga0466957_0190351 3300044842 Bacteria 1344
392 Ga0466960_0085372 3300044901 Bacteria 1599
393 Ga0466959_0015302 3300045049 Bacteria 5586
394 Ga0466959_0218767 3300045049 Bacteria 1322
395 Ga0466959_1196475 3300045049 Bacteria 505
396 Ga0495592_0222941 3300046454 Bacteria 1260
397 Ga0495590_0022740 3300046457 Bacteria 2216
398 Ga0495629_0105142 3300046459 Bacteria 1969
399 Ga0495638_0000688 3300046460 Bacteria 36751
400 Ga0495638_0068775 3300046460 Bacteria 2171
401 Ga0495650_0024004 3300046471 Bacteria 2889
402 Ga0495585_0467522 3300046492 Bacteria 602
403 Ga0495583_0232912 3300046506 Bacteria 742
404 Ga0495606_0067663 3300046507 Bacteria 2261
405 Ga0495606_0080400 3300046507 Bacteria 2028
406 Ga0495610_0002440 3300046512 Bacteria 15640
407 Ga0495610_0018450 3300046512 Bacteria 3940
408 Ga0495620_0166193 3300046515 Bacteria 856
409 Ga0495628_0343092 3300046516 Bacteria 1099
410 Ga0495630_0930377 3300046517 Bacteria 662
411 Ga0495631_0006312 3300046518 Bacteria 6134
412 Ga0495637_0053082 3300046520 Bacteria 1689
413 Ga0495643_0022945 3300046522 Bacteria 3552
414 Ga0495643_0189474 3300046522 Bacteria 994
415 Ga0495648_0000039 3300046524 Bacteria 185430
416 Ga0495648_0158297 3300046524 Bacteria 1174
417 Ga0495642_0100282 3300046528 Bacteria 1232
418 Ga0495642_0125404 3300046528 Bacteria 1103
419 Ga0495654_0039482 3300046530 Bacteria 2356
420 Ga0495654_0050067 3300046530 Bacteria 2043
421 Ga0495609_0235526 3300046538 Bacteria 757
422 Ga0495597_0000877 3300046542 Bacteria 23394
423 Ga0495645_0122671 3300046543 Bacteria 1828
424 Ga0495622_0002815 3300046557 Bacteria 8296
425 Ga0495668_0000040 3300046616 Bacteria 230681
426 Ga0495668_0001804 3300046616 Bacteria 19521
427 Ga0495668_0005894 3300046616 Bacteria 8160
428 Ga0495668_0024881 3300046616 Bacteria 3404
429 Ga0495668_0024967 3300046616 Bacteria 3397
430 Ga0495668_0038359 3300046616 Bacteria 2677
431 Ga0495668_0099182 3300046616 Bacteria 1594
432 Ga0495611_0004678 3300046648 Bacteria 5878
433 Ga0495625_0045008 3300046660 Bacteria 3192
434 Ga0495625_0134806 3300046660 Bacteria 1670
435 Ga0495625_0139861 3300046660 Bacteria 1634
436 Ga0495625_0321032 3300046660 Bacteria 986
437 Ga0495625_0659179 3300046660 Bacteria 622
438 Ga0495661_0291671 3300046665 Bacteria 819
439 Ga0495588_0090375 3300046674 Bacteria 1604
440 Ga0495588_0220944 3300046674 Bacteria 1000
441 Ga0495669_0000731 3300046684 Bacteria 14261
442 Ga0495669_0002870 3300046684 Bacteria 7073
443 Ga0495613_0952604 3300046689 Bacteria 553
444 Ga0495671_0131571 3300046692 Bacteria 1220
445 Ga0495581_0184899 3300047315 Bacteria 1219
446 Ga0495674_0966276 3300047319 Bacteria 654
447 Ga0495687_211671 3300047443 Bacteria 607
448 Ga0495677_0051369 3300047445 Bacteria 1518
449 Ga0495673_0000148 3300047469 Bacteria 124135
450 Ga0495686_0001955 3300047472 Bacteria 20498
451 Ga0495602_0505673 3300048088 Bacteria 844
452 Ga0496101_0539915 3300048904 Bacteria 922
453 Ga0496102_0003957 3300048905 Bacteria 12562
454 Ga0496102_1751829 3300048905 Bacteria 539
455 Ga0496103_0497669 3300048906 Bacteria 780
456 Ga0496104_1433207 3300048907 Bacteria 594
457 Ga0496106_0595501 3300048909 Bacteria 886
458 Ga0496107_0072776 3300048910 Bacteria 2499
459 Ga0496108_0009962 3300048911 Bacteria 7704
460 Ga0496109_0106665 3300048912 Bacteria 2602
461 Ga0496112_0964660 3300048915 Bacteria 773
462 Ga0496112_1403157 3300048915 Bacteria 613
463 Ga0496115_0000460 3300048918 Bacteria 32584
464 Ga0496115_0000467 3300048918 Bacteria 32205
465 Ga0496115_0064772 3300048918 Bacteria 2951
466 Ga0496120_0378673 3300048923 Bacteria 630
467 Ga0496121_0224002 3300048924 Bacteria 1322
468 Ga0496124_0019539 3300048927 Bacteria 6299
469 Ga0496124_0261872 3300048927 Bacteria 1272
470 Ga0496125_0037050 3300048928 Bacteria 4246
471 Ga0496126_0011392 3300048929 Bacteria 9212
472 Ga0496126_0524634 3300048929 Bacteria 943
473 Ga0495678_001042 3300049459 Bacteria 23497
474 Ga0501032_0349437 3300049569 Bacteria 953
475 Ga0501033_0040817 3300049570 Bacteria 3464
476 Ga0501033_0248239 3300049570 Bacteria 1262
477 Ga0501033_0701266 3300049570 Bacteria 689
478 Ga0501034_0362264 3300049571 Bacteria 1377
479 Ga0501034_1572997 3300049571 Bacteria 531
480 Ga0501038_0584971 3300049574 Bacteria 846
481 Ga0501046_1129939 3300049580 Bacteria 540
482 Ga0501047_0022986 3300049581 Bacteria 5985
483 Ga0501047_0103456 3300049581 Bacteria 2728
484 Ga0501047_0120785 3300049581 Bacteria 2503
485 Ga0501047_0314700 3300049581 Bacteria 1406
486 Ga0501048_0102758 3300049582 Bacteria 2017
487 Ga0501035_0125543 3300049822 Bacteria 2240
488 Ga0501035_1219648 3300049822 Bacteria 583
489 Ga0501035_1348547 3300049822 Bacteria 548
490 Ga0501044_0231007 3300049823 Bacteria 1797
491 Ga0501044_0273759 3300049823 Bacteria 1623
492 Ga0501044_0867508 3300049823 Bacteria 779
493 Ga0501044_1508515 3300049823 Bacteria 537
494 nmdc:mga03683_279993_c1 3300050489 Bacteria 779
495 nmdc:mga03n38_498756_c1 3300050490 Bacteria 683
496 nmdc:mga03n38_943355_c1 3300050490 Bacteria 509
497 nmdc:mga00v17_494_c1 3300050491 Bacteria 22171
498 nmdc:mga0k408_126535_c1 3300050493 Bacteria 1516
499 nmdc:mga0k408_372634_c1 3300050493 Bacteria 851
500 nmdc:mga0k408_43154_c1 3300050493 Bacteria 2598
501 nmdc:mga06z11_25706_c1 3300050494 Bacteria 2794
502 nmdc:mga06z11_692696_c1 3300050494 Bacteria 621
503 nmdc:mga04h51_317928_c1 3300050495 Bacteria 638
504 nmdc:mga07m45_140017_c1 3300050496 Bacteria 1401
505 nmdc:mga07m45_197258_c1 3300050496 Bacteria 1171
506 nmdc:mga07m45_31489_c1 3300050496 Bacteria 2940
507 nmdc:mga07m45_472012_c1 3300050496 Bacteria 727
508 nmdc:mga0sz30_131970_c1 3300050516 Bacteria 1101
509 nmdc:mga0sz30_235560_c1 3300050516 Bacteria 815
510 Ga0495601_0523676 3300053077 Bacteria 764
511 Ga0500578_0000041 3300053086 Bacteria 129580
512 Ga0500578_0527733 3300053086 Bacteria 660
513 Ga0500643_054761 3300053087 Bacteria 1131
514 Ga0500643_113137 3300053087 Bacteria 732
515 Ga0500644_0000984 3300053088 Bacteria 8874
516 Ga0500644_0348663 3300053088 Bacteria 640
517 Ga0500646_0136084 3300053090 Bacteria 803
518 Ga0500651_0193724 3300053093 Bacteria 1202
519 Ga0500651_0304454 3300053093 Bacteria 914
520 Ga0500566_0322648 3300053094 Bacteria 718
521 Ga0500641_0201531 3300053096 Bacteria 849
522 Ga0500641_0284236 3300053096 Bacteria 684
523 Ga0500555_000832 3300053103 Bacteria 11017
524 Ga0500555_012018 3300053103 Bacteria 2488
525 Ga0500555_062525 3300053103 Bacteria 998
526 Ga0500556_0006739 3300053104 Bacteria 3266
527 Ga0500562_000786 3300053108 Bacteria 7753
528 Ga0500562_018791 3300053108 Bacteria 1785
529 Ga0500569_002122 3300053109 Bacteria 3858
530 Ga0500594_0000437 3300053118 Bacteria 9204
531 Ga0500595_008594 3300053119 Bacteria 4166
532 Ga0500595_029784 3300053119 Bacteria 1848
533 Ga0500608_000487 3300053122 Bacteria 14877
534 Ga0500608_076394 3300053122 Bacteria 1586
535 Ga0500614_106423 3300053123 Bacteria 813
536 Ga0500621_149245 3300053126 Bacteria 879
537 Ga0500658_0104062 3300053134 Bacteria 1242
538 Ga0500559_0000004 3300053136 Bacteria 241551
539 Ga0500559_0002849 3300053136 Bacteria 8736
540 Ga0500559_0009524 3300053136 Bacteria 4198
541 Ga0500564_001058 3300053138 Bacteria 9075
542 Ga0500568_0011648 3300053139 Bacteria 4068
543 Ga0500577_0302106 3300053142 Bacteria 699
544 Ga0500588_0258519 3300053146 Bacteria 655
545 Ga0500590_239482 3300053148 Bacteria 731
546 Ga0500619_024052 3300053154 Bacteria 1788
547 Ga0500622_0014800 3300053156 Bacteria 4182
548 Ga0500622_0015451 3300053156 Bacteria 4086
549 Ga0500622_0039857 3300053156 Bacteria 2448
550 Ga0500633_0076019 3300053160 Bacteria 1208
551 Ga0500639_351693 3300053163 Bacteria 521
552 Ga0500636_0005973 3300053177 Bacteria 6977
553 Ga0500637_0354651 3300053178 Bacteria 779
554 Ga0500625_256998 3300053729 Bacteria 513
555 2585150162 2582581279 Bacteria 4980720
556 2857505906 2857504554 Bacteria 5369913
557 Ga0105245_10206576
558 Ga0055526_1063621
559 Ga0055536_1012522
560 Ga0055536_1013219
561 Ga0055530_10008227
562 Ga0055530_10011679
563 Ga0055540_1031480
564 Ga0055531_10000947
565 Ga0070658_10170958
566 Ga0070658_10419669
567 Ga0070658_10432722
568 Ga0070670_100035149
569 Ga0070670_100791872
570 Ga0068869_100259412
571 Ga0068869_101995018
572 Ga0070666_10843640
573 Ga0070666_11436101
574 Ga0070680_100007014
575 Ga0070680_100034138
576 Ga0070680_101242240
577 Ga0070660_100034919
578 Ga0070660_100141000
579 Ga0070660_101133149
580 Ga0070660_101206305
581 Ga0070691_10017047
582 Ga0070668_100002963
583 Ga0070668_100004810
584 Ga0070668_100005098
585 Ga0070671_100006295
586 Ga0070671_100207489
587 Ga0070673_101677447
588 Ga0070688_101127641
589 Ga0070659_100001009
590 Ga0070659_100363954
591 Ga0070667_100007531
592 Ga0070667_100073226
593 Ga0070667_100934452
594 Ga0070663_101927979
595 Ga0070678_101576608
596 Ga0070681_10018764
597 Ga0070681_10024623
598 Ga0070681_11753621
599 Ga0068867_101260353
600 Ga0070706_100891049
601 Ga0070679_100007148
602 Ga0070679_100081634
603 Ga0070679_100710222
604 Ga0070679_101641120
605 Ga0068853_100028340
606 Ga0068853_102078690
607 Ga0068853_102116635
608 Ga0070665_100000721
609 Ga0070665_100042525
610 Ga0070665_100767832
611 Ga0070665_100782801
612 Ga0068855_100119862
613 Ga0068855_100122236
614 Ga0068855_100443923
615 Ga0068855_100492709
616 Ga0068855_101111046
617 Ga0070664_101289791
618 Ga0068854_100143800
619 Ga0068854_101791684
620 Ga0068856_100616422
621 Ga0068856_101481523
622 Ga0068852_100157605
623 Ga0068852_100270822
624 Ga0068859_100001326
625 Ga0068859_100095192
626 Ga0068859_101084930
627 Ga0068864_100000058
628 Ga0068864_100133519
629 Ga0068864_100670644
630 Ga0068864_101674623
631 Ga0068861_100077518
632 Ga0068861_100210067
633 Ga0068863_100000290
634 Ga0068863_100017625
635 Ga0068863_101867919
636 Ga0068863_102663436
637 Ga0068858_100000006
638 Ga0068858_100050015
639 Ga0068860_100000066
640 Ga0068860_100057261
641 Ga0068860_100300965
642 Ga0068862_100033648
643 Ga0068862_100036703
644 Ga0068862_100843336
645 Ga0070717_10938068
646 Ga0075363_100016426
647 Ga0075363_100564138
648 Ga0075364_10000415
649 Ga0070712_101582750
650 Ga0075362_10158659
651 Ga0075362_10382364
652 Ga0075367_10014430
653 Ga0075369_10052013
654 Ga0075366_10089838
655 Ga0075366_10120337
656 Ga0075366_10671994
657 Ga0075370_10025765
658 Ga0075370_10728133
659 Ga0068871_100682431
660 Ga0068865_100002365
661 Ga0097620_100001326
662 Ga0097620_100095182
663 Ga0097620_101084923
664 Ga0079104_1035835
665 Ga0105250_10017473
666 Ga0105240_10009648
667 Ga0105240_10066752
668 Ga0105240_10072348
669 Ga0105240_10103371
670 Ga0105240_10246291
671 Ga0105240_10298931
672 Ga0105240_10353751
673 Ga0105240_10601896
674 Ga0105240_10792808
675 Ga0105240_10844874
676 Ga0105240_11383443
677 Ga0105241_10584565
678 Ga0105241_12503345
679 Ga0105242_10424231
680 Ga0105248_10000746
681 Ga0105248_10022274
682 Ga0105248_10190799
683 Ga0105248_10195394
684 Ga0105248_10698791
685 Ga0105237_10097435
686 Ga0105237_10536172
687 Ga0105237_11484983
688 Ga0105237_11855793
689 Ga0105238_10004776
690 Ga0105238_10057017
691 Ga0105238_10061827
692 Ga0105238_10097263
693 Ga0105238_10224180
694 Ga0105238_10231133
695 Ga0105238_10521457
696 Ga0105238_10591442
697 Ga0105238_10784014
698 Ga0105238_10831175
699 Ga0105238_11192783
700 Ga0105238_12257035
701 Ga0105249_10539025
702 Ga0105249_11104521
703 Ga0105239_10191877
704 Ga0105239_10217570
705 Ga0105239_12900097
706 Ga0157373_10728971
707 Ga0157370_10242102
708 Ga0157370_12036001
709 Ga0157369_10405508
710 Ga0157369_11307115
711 Ga0157369_11406016
712 Ga0157378_12537729
713 Ga0163162_10171085
714 Ga0163162_10833962
715 Ga0163162_11364976
716 Ga0157372_10199417
717 Ga0157372_10525895
718 Ga0157372_11918157
719 Ga0157375_10837614
720 Ga0163163_10004890
721 Ga0163163_10074529
722 Ga0163163_10085374
723 Ga0163163_10270416
724 Ga0163163_10497850
725 Ga0163163_11661567
726 Ga0157377_10807714
727 Ga0157379_10003062
728 Ga0157379_10058260
729 Ga0157379_10736244
730 Ga0157376_10756607
731 Ga0163161_10467998
732 Ga0213873_10233299
733 Ga0213872_10105467
734 Ga0213872_10179077
735 Ga0213874_10216462
736 Ga0213876_10000126
737 Ga0213876_10067296
738 Ga0213876_10647071
739 Ga0213876_10731533
740 Ga0213875_10053635
741 Ga0213875_10068107
742 Ga0213875_10479901
743 Ga0213871_10085741
744 Ga0209026_1000608
745 Ga0209148_1005975
746 Ga0209676_1000713
747 Ga0209676_1003719
748 Ga0209564_1030926
749 Ga0209050_1002131
750 Ga0209050_1015597
751 Ga0209256_1006940
752 Ga0209051_1041753
753 Ga0209257_1000282
754 Ga0209257_1012368
755 Ga0207696_1015498
756 Ga0207710_10354311
757 Ga0207680_10895874
758 Ga0207643_10499660
759 Ga0207705_10051030
760 Ga0207705_10233256
761 Ga0207705_10406608
762 Ga0207654_11209482
763 Ga0207707_10152178
764 Ga0207707_10395939
765 Ga0207707_10411608
766 Ga0207695_10000269
767 Ga0207695_10001168
768 Ga0207695_10048752
769 Ga0207695_10072490
770 Ga0207695_10140288
771 Ga0207695_10737746
772 Ga0207695_11649013
773 Ga0207671_10131504
774 Ga0207671_10455377
775 Ga0207671_11388758
776 Ga0207660_10003585
777 Ga0207660_10090230
778 Ga0207660_10328998
779 Ga0207660_10330894
780 Ga0207660_11221649
781 Ga0207657_10019403
782 Ga0207657_10136331
783 Ga0207657_10139062
784 Ga0207649_10074225
785 Ga0207649_10323871
786 Ga0207652_10017249
787 Ga0207652_10093743
788 Ga0207652_10823429
789 Ga0207652_11038305
790 Ga0207681_10027957
791 Ga0207694_10007003
792 Ga0207694_10057270
793 Ga0207694_10116052
794 Ga0207694_10146209
795 Ga0207694_10199738
796 Ga0207694_10429682
797 Ga0207694_10472369
798 Ga0207694_10634222
799 Ga0207694_10675343
800 Ga0207694_10818860
801 Ga0207694_11282600
802 Ga0207650_10139370
803 Ga0207650_10700029
804 Ga0207650_10859353
805 Ga0207687_10149878
806 Ga0207644_10024158
807 Ga0207644_11196163
808 Ga0207690_10000031
809 Ga0207690_10039791
810 Ga0207690_10784216
811 Ga0207690_11141059
812 Ga0207704_10001150
813 Ga0207711_10001601
814 Ga0207711_10012879
815 Ga0207711_10382004
816 Ga0207689_10269032
817 Ga0207661_10166735
818 Ga0207661_10725278
819 Ga0207667_10116455
820 Ga0207667_10150427
821 Ga0207667_10184287
822 Ga0207667_10817124
823 Ga0207667_11335893
824 Ga0207667_12161574
825 Ga0207651_11509461
826 Ga0207712_10789854
827 Ga0207668_10003930
828 Ga0207640_10105006
829 Ga0207658_10031911
830 Ga0207658_10451103
831 Ga0207703_10000027
832 Ga0207703_10039905
833 Ga0207639_10628794
834 Ga0207678_10250060
835 Ga0207702_10038796
836 Ga0207702_10213026
837 Ga0207702_11247197
838 Ga0207702_11422205
839 Ga0207641_10000003
840 Ga0207641_10001763
841 Ga0207641_12123035
842 Ga0207676_10003810
843 Ga0207676_10601394
844 Ga0207676_10966013
845 Ga0207674_11080845
846 Ga0207674_11993381
847 Ga0207675_102648258
848 Ga0207683_10692104
849 Ga0207698_10135132
850 Ga0207698_10419060
851 Ga0207698_10459995
852 Ga0207698_11883859
853 Ga0209281_1051339
854 Ga0209813_10284717
855 Ga0268266_10000003
856 Ga0268266_10021359
857 Ga0268266_10100326
858 Ga0268266_11088710
859 Ga0268266_11548660
860 Ga0268266_11824234
861 Ga0268265_10578024
862 Ga0268265_11138787
863 Ga0268264_10238775
864 Ga0268264_11013715
865 Ga0265319_1279553
866 Ga0265334_10320764
867 Ga0265318_10140855
868 Ga0307517_10096340
869 Ga0307517_10284738
870 Ga0307515_10041561
871 Ga0307515_10079623
872 Ga0265338_10033070
873 Ga0265338_10540773
874 Ga0265338_10555309
875 Ga0265325_10442573
876 Ga0265327_10088841
877 Ga0265313_10172232
878 Ga0307508_10178507
879 Ga0265314_10050434
880 Ga0265342_10475132
881 Ga0307516_10000338
882 Ga0307416_101977343
883 Ga0307510_10023326
884 Ga0373936_0003245
885 Ga0373943_0520767
886 Ga0373946_0035402
887 Ga0373946_0707594
888 Ga0373935_0237790
889 Ga0373927_0000111
890 Ga0373933_1172646
891 Ga0373947_0883762
892 Ga0373937_0777671
893 Ga0373937_0900200
894 Ga0373937_0927233
895 Ga0373937_1186210
896 Ga0373925_0000209
897 Ga0373925_0033394
898 Ga0373925_0879018
899 Ga0395899_0000018
900 Ga0395899_0109762
901 Ga0395899_0210453
902 Ga0395900_0083605
903 Ga0395900_0905315
904 Ga0395900_0917708
905 Ga0395900_0982795
906 Ga0395898_0062040
907 Ga0395898_0150971
908 Ga0395898_0339030
909 Ga0395898_0529065
910 Ga0395905_0019172
911 Ga0395905_0075894
912 Ga0395905_0385061
913 Ga0395905_0546566
914 Ga0395905_0869423
915 Ga0395905_1061592
916 Ga0395905_1581833
917 Ga0436364_0128536
918 Ga0436364_0156352
919 Ga0436364_0709125
920 Ga0436364_0921332
921 Ga0395901_0120021
922 Ga0395901_0210664
923 Ga0395901_1218958
924 Ga0395901_1232468
925 Ga0436365_0043364
926 Ga0436365_0593717
927 Ga0436365_0604316
928 Ga0436365_0609077
929 Ga0436365_1698968
930 Ga0436365_1937184
931 Ga0436360_0367867
932 Ga0436360_0435957
933 Ga0436361_1012460
934 Ga0436361_1019684
935 Ga0436361_1187531
936 Ga0436361_1207354
937 Ga0436363_0052366
938 Ga0436363_0720807
939 Ga0436362_0288192
940 Ga0436362_0545548
941 Ga0451804_0459622
942 Ga0451807_0232979
943 Ga0466972_0220818
944 Ga0466966_0149928
945 Ga0466966_0969539
946 Ga0466968_0423087
947 Ga0466957_0190351
948 Ga0466960_0085372
949 Ga0466959_0015302
950 Ga0466959_0218767
951 Ga0466959_1196475
952 Ga0495592_0222941
953 Ga0495590_0022740
954 Ga0495629_0105142
955 Ga0495638_0000688
956 Ga0495638_0068775
957 Ga0495650_0024004
958 Ga0495585_0467522
959 Ga0495583_0232912
960 Ga0495606_0067663
961 Ga0495606_0080400
962 Ga0495610_0002440
963 Ga0495610_0018450
964 Ga0495620_0166193
965 Ga0495628_0343092
966 Ga0495630_0930377
967 Ga0495631_0006312
968 Ga0495637_0053082
969 Ga0495643_0022945
970 Ga0495643_0189474
971 Ga0495648_0000039
972 Ga0495648_0158297
973 Ga0495642_0100282
974 Ga0495642_0125404
975 Ga0495654_0039482
976 Ga0495654_0050067
977 Ga0495609_0235526
978 Ga0495597_0000877
979 Ga0495645_0122671
980 Ga0495622_0002815
981 Ga0495668_0000040
982 Ga0495668_0001804
983 Ga0495668_0005894
984 Ga0495668_0024881
985 Ga0495668_0024967
986 Ga0495668_0038359
987 Ga0495668_0099182
988 Ga0495611_0004678
989 Ga0495625_0045008
990 Ga0495625_0134806
991 Ga0495625_0139861
992 Ga0495625_0321032
993 Ga0495625_0659179
994 Ga0495661_0291671
995 Ga0495588_0090375
996 Ga0495588_0220944
997 Ga0495669_0000731
998 Ga0495669_0002870
999 Ga0495613_0952604
1000 Ga0495671_0131571
1001 Ga0495581_0184899
1002 Ga0495674_0966276
1003 Ga0495687_211671
1004 Ga0495677_0051369
1005 Ga0495673_0000148
1006 Ga0495686_0001955
1007 Ga0495602_0505673
1008 Ga0496101_0539915
1009 Ga0496102_0003957
1010 Ga0496102_1751829
1011 Ga0496103_0497669
1012 Ga0496104_1433207
1013 Ga0496106_0595501
1014 Ga0496107_0072776
1015 Ga0496108_0009962
1016 Ga0496109_0106665
1017 Ga0496112_0964660
1018 Ga0496112_1403157
1019 Ga0496115_0000460
1020 Ga0496115_0000467
1021 Ga0496115_0064772
1022 Ga0496120_0378673
1023 Ga0496121_0224002
1024 Ga0496124_0019539
1025 Ga0496124_0261872
1026 Ga0496125_0037050
1027 Ga0496126_0011392
1028 Ga0496126_0524634
1029 Ga0495678_001042
1030 Ga0501032_0349437
1031 Ga0501033_0040817
1032 Ga0501033_0248239
1033 Ga0501033_0701266
1034 Ga0501034_0362264
1035 Ga0501034_1572997
1036 Ga0501038_0584971
1037 Ga0501046_1129939
1038 Ga0501047_0022986
1039 Ga0501047_0103456
1040 Ga0501047_0120785
1041 Ga0501047_0314700
1042 Ga0501048_0102758
1043 Ga0501035_0125543
1044 Ga0501035_1219648
1045 Ga0501035_1348547
1046 Ga0501044_0231007
1047 Ga0501044_0273759
1048 Ga0501044_0867508
1049 Ga0501044_1508515
1050 nmdc:mga03683_279993_c1
1051 nmdc:mga03n38_498756_c1
1052 nmdc:mga03n38_943355_c1
1053 nmdc:mga00v17_494_c1
1054 nmdc:mga0k408_126535_c1
1055 nmdc:mga0k408_372634_c1
1056 nmdc:mga0k408_43154_c1
1057 nmdc:mga06z11_25706_c1
1058 nmdc:mga06z11_692696_c1
1059 nmdc:mga04h51_317928_c1
1060 nmdc:mga07m45_140017_c1
1061 nmdc:mga07m45_197258_c1
1062 nmdc:mga07m45_31489_c1
1063 nmdc:mga07m45_472012_c1
1064 nmdc:mga0sz30_131970_c1
1065 nmdc:mga0sz30_235560_c1
1066 Ga0495601_0523676
1067 Ga0500578_0000041
1068 Ga0500578_0527733
1069 Ga0500643_054761
1070 Ga0500643_113137
1071 Ga0500644_0000984
1072 Ga0500644_0348663
1073 Ga0500646_0136084
1074 Ga0500651_0193724
1075 Ga0500651_0304454
1076 Ga0500566_0322648
1077 Ga0500641_0201531
1078 Ga0500641_0284236
1079 Ga0500555_000832
1080 Ga0500555_012018
1081 Ga0500555_062525
1082 Ga0500556_0006739
1083 Ga0500562_000786
1084 Ga0500562_018791
1085 Ga0500569_002122
1086 Ga0500594_0000437
1087 Ga0500595_008594
1088 Ga0500595_029784
1089 Ga0500608_000487
1090 Ga0500608_076394
1091 Ga0500614_106423
1092 Ga0500621_149245
1093 Ga0500658_0104062
1094 Ga0500559_0000004
1095 Ga0500559_0002849
1096 Ga0500559_0009524
1097 Ga0500564_001058
1098 Ga0500568_0011648
1099 Ga0500577_0302106
1100 Ga0500588_0258519
1101 Ga0500590_239482
1102 Ga0500619_024052
1103 Ga0500622_0014800
1104 Ga0500622_0015451
1105 Ga0500622_0039857
1106 Ga0500633_0076019
1107 Ga0500639_351693
1108 Ga0500636_0005973
1109 Ga0500637_0354651
1110 Ga0500625_256998
1111 2585150162
1112 2857505906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03966

Trm112p

Trm112p-like protein

24

63

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pk7-assembly1.cif.gz_B crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1 0.9415 15 64
5nqd-assembly2.cif.gz_D arsenite oxidase aioab from rhizobium sp. str. nt-26 mutant aiobf108a 0.9374 20 47
2pk7-assembly1.cif.gz_A crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1 0.9263 15 64
1g8j-assembly1.cif.gz_B crystal structure analysis of arsenite oxidase from alcaligenes faecalis 0.8914 27 47
6zxw-assembly1.cif.gz_H structure of archaeoglobus fulgidus trm11-trm112 m2g10 trna methyltransferase complex bound to sinefungin 0.8629 13 59
ID Description Score Start End Superfamily
af_Q5U1Z8_55_112_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9892 19 64 2.20.25.10
af_Q8LG27_23_76_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9864 19 65 2.20.25.10
2hf1B01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9855 19 64 2.20.25.10
4aayB00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9433 20 47 2.102.10.10
af_O33186_9_68_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8879 19 65 2.20.25.10
ID Description Score Start End GO Terms
AF-L1JI65-F1-model_v4 Protein preY, mitochondrial 0.9942 19 65
AF-A0A424T3G9-F1-model_v4 UPF0434 protein CBC49_010440 0.994 19 63 GO:0005829
AF-A0A812YTK1-F1-model_v4 deleted 0.9938 16 62
AF-A0A2I0AKG1-F1-model_v4 Protein preY, mitochondrial 0.9895 11 65
AF-A1TQ98-F1-model_v4 UPF0434 protein Aave_2563 0.9884 12 65 GO:0005829

Map