F463149
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 555 | 248 | 1110 | 396 |
Family's Representative Sequence
| Representative Sequence | 3300048913|Ga0496110_0073033|Ga0496110_0073033_998_2212 |
| Length | 404 |
| Sequence | MLAVADRVSFDVLVVGSGASGLAAALSAERAGARVALVSKGSLQSCNSAKAQGGIQAAFGEDDSPEQHADDVWQSSHETADRSLVEVLTAEAPGAIHWLEEQGVEFTRENGGYRLARCGGATRKRLLQVGDRTGHAITTALRDAYTASGGESFPNAPLVALEQSENGWVATCRRKSGDELVIGAGAVVLAAGGRCYRVAEELGELSTNHPGATGEVTELALDLGAESRDLDALQYHPNGGAWPPTMQGYSIPETTRAYGATLLNADGDEFTDPLGPRDAVSQAIFEEVDAGRGVETPDGRPAVYLDTTRIAEHDAEISLPYMLRRYRSAGIDPLREPILTFPVLHYQNGGLVIDEHGETTLPGLYACGEIAGGTHGRNRMMGNSLLECTVFGRRAGLAAAGRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 121 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 123 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 135 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 148 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 149 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 154 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 155 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 156 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 157 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 158 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 163 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 196 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 203 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 12.61 |
| Rhizosphere | 85.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496110_0073033 | 3300048913 | Bacteria | 3044 |
| 2 | Ga0070658_10002497 | 3300005327 | Bacteria | 15366 |
| 3 | Ga0070658_10011603 | 3300005327 | Bacteria | 7067 |
| 4 | Ga0070658_10030991 | 3300005327 | Bacteria | 4294 |
| 5 | Ga0070683_100006342 | 3300005329 | Bacteria | 9917 |
| 6 | Ga0070683_100008056 | 3300005329 | Bacteria | 8949 |
| 7 | Ga0070683_100140085 | 3300005329 | Bacteria | 2291 |
| 8 | Ga0070690_100045366 | 3300005330 | Unclassified | 2792 |
| 9 | Ga0068869_100124303 | 3300005334 | Bacteria | 1977 |
| 10 | Ga0070680_100022365 | 3300005336 | Bacteria | 5036 |
| 11 | Ga0070660_100013533 | 3300005339 | Bacteria | 5854 |
| 12 | Ga0070660_100058974 | 3300005339 | Unclassified | 2976 |
| 13 | Ga0070661_100140376 | 3300005344 | Bacteria | 1820 |
| 14 | Ga0070692_10027195 | 3300005345 | Unclassified | 2833 |
| 15 | Ga0070674_100119587 | 3300005356 | Bacteria | 1948 |
| 16 | Ga0070673_100096373 | 3300005364 | Bacteria | 2428 |
| 17 | Ga0070659_100093069 | 3300005366 | Unclassified | 2418 |
| 18 | Ga0070703_10000997 | 3300005406 | Bacteria | 8911 |
| 19 | Ga0070709_10031557 | 3300005434 | Bacteria | 3188 |
| 20 | Ga0070714_100031260 | 3300005435 | Bacteria | 4441 |
| 21 | Ga0070714_100083586 | 3300005435 | Bacteria | 2784 |
| 22 | Ga0070714_100162190 | 3300005435 | Unclassified | 2023 |
| 23 | Ga0070714_100201560 | 3300005435 | Bacteria | 1820 |
| 24 | Ga0070710_10004658 | 3300005437 | Bacteria | 6485 |
| 25 | Ga0070710_10022551 | 3300005437 | Unclassified | 3294 |
| 26 | Ga0070710_10102676 | 3300005437 | Unclassified | 1705 |
| 27 | Ga0070701_10013537 | 3300005438 | Bacteria | 3714 |
| 28 | Ga0070711_100006010 | 3300005439 | Bacteria | 7289 |
| 29 | Ga0070711_100011069 | 3300005439 | Bacteria | 5597 |
| 30 | Ga0070705_100129196 | 3300005440 | Bacteria | 1645 |
| 31 | Ga0070700_100127726 | 3300005441 | Bacteria | 1711 |
| 32 | Ga0070708_100109578 | 3300005445 | Bacteria | 2537 |
| 33 | Ga0070678_100000610 | 3300005456 | Bacteria | 17560 |
| 34 | Ga0070662_100165283 | 3300005457 | Bacteria | 1734 |
| 35 | Ga0070681_10014785 | 3300005458 | Bacteria | 7762 |
| 36 | Ga0070681_10056775 | 3300005458 | Bacteria | 3896 |
| 37 | Ga0070681_10093019 | 3300005458 | Bacteria | 2964 |
| 38 | Ga0070681_10097558 | 3300005458 | Bacteria | 2886 |
| 39 | Ga0070681_10271645 | 3300005458 | Bacteria | 1607 |
| 40 | Ga0068867_100149575 | 3300005459 | Bacteria | 1833 |
| 41 | Ga0070685_10003502 | 3300005466 | Bacteria | 7986 |
| 42 | Ga0070706_100023630 | 3300005467 | Bacteria | 5659 |
| 43 | Ga0070706_100066471 | 3300005467 | Unclassified | 3335 |
| 44 | Ga0070706_100134741 | 3300005467 | Bacteria | 2306 |
| 45 | Ga0070707_100000909 | 3300005468 | Bacteria | 29346 |
| 46 | Ga0070707_100021091 | 3300005468 | Bacteria | 6154 |
| 47 | Ga0070707_100061874 | 3300005468 | Bacteria | 3590 |
| 48 | Ga0070707_100247195 | 3300005468 | Bacteria | 1736 |
| 49 | Ga0070698_100040788 | 3300005471 | Bacteria | 4769 |
| 50 | Ga0070698_100048974 | 3300005471 | Bacteria | 4316 |
| 51 | Ga0070684_100003041 | 3300005535 | Bacteria | 12512 |
| 52 | Ga0070686_100001075 | 3300005544 | Bacteria | 15758 |
| 53 | Ga0070693_100024887 | 3300005547 | Unclassified | 3216 |
| 54 | Ga0068855_100190228 | 3300005563 | Unclassified | 2315 |
| 55 | Ga0068857_100000231 | 3300005577 | Bacteria | 37351 |
| 56 | Ga0068864_100337364 | 3300005618 | Unclassified | 1419 |
| 57 | Ga0068866_10101416 | 3300005718 | Unclassified | 1588 |
| 58 | Ga0068860_100297273 | 3300005843 | Bacteria | 1581 |
| 59 | Ga0081455_10018564 | 3300005937 | Bacteria | 6617 |
| 60 | Ga0081455_10041173 | 3300005937 | Bacteria | 4066 |
| 61 | Ga0081538_10000055 | 3300005981 | Bacteria | 106524 |
| 62 | Ga0081538_10000181 | 3300005981 | Bacteria | 68890 |
| 63 | Ga0081538_10000872 | 3300005981 | Bacteria | 32589 |
| 64 | Ga0081538_10008020 | 3300005981 | Bacteria | 9028 |
| 65 | Ga0081538_10009342 | 3300005981 | Bacteria | 8199 |
| 66 | Ga0081538_10010401 | 3300005981 | Bacteria | 7627 |
| 67 | Ga0081539_10009081 | 3300005985 | Bacteria | 8421 |
| 68 | Ga0081539_10011735 | 3300005985 | Bacteria | 6870 |
| 69 | Ga0070717_10140931 | 3300006028 | Bacteria | 2079 |
| 70 | Ga0075365_10006295 | 3300006038 | Bacteria | 6517 |
| 71 | Ga0075432_10007642 | 3300006058 | Bacteria | 3688 |
| 72 | Ga0070716_100021290 | 3300006173 | Bacteria | 3414 |
| 73 | Ga0070716_100025433 | 3300006173 | Unclassified | 3159 |
| 74 | Ga0070712_100008079 | 3300006175 | Bacteria | 6604 |
| 75 | Ga0075367_10006846 | 3300006178 | Bacteria | 5797 |
| 76 | Ga0068871_100047960 | 3300006358 | Bacteria | 3446 |
| 77 | Ga0075428_100038921 | 3300006844 | Bacteria | 5232 |
| 78 | Ga0075431_100064278 | 3300006847 | Bacteria | 3789 |
| 79 | Ga0075433_10076977 | 3300006852 | Unclassified | 2938 |
| 80 | Ga0075433_10080223 | 3300006852 | Bacteria | 2876 |
| 81 | Ga0075433_10158230 | 3300006852 | Unclassified | 2016 |
| 82 | Ga0075434_100013050 | 3300006871 | Bacteria | 7889 |
| 83 | Ga0075434_100185299 | 3300006871 | Unclassified | 2102 |
| 84 | Ga0068865_100002992 | 3300006881 | Bacteria | 10087 |
| 85 | Ga0068865_100025608 | 3300006881 | Bacteria | 3882 |
| 86 | Ga0068865_100144978 | 3300006881 | Bacteria | 1795 |
| 87 | Ga0075436_100007008 | 3300006914 | Bacteria | 7719 |
| 88 | Ga0075436_100131273 | 3300006914 | Bacteria | 1757 |
| 89 | Ga0075435_100005525 | 3300007076 | Bacteria | 8839 |
| 90 | Ga0075435_100011437 | 3300007076 | Bacteria | 6530 |
| 91 | Ga0075435_100029327 | 3300007076 | Bacteria | 4317 |
| 92 | Ga0105240_10575253 | 3300009093 | Bacteria | 1243 |
| 93 | Ga0111539_10001013 | 3300009094 | Bacteria | 36808 |
| 94 | Ga0111539_10017759 | 3300009094 | Bacteria | 8807 |
| 95 | Ga0111539_10040161 | 3300009094 | Bacteria | 5634 |
| 96 | Ga0111539_10082834 | 3300009094 | Bacteria | 3773 |
| 97 | Ga0111539_10424541 | 3300009094 | Bacteria | 1548 |
| 98 | Ga0105245_10032880 | 3300009098 | Bacteria | 4594 |
| 99 | Ga0105245_10131761 | 3300009098 | Unclassified | 2346 |
| 100 | Ga0105245_10298648 | 3300009098 | Unclassified | 1580 |
| 101 | Ga0114129_10035516 | 3300009147 | Bacteria | 7041 |
| 102 | Ga0114129_10057122 | 3300009147 | Bacteria | 5464 |
| 103 | Ga0105243_10132670 | 3300009148 | Bacteria | 2115 |
| 104 | Ga0105243_10336103 | 3300009148 | Bacteria | 1382 |
| 105 | Ga0105241_10026624 | 3300009174 | Bacteria | 4304 |
| 106 | Ga0105242_10007056 | 3300009176 | Bacteria | 8677 |
| 107 | Ga0105248_10019066 | 3300009177 | Bacteria | 7585 |
| 108 | Ga0105237_10077396 | 3300009545 | Unclassified | 3316 |
| 109 | Ga0105249_10174862 | 3300009553 | Bacteria | 2085 |
| 110 | Ga0105239_10088185 | 3300010375 | Unclassified | 3421 |
| 111 | Ga0105239_10098494 | 3300010375 | Unclassified | 3232 |
| 112 | Ga0105239_10259299 | 3300010375 | Bacteria | 1953 |
| 113 | Ga0157370_10075852 | 3300013104 | Bacteria | 3169 |
| 114 | Ga0157370_10076775 | 3300013104 | Bacteria | 3147 |
| 115 | Ga0157369_10084687 | 3300013105 | Bacteria | 3388 |
| 116 | Ga0157369_10116774 | 3300013105 | Bacteria | 2833 |
| 117 | Ga0157369_10353044 | 3300013105 | Unclassified | 1527 |
| 118 | Ga0157378_10178628 | 3300013297 | Unclassified | 1995 |
| 119 | Ga0157378_10206406 | 3300013297 | Bacteria | 1861 |
| 120 | Ga0163162_10003800 | 3300013306 | Bacteria | 14483 |
| 121 | Ga0157375_10019240 | 3300013308 | Bacteria | 6208 |
| 122 | Ga0157380_10031370 | 3300014326 | Bacteria | 4079 |
| 123 | Ga0182008_10051517 | 3300014497 | Bacteria | 2042 |
| 124 | Ga0157377_10058567 | 3300014745 | Unclassified | 2194 |
| 125 | Ga0157377_10068877 | 3300014745 | Unclassified | 2040 |
| 126 | Ga0182006_1041689 | 3300015261 | Bacteria | 1801 |
| 127 | Ga0182007_10011690 | 3300015262 | Bacteria | 3410 |
| 128 | Ga0163161_10143296 | 3300017792 | Unclassified | 1811 |
| 129 | Ga0206354_11363323 | 3300020081 | Bacteria | 1944 |
| 130 | Ga0206353_10834556 | 3300020082 | Bacteria | 3725 |
| 131 | Ga0206353_11109028 | 3300020082 | Bacteria | 4218 |
| 132 | Ga0206353_11156630 | 3300020082 | Bacteria | 1755 |
| 133 | Ga0207653_10000538 | 3300025885 | Bacteria | 14123 |
| 134 | Ga0207692_10141593 | 3300025898 | Bacteria | 1368 |
| 135 | Ga0207692_10158823 | 3300025898 | Bacteria | 1301 |
| 136 | Ga0207705_10076550 | 3300025909 | Bacteria | 2432 |
| 137 | Ga0207705_10130500 | 3300025909 | Bacteria | 1870 |
| 138 | Ga0207705_10222652 | 3300025909 | Unclassified | 1434 |
| 139 | Ga0207684_10042505 | 3300025910 | Bacteria | 3853 |
| 140 | Ga0207684_10086381 | 3300025910 | Bacteria | 2672 |
| 141 | Ga0207684_10122505 | 3300025910 | Bacteria | 2230 |
| 142 | Ga0207654_10115657 | 3300025911 | Bacteria | 1676 |
| 143 | Ga0207707_10048000 | 3300025912 | Bacteria | 3719 |
| 144 | Ga0207707_10162294 | 3300025912 | Bacteria | 1954 |
| 145 | Ga0207695_10128568 | 3300025913 | Bacteria | 2493 |
| 146 | Ga0207693_10001397 | 3300025915 | Bacteria | 21388 |
| 147 | Ga0207693_10002189 | 3300025915 | Bacteria | 17038 |
| 148 | Ga0207693_10012137 | 3300025915 | Bacteria | 6961 |
| 149 | Ga0207693_10067196 | 3300025915 | Unclassified | 2807 |
| 150 | Ga0207663_10005437 | 3300025916 | Bacteria | 6418 |
| 151 | Ga0207660_10017078 | 3300025917 | Bacteria | 4815 |
| 152 | Ga0207660_10204699 | 3300025917 | Bacteria | 1543 |
| 153 | Ga0207657_10014881 | 3300025919 | Bacteria | 7569 |
| 154 | Ga0207657_10029232 | 3300025919 | Bacteria | 5019 |
| 155 | Ga0207657_10033185 | 3300025919 | Bacteria | 4655 |
| 156 | Ga0207652_10018363 | 3300025921 | Bacteria | 5735 |
| 157 | Ga0207646_10005164 | 3300025922 | Bacteria | 13824 |
| 158 | Ga0207646_10018786 | 3300025922 | Bacteria | 6440 |
| 159 | Ga0207646_10201646 | 3300025922 | Unclassified | 1797 |
| 160 | Ga0207646_10223216 | 3300025922 | Bacteria | 1702 |
| 161 | Ga0207646_10402114 | 3300025922 | Unclassified | 1237 |
| 162 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 163 | Ga0207664_10104803 | 3300025929 | Bacteria | 2342 |
| 164 | Ga0207664_10177422 | 3300025929 | Bacteria | 1827 |
| 165 | Ga0207664_10318314 | 3300025929 | Bacteria | 1372 |
| 166 | Ga0207706_10076507 | 3300025933 | Bacteria | 2943 |
| 167 | Ga0207709_10002296 | 3300025935 | Bacteria | 12127 |
| 168 | Ga0207669_10001101 | 3300025937 | Bacteria | 11546 |
| 169 | Ga0207704_10070630 | 3300025938 | Bacteria | 2212 |
| 170 | Ga0207665_10017671 | 3300025939 | Bacteria | 4687 |
| 171 | Ga0207665_10042628 | 3300025939 | Unclassified | 3034 |
| 172 | Ga0207711_10037642 | 3300025941 | Bacteria | 4111 |
| 173 | Ga0207689_10076567 | 3300025942 | Bacteria | 2750 |
| 174 | Ga0207661_10001980 | 3300025944 | Bacteria | 14091 |
| 175 | Ga0207661_10074547 | 3300025944 | Unclassified | 2781 |
| 176 | Ga0207661_10136065 | 3300025944 | Unclassified | 2110 |
| 177 | Ga0207667_10062529 | 3300025949 | Bacteria | 3892 |
| 178 | Ga0207667_10131563 | 3300025949 | Unclassified | 2577 |
| 179 | Ga0207651_10042114 | 3300025960 | Bacteria | 3037 |
| 180 | Ga0207668_10090913 | 3300025972 | Bacteria | 2242 |
| 181 | Ga0207640_10045927 | 3300025981 | Bacteria | 2807 |
| 182 | Ga0207640_10096421 | 3300025981 | Bacteria | 2062 |
| 183 | Ga0207658_10019445 | 3300025986 | Bacteria | 4697 |
| 184 | Ga0207703_10264424 | 3300026035 | Bacteria | 1556 |
| 185 | Ga0207678_10011108 | 3300026067 | Bacteria | 7911 |
| 186 | Ga0207708_10000318 | 3300026075 | Bacteria | 38045 |
| 187 | Ga0207708_10029838 | 3300026075 | Bacteria | 4135 |
| 188 | Ga0207648_10058319 | 3300026089 | Bacteria | 3367 |
| 189 | Ga0207648_10059968 | 3300026089 | Bacteria | 3318 |
| 190 | Ga0207676_10156544 | 3300026095 | Bacteria | 1969 |
| 191 | Ga0207674_10000602 | 3300026116 | Bacteria | 47280 |
| 192 | Ga0207674_10001034 | 3300026116 | Bacteria | 36274 |
| 193 | Ga0207675_100158994 | 3300026118 | Bacteria | 2154 |
| 194 | Ga0207675_100175106 | 3300026118 | Unclassified | 2052 |
| 195 | Ga0207683_10001788 | 3300026121 | Bacteria | 19030 |
| 196 | Ga0207683_10002095 | 3300026121 | Bacteria | 17570 |
| 197 | Ga0207428_10012917 | 3300027907 | Bacteria | 7322 |
| 198 | Ga0207428_10084990 | 3300027907 | Unclassified | 2465 |
| 199 | Ga0268266_10087460 | 3300028379 | Unclassified | 2726 |
| 200 | Ga0265319_1001078 | 3300028563 | Bacteria | 16951 |
| 201 | Ga0265334_10018145 | 3300028573 | Bacteria | 2901 |
| 202 | Ga0265318_10014025 | 3300028577 | Bacteria | 3368 |
| 203 | Ga0265323_10043426 | 3300028653 | Unclassified | 1623 |
| 204 | Ga0265338_10044423 | 3300028800 | Bacteria | 4103 |
| 205 | Ga0265338_10166260 | 3300028800 | Bacteria | 1697 |
| 206 | Ga0265325_10011530 | 3300031241 | Bacteria | 5076 |
| 207 | Ga0265339_10051826 | 3300031249 | Bacteria | 2238 |
| 208 | Ga0265316_10007718 | 3300031344 | Bacteria | 10084 |
| 209 | Ga0307408_100075736 | 3300031548 | Bacteria | 2501 |
| 210 | Ga0265314_10061158 | 3300031711 | Bacteria | 2566 |
| 211 | Ga0307405_10016729 | 3300031731 | Bacteria | 4007 |
| 212 | Ga0307410_10082830 | 3300031852 | Unclassified | 2257 |
| 213 | Ga0307406_10052447 | 3300031901 | Bacteria | 2594 |
| 214 | Ga0307407_10031183 | 3300031903 | Bacteria | 2884 |
| 215 | Ga0307412_10069142 | 3300031911 | Bacteria | 2403 |
| 216 | Ga0307416_100005331 | 3300032002 | Bacteria | 7883 |
| 217 | Ga0307416_100080229 | 3300032002 | Bacteria | 2753 |
| 218 | Ga0307414_10028627 | 3300032004 | Bacteria | 3616 |
| 219 | Ga0307415_100019373 | 3300032126 | Bacteria | 4130 |
| 220 | Ga0373950_0006939 | 3300034818 | Bacteria | 1744 |
| 221 | Ga0373940_0029624 | 3300035088 | Bacteria | 1451 |
| 222 | Ga0373949_0002319 | 3300035090 | Bacteria | 4943 |
| 223 | Ga0373932_0010090 | 3300035112 | Bacteria | 2280 |
| 224 | Ga0373939_0002365 | 3300035114 | Bacteria | 4458 |
| 225 | Ga0373943_0077163 | 3300035170 | Unclassified | 1701 |
| 226 | Ga0373947_0005766 | 3300035725 | Bacteria | 7224 |
| 227 | Ga0395899_0004381 | 3300037312 | Bacteria | 11006 |
| 228 | Ga0395899_0030795 | 3300037312 | Bacteria | 4034 |
| 229 | Ga0395899_0059061 | 3300037312 | Bacteria | 2827 |
| 230 | Ga0395899_0070298 | 3300037312 | Unclassified | 2562 |
| 231 | Ga0395899_0174027 | 3300037312 | Unclassified | 1514 |
| 232 | Ga0395900_0002094 | 3300037418 | Bacteria | 22368 |
| 233 | Ga0395900_0009598 | 3300037418 | Bacteria | 9921 |
| 234 | Ga0395900_0009995 | 3300037418 | Bacteria | 9711 |
| 235 | Ga0395900_0010324 | 3300037418 | Bacteria | 9554 |
| 236 | Ga0395900_0019705 | 3300037418 | Bacteria | 6877 |
| 237 | Ga0395900_0022951 | 3300037418 | Bacteria | 6385 |
| 238 | Ga0395900_0023499 | 3300037418 | Bacteria | 6308 |
| 239 | Ga0395900_0023983 | 3300037418 | Bacteria | 6243 |
| 240 | Ga0395900_0026396 | 3300037418 | Bacteria | 5947 |
| 241 | Ga0395900_0030634 | 3300037418 | Bacteria | 5525 |
| 242 | Ga0395900_0036482 | 3300037418 | Bacteria | 5069 |
| 243 | Ga0395900_0120185 | 3300037418 | Bacteria | 2696 |
| 244 | Ga0395900_0143904 | 3300037418 | Unclassified | 2439 |
| 245 | Ga0395900_0289670 | 3300037418 | Bacteria | 1626 |
| 246 | Ga0395900_0327171 | 3300037418 | Bacteria | 1511 |
| 247 | Ga0395900_0361240 | 3300037418 | Bacteria | 1423 |
| 248 | Ga0395900_0393440 | 3300037418 | Bacteria | 1351 |
| 249 | Ga0395898_0006254 | 3300037466 | Bacteria | 12740 |
| 250 | Ga0395898_0007652 | 3300037466 | Bacteria | 11472 |
| 251 | Ga0395898_0007665 | 3300037466 | Bacteria | 11462 |
| 252 | Ga0395898_0008336 | 3300037466 | Bacteria | 10957 |
| 253 | Ga0395898_0017671 | 3300037466 | Bacteria | 7279 |
| 254 | Ga0395898_0035492 | 3300037466 | Bacteria | 4956 |
| 255 | Ga0395898_0052659 | 3300037466 | Bacteria | 3976 |
| 256 | Ga0395905_0002243 | 3300037471 | Bacteria | 21739 |
| 257 | Ga0395905_0004096 | 3300037471 | Bacteria | 15274 |
| 258 | Ga0395905_0006717 | 3300037471 | Bacteria | 11518 |
| 259 | Ga0395905_0007605 | 3300037471 | Bacteria | 10757 |
| 260 | Ga0395905_0034427 | 3300037471 | Bacteria | 4756 |
| 261 | Ga0395905_0052264 | 3300037471 | Bacteria | 3825 |
| 262 | Ga0395905_0070289 | 3300037471 | Bacteria | 3280 |
| 263 | Ga0395905_0340004 | 3300037471 | Bacteria | 1392 |
| 264 | Ga0395901_0000679 | 3300038443 | Bacteria | 39130 |
| 265 | Ga0395901_0004266 | 3300038443 | Bacteria | 14419 |
| 266 | Ga0395901_0004685 | 3300038443 | Bacteria | 13791 |
| 267 | Ga0395901_0014531 | 3300038443 | Bacteria | 8005 |
| 268 | Ga0395901_0025690 | 3300038443 | Bacteria | 6047 |
| 269 | Ga0395901_0025864 | 3300038443 | Bacteria | 6027 |
| 270 | Ga0395901_0026811 | 3300038443 | Bacteria | 5917 |
| 271 | Ga0395901_0031766 | 3300038443 | Bacteria | 5444 |
| 272 | Ga0395901_0050388 | 3300038443 | Bacteria | 4326 |
| 273 | Ga0395901_0056061 | 3300038443 | Bacteria | 4099 |
| 274 | Ga0395901_0059978 | 3300038443 | Bacteria | 3958 |
| 275 | Ga0395901_0078231 | 3300038443 | Bacteria | 3453 |
| 276 | Ga0395901_0086399 | 3300038443 | Unclassified | 3279 |
| 277 | Ga0395901_0093902 | 3300038443 | Unclassified | 3142 |
| 278 | Ga0395901_0099589 | 3300038443 | Bacteria | 3048 |
| 279 | Ga0395901_0162729 | 3300038443 | Unclassified | 2343 |
| 280 | Ga0395901_0204413 | 3300038443 | Bacteria | 2069 |
| 281 | Ga0395901_0227206 | 3300038443 | Bacteria | 1949 |
| 282 | Ga0395901_0267817 | 3300038443 | Bacteria | 1777 |
| 283 | Ga0395901_0455944 | 3300038443 | Bacteria | 1307 |
| 284 | Ga0436360_1216471 | 3300039438 | Bacteria | 7799 |
| 285 | Ga0439465_0023195 | 3300041413 | Bacteria | 1953 |
| 286 | Ga0451791_0728893 | 3300041451 | Bacteria | 1766 |
| 287 | Ga0451793_0183820 | 3300041452 | Bacteria | 2295 |
| 288 | Ga0451800_0225652 | 3300041459 | Unclassified | 1444 |
| 289 | Ga0451804_1051464 | 3300041463 | Bacteria | 2590 |
| 290 | Ga0451835_0833935 | 3300041492 | Bacteria | 2198 |
| 291 | Ga0451839_0511163 | 3300041496 | Bacteria | 2099 |
| 292 | Ga0451855_0329514 | 3300041511 | Bacteria | 2942 |
| 293 | Ga0451853_0738620 | 3300041512 | Bacteria | 3884 |
| 294 | Ga0451853_0991702 | 3300041512 | Unclassified | 1919 |
| 295 | Ga0439448_0046533 | 3300042005 | Bacteria | 1414 |
| 296 | Ga0439451_012009 | 3300042009 | Bacteria | 1747 |
| 297 | Ga0466963_0005407 | 3300044694 | Bacteria | 7479 |
| 298 | Ga0466963_0007388 | 3300044694 | Bacteria | 6546 |
| 299 | Ga0466963_0091927 | 3300044694 | Bacteria | 2067 |
| 300 | Ga0466964_0004105 | 3300044706 | Bacteria | 5361 |
| 301 | Ga0466964_0011971 | 3300044706 | Bacteria | 3280 |
| 302 | Ga0466964_0091193 | 3300044706 | Bacteria | 1326 |
| 303 | Ga0466957_0080740 | 3300044842 | Unclassified | 2025 |
| 304 | Ga0466960_0048986 | 3300044901 | Bacteria | 2032 |
| 305 | Ga0466958_0020019 | 3300045836 | Bacteria | 3899 |
| 306 | Ga0466958_0077415 | 3300045836 | Bacteria | 2042 |
| 307 | Ga0466967_0000140 | 3300045976 | Bacteria | 27968 |
| 308 | Ga0466967_0024531 | 3300045976 | Bacteria | 4960 |
| 309 | Ga0466967_0042391 | 3300045976 | Bacteria | 3932 |
| 310 | Ga0466967_0246691 | 3300045976 | Bacteria | 1704 |
| 311 | Ga0495603_0003282 | 3300046455 | Bacteria | 9635 |
| 312 | Ga0495629_0050057 | 3300046459 | Unclassified | 2927 |
| 313 | Ga0495629_0054348 | 3300046459 | Bacteria | 2801 |
| 314 | Ga0495653_0031044 | 3300046463 | Bacteria | 4250 |
| 315 | Ga0495582_0081045 | 3300046473 | Unclassified | 1802 |
| 316 | Ga0495639_0030088 | 3300046475 | Unclassified | 2412 |
| 317 | Ga0495662_0069337 | 3300046476 | Unclassified | 1708 |
| 318 | Ga0495584_0071685 | 3300046491 | Bacteria | 1741 |
| 319 | Ga0495596_0006468 | 3300046500 | Bacteria | 5386 |
| 320 | Ga0495596_0059220 | 3300046500 | Bacteria | 1493 |
| 321 | Ga0495618_0038202 | 3300046514 | Unclassified | 3016 |
| 322 | Ga0495663_0008620 | 3300046525 | Bacteria | 2828 |
| 323 | Ga0495652_0123290 | 3300046529 | Bacteria | 2063 |
| 324 | Ga0495652_0159289 | 3300046529 | Bacteria | 1754 |
| 325 | Ga0495640_0075685 | 3300046533 | Bacteria | 2248 |
| 326 | Ga0495586_0009265 | 3300046535 | Bacteria | 5235 |
| 327 | Ga0495586_0062370 | 3300046535 | Unclassified | 2029 |
| 328 | Ga0495587_0111456 | 3300046536 | Unclassified | 1571 |
| 329 | Ga0495609_0029147 | 3300046538 | Bacteria | 2515 |
| 330 | Ga0495609_0049985 | 3300046538 | Bacteria | 1865 |
| 331 | Ga0495645_0110910 | 3300046543 | Bacteria | 1941 |
| 332 | Ga0495668_0008769 | 3300046616 | Bacteria | 6272 |
| 333 | Ga0495634_0094305 | 3300046642 | Bacteria | 1940 |
| 334 | Ga0495659_0007230 | 3300046664 | Unclassified | 3518 |
| 335 | Ga0495658_0034360 | 3300046683 | Bacteria | 2782 |
| 336 | Ga0495613_0019816 | 3300046689 | Bacteria | 5013 |
| 337 | Ga0495624_0051428 | 3300046690 | Bacteria | 2607 |
| 338 | Ga0495589_0120582 | 3300046794 | Bacteria | 1263 |
| 339 | Ga0495674_0083070 | 3300047319 | Bacteria | 2746 |
| 340 | Ga0495676_0035297 | 3300047321 | Bacteria | 4184 |
| 341 | Ga0495676_0048669 | 3300047321 | Bacteria | 3416 |
| 342 | Ga0496100_0068030 | 3300048903 | Unclassified | 2367 |
| 343 | Ga0496101_0005040 | 3300048904 | Bacteria | 8398 |
| 344 | Ga0496101_0013586 | 3300048904 | Bacteria | 5459 |
| 345 | Ga0496101_0156209 | 3300048904 | Bacteria | 1747 |
| 346 | Ga0496102_0041058 | 3300048905 | Bacteria | 4188 |
| 347 | Ga0496102_0067252 | 3300048905 | Bacteria | 3286 |
| 348 | Ga0496102_0089251 | 3300048905 | Bacteria | 2851 |
| 349 | Ga0496103_0001259 | 3300048906 | Bacteria | 17295 |
| 350 | Ga0496103_0062515 | 3300048906 | Bacteria | 2317 |
| 351 | Ga0496103_0089831 | 3300048906 | Bacteria | 1938 |
| 352 | Ga0496104_0000467 | 3300048907 | Bacteria | 34852 |
| 353 | Ga0496104_0009032 | 3300048907 | Bacteria | 8862 |
| 354 | Ga0496104_0048549 | 3300048907 | Unclassified | 4001 |
| 355 | Ga0496104_0115818 | 3300048907 | Unclassified | 2572 |
| 356 | Ga0496105_0000255 | 3300048908 | Bacteria | 35883 |
| 357 | Ga0496105_0007003 | 3300048908 | Bacteria | 8684 |
| 358 | Ga0496105_0050536 | 3300048908 | Bacteria | 3434 |
| 359 | Ga0496105_0085231 | 3300048908 | Bacteria | 2610 |
| 360 | Ga0496105_0108267 | 3300048908 | Bacteria | 2294 |
| 361 | Ga0496105_0120374 | 3300048908 | Unclassified | 2165 |
| 362 | Ga0496105_0126678 | 3300048908 | Bacteria | 2105 |
| 363 | Ga0496106_0002668 | 3300048909 | Bacteria | 13276 |
| 364 | Ga0496106_0119720 | 3300048909 | Bacteria | 2057 |
| 365 | Ga0496106_0134349 | 3300048909 | Bacteria | 1942 |
| 366 | Ga0496106_0284687 | 3300048909 | Bacteria | 1324 |
| 367 | Ga0496107_0004641 | 3300048910 | Bacteria | 9318 |
| 368 | Ga0496107_0033783 | 3300048910 | Bacteria | 3661 |
| 369 | Ga0496107_0065242 | 3300048910 | Bacteria | 2639 |
| 370 | Ga0496107_0085355 | 3300048910 | Bacteria | 2304 |
| 371 | Ga0496107_0121379 | 3300048910 | Bacteria | 1925 |
| 372 | Ga0496108_0001345 | 3300048911 | Bacteria | 19324 |
| 373 | Ga0496108_0023573 | 3300048911 | Bacteria | 5065 |
| 374 | Ga0496109_0002827 | 3300048912 | Bacteria | 14545 |
| 375 | Ga0496109_0003229 | 3300048912 | Bacteria | 13575 |
| 376 | Ga0496109_0008994 | 3300048912 | Bacteria | 8504 |
| 377 | Ga0496109_0011113 | 3300048912 | Bacteria | 7721 |
| 378 | Ga0496109_0014142 | 3300048912 | Bacteria | 6938 |
| 379 | Ga0496109_0065349 | 3300048912 | Bacteria | 3330 |
| 380 | Ga0496109_0186752 | 3300048912 | Bacteria | 1947 |
| 381 | Ga0496110_0000642 | 3300048913 | Bacteria | 23961 |
| 382 | Ga0496110_0000980 | 3300048913 | Bacteria | 20040 |
| 383 | Ga0496110_0001410 | 3300048913 | Bacteria | 17372 |
| 384 | Ga0496110_0020491 | 3300048913 | Bacteria | 5584 |
| 385 | Ga0496110_0027995 | 3300048913 | Bacteria | 4836 |
| 386 | Ga0496110_0212562 | 3300048913 | Bacteria | 1758 |
| 387 | Ga0496110_0270967 | 3300048913 | Unclassified | 1546 |
| 388 | Ga0496111_0000034 | 3300048914 | Bacteria | 54519 |
| 389 | Ga0496111_0000243 | 3300048914 | Bacteria | 26096 |
| 390 | Ga0496111_0035431 | 3300048914 | Bacteria | 3566 |
| 391 | Ga0496111_0053149 | 3300048914 | Bacteria | 2926 |
| 392 | Ga0496111_0057237 | 3300048914 | Bacteria | 2822 |
| 393 | Ga0496111_0242754 | 3300048914 | Unclassified | 1337 |
| 394 | Ga0496112_0013402 | 3300048915 | Bacteria | 7567 |
| 395 | Ga0496112_0022926 | 3300048915 | Bacteria | 5957 |
| 396 | Ga0496112_0038276 | 3300048915 | Bacteria | 4683 |
| 397 | Ga0496112_0076921 | 3300048915 | Bacteria | 3300 |
| 398 | Ga0496112_0080747 | 3300048915 | Bacteria | 3216 |
| 399 | Ga0496112_0090903 | 3300048915 | Bacteria | 3022 |
| 400 | Ga0496112_0402704 | 3300048915 | Bacteria | 1308 |
| 401 | Ga0496112_0422746 | 3300048915 | Unclassified | 1271 |
| 402 | Ga0496113_0004448 | 3300048916 | Bacteria | 8622 |
| 403 | Ga0496113_0022158 | 3300048916 | Bacteria | 4489 |
| 404 | Ga0496113_0059049 | 3300048916 | Bacteria | 2889 |
| 405 | Ga0496113_0271998 | 3300048916 | Bacteria | 1354 |
| 406 | Ga0496113_0273859 | 3300048916 | Bacteria | 1349 |
| 407 | Ga0501031_0000809 | 3300049568 | Bacteria | 18820 |
| 408 | Ga0501031_0078585 | 3300049568 | Bacteria | 2150 |
| 409 | Ga0501032_0001991 | 3300049569 | Bacteria | 16082 |
| 410 | Ga0501032_0021004 | 3300049569 | Bacteria | 4542 |
| 411 | Ga0501033_0026981 | 3300049570 | Bacteria | 4320 |
| 412 | Ga0501033_0074410 | 3300049570 | Bacteria | 2493 |
| 413 | Ga0501034_0111256 | 3300049571 | Bacteria | 2729 |
| 414 | Ga0501034_0142319 | 3300049571 | Bacteria | 2377 |
| 415 | Ga0501036_0001855 | 3300049572 | Bacteria | 16381 |
| 416 | Ga0501036_0010472 | 3300049572 | Bacteria | 7660 |
| 417 | Ga0501037_0001119 | 3300049573 | Bacteria | 19924 |
| 418 | Ga0501037_0055067 | 3300049573 | Bacteria | 2908 |
| 419 | Ga0501037_0088720 | 3300049573 | Bacteria | 2238 |
| 420 | Ga0501038_0001475 | 3300049574 | Bacteria | 21645 |
| 421 | Ga0501038_0047704 | 3300049574 | Bacteria | 3709 |
| 422 | Ga0501038_0138177 | 3300049574 | Unclassified | 1995 |
| 423 | Ga0501039_0002978 | 3300049575 | Bacteria | 12671 |
| 424 | Ga0501039_0003282 | 3300049575 | Bacteria | 12099 |
| 425 | Ga0501039_0004066 | 3300049575 | Bacteria | 10996 |
| 426 | Ga0501040_0000239 | 3300049576 | Bacteria | 32294 |
| 427 | Ga0501040_0007338 | 3300049576 | Bacteria | 7139 |
| 428 | Ga0501040_0010305 | 3300049576 | Bacteria | 6113 |
| 429 | Ga0501040_0062421 | 3300049576 | Viruses | 2563 |
| 430 | Ga0501041_0001644 | 3300049577 | Bacteria | 12491 |
| 431 | Ga0501041_0001805 | 3300049577 | Bacteria | 11993 |
| 432 | Ga0501041_0063065 | 3300049577 | Archaea | 2269 |
| 433 | Ga0501042_0000014 | 3300049578 | Bacteria | 53046 |
| 434 | Ga0501042_0000366 | 3300049578 | Bacteria | 22815 |
| 435 | Ga0501042_0031456 | 3300049578 | Bacteria | 3753 |
| 436 | Ga0501042_0031988 | 3300049578 | Unclassified | 3723 |
| 437 | Ga0501042_0065987 | 3300049578 | Bacteria | 2586 |
| 438 | Ga0501043_0000092 | 3300049579 | Bacteria | 80825 |
| 439 | Ga0501043_0025248 | 3300049579 | Unclassified | 4661 |
| 440 | Ga0501043_0034523 | 3300049579 | Bacteria | 3977 |
| 441 | Ga0501046_0006406 | 3300049580 | Bacteria | 10436 |
| 442 | Ga0501046_0009463 | 3300049580 | Bacteria | 8420 |
| 443 | Ga0501046_0018063 | 3300049580 | Bacteria | 5875 |
| 444 | Ga0501047_0000188 | 3300049581 | Bacteria | 75057 |
| 445 | Ga0501047_0056067 | 3300049581 | Bacteria | 3809 |
| 446 | Ga0501047_0230370 | 3300049581 | Bacteria | 1706 |
| 447 | Ga0501048_0001148 | 3300049582 | Bacteria | 19885 |
| 448 | Ga0501048_0002599 | 3300049582 | Bacteria | 13837 |
| 449 | Ga0501048_0014104 | 3300049582 | Bacteria | 5922 |
| 450 | Ga0501048_0019697 | 3300049582 | Unclassified | 4948 |
| 451 | Ga0501048_0025833 | 3300049582 | Bacteria | 4278 |
| 452 | Ga0501048_0152818 | 3300049582 | Bacteria | 1633 |
| 453 | Ga0501067_0032509 | 3300049583 | Bacteria | 2896 |
| 454 | Ga0501068_0000009 | 3300049584 | Bacteria | 67122 |
| 455 | Ga0501068_0000647 | 3300049584 | Bacteria | 17830 |
| 456 | Ga0501068_0050246 | 3300049584 | Bacteria | 2521 |
| 457 | Ga0501068_0076916 | 3300049584 | Bacteria | 2043 |
| 458 | Ga0501069_0000274 | 3300049585 | Bacteria | 23403 |
| 459 | Ga0501069_0015507 | 3300049585 | Bacteria | 4085 |
| 460 | Ga0501069_0056216 | 3300049585 | Archaea | 2192 |
| 461 | Ga0501070_0006278 | 3300049586 | Bacteria | 10114 |
| 462 | Ga0501070_0010603 | 3300049586 | Bacteria | 7789 |
| 463 | Ga0501070_0029858 | 3300049586 | Bacteria | 4567 |
| 464 | Ga0501070_0055748 | 3300049586 | Unclassified | 3276 |
| 465 | Ga0501070_0096568 | 3300049586 | Bacteria | 2445 |
| 466 | Ga0501071_0002211 | 3300049587 | Bacteria | 11702 |
| 467 | Ga0501071_0003256 | 3300049587 | Bacteria | 10130 |
| 468 | Ga0501071_0003286 | 3300049587 | Bacteria | 10096 |
| 469 | Ga0501071_0026363 | 3300049587 | Bacteria | 4078 |
| 470 | Ga0501071_0056346 | 3300049587 | Bacteria | 2839 |
| 471 | Ga0501071_0093523 | 3300049587 | Bacteria | 2210 |
| 472 | Ga0501072_0000600 | 3300049588 | Bacteria | 25969 |
| 473 | Ga0501072_0003371 | 3300049588 | Bacteria | 12014 |
| 474 | Ga0501072_0007835 | 3300049588 | Bacteria | 8113 |
| 475 | Ga0501072_0011137 | 3300049588 | Bacteria | 6863 |
| 476 | Ga0501072_0072434 | 3300049588 | Bacteria | 2723 |
| 477 | Ga0501072_0089110 | 3300049588 | Bacteria | 2448 |
| 478 | Ga0501073_0008092 | 3300049589 | Bacteria | 7800 |
| 479 | Ga0501073_0064552 | 3300049589 | Bacteria | 2553 |
| 480 | Ga0501074_0000215 | 3300049590 | Bacteria | 31741 |
| 481 | Ga0501074_0004956 | 3300049590 | Bacteria | 9541 |
| 482 | Ga0501075_0000006 | 3300049591 | Bacteria | 111683 |
| 483 | Ga0501075_0008445 | 3300049591 | Bacteria | 7184 |
| 484 | Ga0501075_0011175 | 3300049591 | Bacteria | 6345 |
| 485 | Ga0501075_0019283 | 3300049591 | Bacteria | 4945 |
| 486 | Ga0501075_0060230 | 3300049591 | Bacteria | 2861 |
| 487 | Ga0501075_0060270 | 3300049591 | Bacteria | 2859 |
| 488 | Ga0501075_0130615 | 3300049591 | Bacteria | 1914 |
| 489 | Ga0501076_0001522 | 3300049592 | Bacteria | 15527 |
| 490 | Ga0501076_0002138 | 3300049592 | Bacteria | 13566 |
| 491 | Ga0501076_0014684 | 3300049592 | Bacteria | 5904 |
| 492 | Ga0501076_0042629 | 3300049592 | Bacteria | 3573 |
| 493 | Ga0501076_0209398 | 3300049592 | Bacteria | 1593 |
| 494 | Ga0501077_0004148 | 3300049593 | Bacteria | 8755 |
| 495 | Ga0501077_0011970 | 3300049593 | Bacteria | 5427 |
| 496 | Ga0501077_0043141 | 3300049593 | Bacteria | 2866 |
| 497 | Ga0501079_0000902 | 3300049741 | Bacteria | 20349 |
| 498 | Ga0501079_0001040 | 3300049741 | Bacteria | 19219 |
| 499 | Ga0501079_0015041 | 3300049741 | Bacteria | 5899 |
| 500 | Ga0501079_0051488 | 3300049741 | Unclassified | 3179 |
| 501 | Ga0501079_0134237 | 3300049741 | Bacteria | 1926 |
| 502 | Ga0501079_0349509 | 3300049741 | Bacteria | 1158 |
| 503 | Ga0501080_0000026 | 3300049742 | Bacteria | 89548 |
| 504 | Ga0501080_0001089 | 3300049742 | Bacteria | 22370 |
| 505 | Ga0501080_0004898 | 3300049742 | Bacteria | 11932 |
| 506 | Ga0501081_0000069 | 3300049743 | Bacteria | 39558 |
| 507 | Ga0501081_0003757 | 3300049743 | Bacteria | 9719 |
| 508 | Ga0501081_0011707 | 3300049743 | Bacteria | 5741 |
| 509 | Ga0501081_0031631 | 3300049743 | Unclassified | 3586 |
| 510 | Ga0501081_0035688 | 3300049743 | Bacteria | 3385 |
| 511 | Ga0501081_0067284 | 3300049743 | Bacteria | 2493 |
| 512 | Ga0501083_0001321 | 3300049744 | Bacteria | 16805 |
| 513 | Ga0501083_0021115 | 3300049744 | Bacteria | 4526 |
| 514 | Ga0501035_0000499 | 3300049822 | Bacteria | 44174 |
| 515 | Ga0501035_0099439 | 3300049822 | Bacteria | 2553 |
| 516 | Ga0501044_0004392 | 3300049823 | Bacteria | 15777 |
| 517 | Ga0501044_0055463 | 3300049823 | Bacteria | 4070 |
| 518 | Ga0501044_0139262 | 3300049823 | Bacteria | 2415 |
| 519 | Ga0501045_0000110 | 3300049824 | Bacteria | 41325 |
| 520 | Ga0501045_0000585 | 3300049824 | Bacteria | 22890 |
| 521 | Ga0501045_0013642 | 3300049824 | Bacteria | 5743 |
| 522 | Ga0501045_0034975 | 3300049824 | Bacteria | 3647 |
| 523 | nmdc:mga06z11_97347_c1 | 3300050494 | Bacteria | 1608 |
| 524 | nmdc:mga05p37_1860_c1 | 3300050507 | Bacteria | 24585 |
| 525 | nmdc:mga05p37_57956_c1 | 3300050507 | Bacteria | 4770 |
| 526 | nmdc:mga06r32_39864_c1 | 3300050510 | Bacteria | 4458 |
| 527 | nmdc:mga08y16_120186_c1 | 3300050511 | Bacteria | 2734 |
| 528 | nmdc:mga08y16_134480_c1 | 3300050511 | Bacteria | 2570 |
| 529 | nmdc:mga08y16_2814_c1 | 3300050511 | Bacteria | 17864 |
| 530 | nmdc:mga08y16_31729_c1 | 3300050511 | Bacteria | 5555 |
| 531 | nmdc:mga0n895_17560_c1 | 3300050512 | Bacteria | 6598 |
| 532 | nmdc:mga0n895_179516_c1 | 3300050512 | Unclassified | 2148 |
| 533 | nmdc:mga0n895_21959_c1 | 3300050512 | Bacteria | 5979 |
| 534 | nmdc:mga0n895_75067_c1 | 3300050512 | Bacteria | 3360 |
| 535 | nmdc:mga0rr50_14547_c1 | 3300050513 | Bacteria | 5166 |
| 536 | nmdc:mga0rr50_5540_c1 | 3300050513 | Bacteria | 7547 |
| 537 | nmdc:mga08x19_20950_c1 | 3300050514 | Unclassified | 4032 |
| 538 | nmdc:mga08x19_41424_c1 | 3300050514 | Bacteria | 2933 |
| 539 | nmdc:mga08x19_9545_c1 | 3300050514 | Bacteria | 5809 |
| 540 | nmdc:mga0a205_206003_c1 | 3300050515 | Unclassified | 1856 |
| 541 | Ga0495601_0039079 | 3300053077 | Unclassified | 2970 |
| 542 | Ga0495619_0011726 | 3300053085 | Bacteria | 5523 |
| 543 | Ga0495619_0047560 | 3300053085 | Bacteria | 2825 |
| 544 | Ga0495619_0105576 | 3300053085 | Bacteria | 1920 |
| 545 | Ga0501084_0000105 | 3300054114 | Bacteria | 62464 |
| 546 | Ga0501084_0002637 | 3300054114 | Bacteria | 14452 |
| 547 | Ga0501084_0059032 | 3300054114 | Bacteria | 3210 |
| 548 | Ga0501082_0000453 | 3300060353 | Bacteria | 36303 |
| 549 | Ga0501082_0001714 | 3300060353 | Bacteria | 19338 |
| 550 | Ga0501082_0011424 | 3300060353 | Bacteria | 7639 |
| 551 | Ga0530510_0001130 | 3300061734 | Bacteria | 17735 |
| 552 | Ga0530510_0001571 | 3300061734 | Bacteria | 15385 |
| 553 | Ga0530510_0006616 | 3300061734 | Bacteria | 8081 |
| 554 | Ga0530510_0015884 | 3300061734 | Bacteria | 5323 |
| 555 | Ga0530510_0044221 | 3300061734 | Bacteria | 3218 |
| 556 | Ga0496110_0073033 | |||
| 557 | Ga0070658_10002497 | |||
| 558 | Ga0070658_10011603 | |||
| 559 | Ga0070658_10030991 | |||
| 560 | Ga0070683_100006342 | |||
| 561 | Ga0070683_100008056 | |||
| 562 | Ga0070683_100140085 | |||
| 563 | Ga0070690_100045366 | |||
| 564 | Ga0068869_100124303 | |||
| 565 | Ga0070680_100022365 | |||
| 566 | Ga0070660_100013533 | |||
| 567 | Ga0070660_100058974 | |||
| 568 | Ga0070661_100140376 | |||
| 569 | Ga0070692_10027195 | |||
| 570 | Ga0070674_100119587 | |||
| 571 | Ga0070673_100096373 | |||
| 572 | Ga0070659_100093069 | |||
| 573 | Ga0070703_10000997 | |||
| 574 | Ga0070709_10031557 | |||
| 575 | Ga0070714_100031260 | |||
| 576 | Ga0070714_100083586 | |||
| 577 | Ga0070714_100162190 | |||
| 578 | Ga0070714_100201560 | |||
| 579 | Ga0070710_10004658 | |||
| 580 | Ga0070710_10022551 | |||
| 581 | Ga0070710_10102676 | |||
| 582 | Ga0070701_10013537 | |||
| 583 | Ga0070711_100006010 | |||
| 584 | Ga0070711_100011069 | |||
| 585 | Ga0070705_100129196 | |||
| 586 | Ga0070700_100127726 | |||
| 587 | Ga0070708_100109578 | |||
| 588 | Ga0070678_100000610 | |||
| 589 | Ga0070662_100165283 | |||
| 590 | Ga0070681_10014785 | |||
| 591 | Ga0070681_10056775 | |||
| 592 | Ga0070681_10093019 | |||
| 593 | Ga0070681_10097558 | |||
| 594 | Ga0070681_10271645 | |||
| 595 | Ga0068867_100149575 | |||
| 596 | Ga0070685_10003502 | |||
| 597 | Ga0070706_100023630 | |||
| 598 | Ga0070706_100066471 | |||
| 599 | Ga0070706_100134741 | |||
| 600 | Ga0070707_100000909 | |||
| 601 | Ga0070707_100021091 | |||
| 602 | Ga0070707_100061874 | |||
| 603 | Ga0070707_100247195 | |||
| 604 | Ga0070698_100040788 | |||
| 605 | Ga0070698_100048974 | |||
| 606 | Ga0070684_100003041 | |||
| 607 | Ga0070686_100001075 | |||
| 608 | Ga0070693_100024887 | |||
| 609 | Ga0068855_100190228 | |||
| 610 | Ga0068857_100000231 | |||
| 611 | Ga0068864_100337364 | |||
| 612 | Ga0068866_10101416 | |||
| 613 | Ga0068860_100297273 | |||
| 614 | Ga0081455_10018564 | |||
| 615 | Ga0081455_10041173 | |||
| 616 | Ga0081538_10000055 | |||
| 617 | Ga0081538_10000181 | |||
| 618 | Ga0081538_10000872 | |||
| 619 | Ga0081538_10008020 | |||
| 620 | Ga0081538_10009342 | |||
| 621 | Ga0081538_10010401 | |||
| 622 | Ga0081539_10009081 | |||
| 623 | Ga0081539_10011735 | |||
| 624 | Ga0070717_10140931 | |||
| 625 | Ga0075365_10006295 | |||
| 626 | Ga0075432_10007642 | |||
| 627 | Ga0070716_100021290 | |||
| 628 | Ga0070716_100025433 | |||
| 629 | Ga0070712_100008079 | |||
| 630 | Ga0075367_10006846 | |||
| 631 | Ga0068871_100047960 | |||
| 632 | Ga0075428_100038921 | |||
| 633 | Ga0075431_100064278 | |||
| 634 | Ga0075433_10076977 | |||
| 635 | Ga0075433_10080223 | |||
| 636 | Ga0075433_10158230 | |||
| 637 | Ga0075434_100013050 | |||
| 638 | Ga0075434_100185299 | |||
| 639 | Ga0068865_100002992 | |||
| 640 | Ga0068865_100025608 | |||
| 641 | Ga0068865_100144978 | |||
| 642 | Ga0075436_100007008 | |||
| 643 | Ga0075436_100131273 | |||
| 644 | Ga0075435_100005525 | |||
| 645 | Ga0075435_100011437 | |||
| 646 | Ga0075435_100029327 | |||
| 647 | Ga0105240_10575253 | |||
| 648 | Ga0111539_10001013 | |||
| 649 | Ga0111539_10017759 | |||
| 650 | Ga0111539_10040161 | |||
| 651 | Ga0111539_10082834 | |||
| 652 | Ga0111539_10424541 | |||
| 653 | Ga0105245_10032880 | |||
| 654 | Ga0105245_10131761 | |||
| 655 | Ga0105245_10298648 | |||
| 656 | Ga0114129_10035516 | |||
| 657 | Ga0114129_10057122 | |||
| 658 | Ga0105243_10132670 | |||
| 659 | Ga0105243_10336103 | |||
| 660 | Ga0105241_10026624 | |||
| 661 | Ga0105242_10007056 | |||
| 662 | Ga0105248_10019066 | |||
| 663 | Ga0105237_10077396 | |||
| 664 | Ga0105249_10174862 | |||
| 665 | Ga0105239_10088185 | |||
| 666 | Ga0105239_10098494 | |||
| 667 | Ga0105239_10259299 | |||
| 668 | Ga0157370_10075852 | |||
| 669 | Ga0157370_10076775 | |||
| 670 | Ga0157369_10084687 | |||
| 671 | Ga0157369_10116774 | |||
| 672 | Ga0157369_10353044 | |||
| 673 | Ga0157378_10178628 | |||
| 674 | Ga0157378_10206406 | |||
| 675 | Ga0163162_10003800 | |||
| 676 | Ga0157375_10019240 | |||
| 677 | Ga0157380_10031370 | |||
| 678 | Ga0182008_10051517 | |||
| 679 | Ga0157377_10058567 | |||
| 680 | Ga0157377_10068877 | |||
| 681 | Ga0182006_1041689 | |||
| 682 | Ga0182007_10011690 | |||
| 683 | Ga0163161_10143296 | |||
| 684 | Ga0206354_11363323 | |||
| 685 | Ga0206353_10834556 | |||
| 686 | Ga0206353_11109028 | |||
| 687 | Ga0206353_11156630 | |||
| 688 | Ga0207653_10000538 | |||
| 689 | Ga0207692_10141593 | |||
| 690 | Ga0207692_10158823 | |||
| 691 | Ga0207705_10076550 | |||
| 692 | Ga0207705_10130500 | |||
| 693 | Ga0207705_10222652 | |||
| 694 | Ga0207684_10042505 | |||
| 695 | Ga0207684_10086381 | |||
| 696 | Ga0207684_10122505 | |||
| 697 | Ga0207654_10115657 | |||
| 698 | Ga0207707_10048000 | |||
| 699 | Ga0207707_10162294 | |||
| 700 | Ga0207695_10128568 | |||
| 701 | Ga0207693_10001397 | |||
| 702 | Ga0207693_10002189 | |||
| 703 | Ga0207693_10012137 | |||
| 704 | Ga0207693_10067196 | |||
| 705 | Ga0207663_10005437 | |||
| 706 | Ga0207660_10017078 | |||
| 707 | Ga0207660_10204699 | |||
| 708 | Ga0207657_10014881 | |||
| 709 | Ga0207657_10029232 | |||
| 710 | Ga0207657_10033185 | |||
| 711 | Ga0207652_10018363 | |||
| 712 | Ga0207646_10005164 | |||
| 713 | Ga0207646_10018786 | |||
| 714 | Ga0207646_10201646 | |||
| 715 | Ga0207646_10223216 | |||
| 716 | Ga0207646_10402114 | |||
| 717 | Ga0207700_10000001 | |||
| 718 | Ga0207664_10104803 | |||
| 719 | Ga0207664_10177422 | |||
| 720 | Ga0207664_10318314 | |||
| 721 | Ga0207706_10076507 | |||
| 722 | Ga0207709_10002296 | |||
| 723 | Ga0207669_10001101 | |||
| 724 | Ga0207704_10070630 | |||
| 725 | Ga0207665_10017671 | |||
| 726 | Ga0207665_10042628 | |||
| 727 | Ga0207711_10037642 | |||
| 728 | Ga0207689_10076567 | |||
| 729 | Ga0207661_10001980 | |||
| 730 | Ga0207661_10074547 | |||
| 731 | Ga0207661_10136065 | |||
| 732 | Ga0207667_10062529 | |||
| 733 | Ga0207667_10131563 | |||
| 734 | Ga0207651_10042114 | |||
| 735 | Ga0207668_10090913 | |||
| 736 | Ga0207640_10045927 | |||
| 737 | Ga0207640_10096421 | |||
| 738 | Ga0207658_10019445 | |||
| 739 | Ga0207703_10264424 | |||
| 740 | Ga0207678_10011108 | |||
| 741 | Ga0207708_10000318 | |||
| 742 | Ga0207708_10029838 | |||
| 743 | Ga0207648_10058319 | |||
| 744 | Ga0207648_10059968 | |||
| 745 | Ga0207676_10156544 | |||
| 746 | Ga0207674_10000602 | |||
| 747 | Ga0207674_10001034 | |||
| 748 | Ga0207675_100158994 | |||
| 749 | Ga0207675_100175106 | |||
| 750 | Ga0207683_10001788 | |||
| 751 | Ga0207683_10002095 | |||
| 752 | Ga0207428_10012917 | |||
| 753 | Ga0207428_10084990 | |||
| 754 | Ga0268266_10087460 | |||
| 755 | Ga0265319_1001078 | |||
| 756 | Ga0265334_10018145 | |||
| 757 | Ga0265318_10014025 | |||
| 758 | Ga0265323_10043426 | |||
| 759 | Ga0265338_10044423 | |||
| 760 | Ga0265338_10166260 | |||
| 761 | Ga0265325_10011530 | |||
| 762 | Ga0265339_10051826 | |||
| 763 | Ga0265316_10007718 | |||
| 764 | Ga0307408_100075736 | |||
| 765 | Ga0265314_10061158 | |||
| 766 | Ga0307405_10016729 | |||
| 767 | Ga0307410_10082830 | |||
| 768 | Ga0307406_10052447 | |||
| 769 | Ga0307407_10031183 | |||
| 770 | Ga0307412_10069142 | |||
| 771 | Ga0307416_100005331 | |||
| 772 | Ga0307416_100080229 | |||
| 773 | Ga0307414_10028627 | |||
| 774 | Ga0307415_100019373 | |||
| 775 | Ga0373950_0006939 | |||
| 776 | Ga0373940_0029624 | |||
| 777 | Ga0373949_0002319 | |||
| 778 | Ga0373932_0010090 | |||
| 779 | Ga0373939_0002365 | |||
| 780 | Ga0373943_0077163 | |||
| 781 | Ga0373947_0005766 | |||
| 782 | Ga0395899_0004381 | |||
| 783 | Ga0395899_0030795 | |||
| 784 | Ga0395899_0059061 | |||
| 785 | Ga0395899_0070298 | |||
| 786 | Ga0395899_0174027 | |||
| 787 | Ga0395900_0002094 | |||
| 788 | Ga0395900_0009598 | |||
| 789 | Ga0395900_0009995 | |||
| 790 | Ga0395900_0010324 | |||
| 791 | Ga0395900_0019705 | |||
| 792 | Ga0395900_0022951 | |||
| 793 | Ga0395900_0023499 | |||
| 794 | Ga0395900_0023983 | |||
| 795 | Ga0395900_0026396 | |||
| 796 | Ga0395900_0030634 | |||
| 797 | Ga0395900_0036482 | |||
| 798 | Ga0395900_0120185 | |||
| 799 | Ga0395900_0143904 | |||
| 800 | Ga0395900_0289670 | |||
| 801 | Ga0395900_0327171 | |||
| 802 | Ga0395900_0361240 | |||
| 803 | Ga0395900_0393440 | |||
| 804 | Ga0395898_0006254 | |||
| 805 | Ga0395898_0007652 | |||
| 806 | Ga0395898_0007665 | |||
| 807 | Ga0395898_0008336 | |||
| 808 | Ga0395898_0017671 | |||
| 809 | Ga0395898_0035492 | |||
| 810 | Ga0395898_0052659 | |||
| 811 | Ga0395905_0002243 | |||
| 812 | Ga0395905_0004096 | |||
| 813 | Ga0395905_0006717 | |||
| 814 | Ga0395905_0007605 | |||
| 815 | Ga0395905_0034427 | |||
| 816 | Ga0395905_0052264 | |||
| 817 | Ga0395905_0070289 | |||
| 818 | Ga0395905_0340004 | |||
| 819 | Ga0395901_0000679 | |||
| 820 | Ga0395901_0004266 | |||
| 821 | Ga0395901_0004685 | |||
| 822 | Ga0395901_0014531 | |||
| 823 | Ga0395901_0025690 | |||
| 824 | Ga0395901_0025864 | |||
| 825 | Ga0395901_0026811 | |||
| 826 | Ga0395901_0031766 | |||
| 827 | Ga0395901_0050388 | |||
| 828 | Ga0395901_0056061 | |||
| 829 | Ga0395901_0059978 | |||
| 830 | Ga0395901_0078231 | |||
| 831 | Ga0395901_0086399 | |||
| 832 | Ga0395901_0093902 | |||
| 833 | Ga0395901_0099589 | |||
| 834 | Ga0395901_0162729 | |||
| 835 | Ga0395901_0204413 | |||
| 836 | Ga0395901_0227206 | |||
| 837 | Ga0395901_0267817 | |||
| 838 | Ga0395901_0455944 | |||
| 839 | Ga0436360_1216471 | |||
| 840 | Ga0439465_0023195 | |||
| 841 | Ga0451791_0728893 | |||
| 842 | Ga0451793_0183820 | |||
| 843 | Ga0451800_0225652 | |||
| 844 | Ga0451804_1051464 | |||
| 845 | Ga0451835_0833935 | |||
| 846 | Ga0451839_0511163 | |||
| 847 | Ga0451855_0329514 | |||
| 848 | Ga0451853_0738620 | |||
| 849 | Ga0451853_0991702 | |||
| 850 | Ga0439448_0046533 | |||
| 851 | Ga0439451_012009 | |||
| 852 | Ga0466963_0005407 | |||
| 853 | Ga0466963_0007388 | |||
| 854 | Ga0466963_0091927 | |||
| 855 | Ga0466964_0004105 | |||
| 856 | Ga0466964_0011971 | |||
| 857 | Ga0466964_0091193 | |||
| 858 | Ga0466957_0080740 | |||
| 859 | Ga0466960_0048986 | |||
| 860 | Ga0466958_0020019 | |||
| 861 | Ga0466958_0077415 | |||
| 862 | Ga0466967_0000140 | |||
| 863 | Ga0466967_0024531 | |||
| 864 | Ga0466967_0042391 | |||
| 865 | Ga0466967_0246691 | |||
| 866 | Ga0495603_0003282 | |||
| 867 | Ga0495629_0050057 | |||
| 868 | Ga0495629_0054348 | |||
| 869 | Ga0495653_0031044 | |||
| 870 | Ga0495582_0081045 | |||
| 871 | Ga0495639_0030088 | |||
| 872 | Ga0495662_0069337 | |||
| 873 | Ga0495584_0071685 | |||
| 874 | Ga0495596_0006468 | |||
| 875 | Ga0495596_0059220 | |||
| 876 | Ga0495618_0038202 | |||
| 877 | Ga0495663_0008620 | |||
| 878 | Ga0495652_0123290 | |||
| 879 | Ga0495652_0159289 | |||
| 880 | Ga0495640_0075685 | |||
| 881 | Ga0495586_0009265 | |||
| 882 | Ga0495586_0062370 | |||
| 883 | Ga0495587_0111456 | |||
| 884 | Ga0495609_0029147 | |||
| 885 | Ga0495609_0049985 | |||
| 886 | Ga0495645_0110910 | |||
| 887 | Ga0495668_0008769 | |||
| 888 | Ga0495634_0094305 | |||
| 889 | Ga0495659_0007230 | |||
| 890 | Ga0495658_0034360 | |||
| 891 | Ga0495613_0019816 | |||
| 892 | Ga0495624_0051428 | |||
| 893 | Ga0495589_0120582 | |||
| 894 | Ga0495674_0083070 | |||
| 895 | Ga0495676_0035297 | |||
| 896 | Ga0495676_0048669 | |||
| 897 | Ga0496100_0068030 | |||
| 898 | Ga0496101_0005040 | |||
| 899 | Ga0496101_0013586 | |||
| 900 | Ga0496101_0156209 | |||
| 901 | Ga0496102_0041058 | |||
| 902 | Ga0496102_0067252 | |||
| 903 | Ga0496102_0089251 | |||
| 904 | Ga0496103_0001259 | |||
| 905 | Ga0496103_0062515 | |||
| 906 | Ga0496103_0089831 | |||
| 907 | Ga0496104_0000467 | |||
| 908 | Ga0496104_0009032 | |||
| 909 | Ga0496104_0048549 | |||
| 910 | Ga0496104_0115818 | |||
| 911 | Ga0496105_0000255 | |||
| 912 | Ga0496105_0007003 | |||
| 913 | Ga0496105_0050536 | |||
| 914 | Ga0496105_0085231 | |||
| 915 | Ga0496105_0108267 | |||
| 916 | Ga0496105_0120374 | |||
| 917 | Ga0496105_0126678 | |||
| 918 | Ga0496106_0002668 | |||
| 919 | Ga0496106_0119720 | |||
| 920 | Ga0496106_0134349 | |||
| 921 | Ga0496106_0284687 | |||
| 922 | Ga0496107_0004641 | |||
| 923 | Ga0496107_0033783 | |||
| 924 | Ga0496107_0065242 | |||
| 925 | Ga0496107_0085355 | |||
| 926 | Ga0496107_0121379 | |||
| 927 | Ga0496108_0001345 | |||
| 928 | Ga0496108_0023573 | |||
| 929 | Ga0496109_0002827 | |||
| 930 | Ga0496109_0003229 | |||
| 931 | Ga0496109_0008994 | |||
| 932 | Ga0496109_0011113 | |||
| 933 | Ga0496109_0014142 | |||
| 934 | Ga0496109_0065349 | |||
| 935 | Ga0496109_0186752 | |||
| 936 | Ga0496110_0000642 | |||
| 937 | Ga0496110_0000980 | |||
| 938 | Ga0496110_0001410 | |||
| 939 | Ga0496110_0020491 | |||
| 940 | Ga0496110_0027995 | |||
| 941 | Ga0496110_0212562 | |||
| 942 | Ga0496110_0270967 | |||
| 943 | Ga0496111_0000034 | |||
| 944 | Ga0496111_0000243 | |||
| 945 | Ga0496111_0035431 | |||
| 946 | Ga0496111_0053149 | |||
| 947 | Ga0496111_0057237 | |||
| 948 | Ga0496111_0242754 | |||
| 949 | Ga0496112_0013402 | |||
| 950 | Ga0496112_0022926 | |||
| 951 | Ga0496112_0038276 | |||
| 952 | Ga0496112_0076921 | |||
| 953 | Ga0496112_0080747 | |||
| 954 | Ga0496112_0090903 | |||
| 955 | Ga0496112_0402704 | |||
| 956 | Ga0496112_0422746 | |||
| 957 | Ga0496113_0004448 | |||
| 958 | Ga0496113_0022158 | |||
| 959 | Ga0496113_0059049 | |||
| 960 | Ga0496113_0271998 | |||
| 961 | Ga0496113_0273859 | |||
| 962 | Ga0501031_0000809 | |||
| 963 | Ga0501031_0078585 | |||
| 964 | Ga0501032_0001991 | |||
| 965 | Ga0501032_0021004 | |||
| 966 | Ga0501033_0026981 | |||
| 967 | Ga0501033_0074410 | |||
| 968 | Ga0501034_0111256 | |||
| 969 | Ga0501034_0142319 | |||
| 970 | Ga0501036_0001855 | |||
| 971 | Ga0501036_0010472 | |||
| 972 | Ga0501037_0001119 | |||
| 973 | Ga0501037_0055067 | |||
| 974 | Ga0501037_0088720 | |||
| 975 | Ga0501038_0001475 | |||
| 976 | Ga0501038_0047704 | |||
| 977 | Ga0501038_0138177 | |||
| 978 | Ga0501039_0002978 | |||
| 979 | Ga0501039_0003282 | |||
| 980 | Ga0501039_0004066 | |||
| 981 | Ga0501040_0000239 | |||
| 982 | Ga0501040_0007338 | |||
| 983 | Ga0501040_0010305 | |||
| 984 | Ga0501040_0062421 | |||
| 985 | Ga0501041_0001644 | |||
| 986 | Ga0501041_0001805 | |||
| 987 | Ga0501041_0063065 | |||
| 988 | Ga0501042_0000014 | |||
| 989 | Ga0501042_0000366 | |||
| 990 | Ga0501042_0031456 | |||
| 991 | Ga0501042_0031988 | |||
| 992 | Ga0501042_0065987 | |||
| 993 | Ga0501043_0000092 | |||
| 994 | Ga0501043_0025248 | |||
| 995 | Ga0501043_0034523 | |||
| 996 | Ga0501046_0006406 | |||
| 997 | Ga0501046_0009463 | |||
| 998 | Ga0501046_0018063 | |||
| 999 | Ga0501047_0000188 | |||
| 1000 | Ga0501047_0056067 | |||
| 1001 | Ga0501047_0230370 | |||
| 1002 | Ga0501048_0001148 | |||
| 1003 | Ga0501048_0002599 | |||
| 1004 | Ga0501048_0014104 | |||
| 1005 | Ga0501048_0019697 | |||
| 1006 | Ga0501048_0025833 | |||
| 1007 | Ga0501048_0152818 | |||
| 1008 | Ga0501067_0032509 | |||
| 1009 | Ga0501068_0000009 | |||
| 1010 | Ga0501068_0000647 | |||
| 1011 | Ga0501068_0050246 | |||
| 1012 | Ga0501068_0076916 | |||
| 1013 | Ga0501069_0000274 | |||
| 1014 | Ga0501069_0015507 | |||
| 1015 | Ga0501069_0056216 | |||
| 1016 | Ga0501070_0006278 | |||
| 1017 | Ga0501070_0010603 | |||
| 1018 | Ga0501070_0029858 | |||
| 1019 | Ga0501070_0055748 | |||
| 1020 | Ga0501070_0096568 | |||
| 1021 | Ga0501071_0002211 | |||
| 1022 | Ga0501071_0003256 | |||
| 1023 | Ga0501071_0003286 | |||
| 1024 | Ga0501071_0026363 | |||
| 1025 | Ga0501071_0056346 | |||
| 1026 | Ga0501071_0093523 | |||
| 1027 | Ga0501072_0000600 | |||
| 1028 | Ga0501072_0003371 | |||
| 1029 | Ga0501072_0007835 | |||
| 1030 | Ga0501072_0011137 | |||
| 1031 | Ga0501072_0072434 | |||
| 1032 | Ga0501072_0089110 | |||
| 1033 | Ga0501073_0008092 | |||
| 1034 | Ga0501073_0064552 | |||
| 1035 | Ga0501074_0000215 | |||
| 1036 | Ga0501074_0004956 | |||
| 1037 | Ga0501075_0000006 | |||
| 1038 | Ga0501075_0008445 | |||
| 1039 | Ga0501075_0011175 | |||
| 1040 | Ga0501075_0019283 | |||
| 1041 | Ga0501075_0060230 | |||
| 1042 | Ga0501075_0060270 | |||
| 1043 | Ga0501075_0130615 | |||
| 1044 | Ga0501076_0001522 | |||
| 1045 | Ga0501076_0002138 | |||
| 1046 | Ga0501076_0014684 | |||
| 1047 | Ga0501076_0042629 | |||
| 1048 | Ga0501076_0209398 | |||
| 1049 | Ga0501077_0004148 | |||
| 1050 | Ga0501077_0011970 | |||
| 1051 | Ga0501077_0043141 | |||
| 1052 | Ga0501079_0000902 | |||
| 1053 | Ga0501079_0001040 | |||
| 1054 | Ga0501079_0015041 | |||
| 1055 | Ga0501079_0051488 | |||
| 1056 | Ga0501079_0134237 | |||
| 1057 | Ga0501079_0349509 | |||
| 1058 | Ga0501080_0000026 | |||
| 1059 | Ga0501080_0001089 | |||
| 1060 | Ga0501080_0004898 | |||
| 1061 | Ga0501081_0000069 | |||
| 1062 | Ga0501081_0003757 | |||
| 1063 | Ga0501081_0011707 | |||
| 1064 | Ga0501081_0031631 | |||
| 1065 | Ga0501081_0035688 | |||
| 1066 | Ga0501081_0067284 | |||
| 1067 | Ga0501083_0001321 | |||
| 1068 | Ga0501083_0021115 | |||
| 1069 | Ga0501035_0000499 | |||
| 1070 | Ga0501035_0099439 | |||
| 1071 | Ga0501044_0004392 | |||
| 1072 | Ga0501044_0055463 | |||
| 1073 | Ga0501044_0139262 | |||
| 1074 | Ga0501045_0000110 | |||
| 1075 | Ga0501045_0000585 | |||
| 1076 | Ga0501045_0013642 | |||
| 1077 | Ga0501045_0034975 | |||
| 1078 | nmdc:mga06z11_97347_c1 | |||
| 1079 | nmdc:mga05p37_1860_c1 | |||
| 1080 | nmdc:mga05p37_57956_c1 | |||
| 1081 | nmdc:mga06r32_39864_c1 | |||
| 1082 | nmdc:mga08y16_120186_c1 | |||
| 1083 | nmdc:mga08y16_134480_c1 | |||
| 1084 | nmdc:mga08y16_2814_c1 | |||
| 1085 | nmdc:mga08y16_31729_c1 | |||
| 1086 | nmdc:mga0n895_17560_c1 | |||
| 1087 | nmdc:mga0n895_179516_c1 | |||
| 1088 | nmdc:mga0n895_21959_c1 | |||
| 1089 | nmdc:mga0n895_75067_c1 | |||
| 1090 | nmdc:mga0rr50_14547_c1 | |||
| 1091 | nmdc:mga0rr50_5540_c1 | |||
| 1092 | nmdc:mga08x19_20950_c1 | |||
| 1093 | nmdc:mga08x19_41424_c1 | |||
| 1094 | nmdc:mga08x19_9545_c1 | |||
| 1095 | nmdc:mga0a205_206003_c1 | |||
| 1096 | Ga0495601_0039079 | |||
| 1097 | Ga0495619_0011726 | |||
| 1098 | Ga0495619_0047560 | |||
| 1099 | Ga0495619_0105576 | |||
| 1100 | Ga0501084_0000105 | |||
| 1101 | Ga0501084_0002637 | |||
| 1102 | Ga0501084_0059032 | |||
| 1103 | Ga0501082_0000453 | |||
| 1104 | Ga0501082_0001714 | |||
| 1105 | Ga0501082_0011424 | |||
| 1106 | Ga0530510_0001130 | |||
| 1107 | Ga0530510_0001571 | |||
| 1108 | Ga0530510_0006616 | |||
| 1109 | Ga0530510_0015884 | |||
| 1110 | Ga0530510_0044221 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8jyt-assembly1.cif.gz_A | ancestral imine reducatase n560 | 0.9758 | 5 | 34 |
| 7osn-assembly3.cif.gz_F | ired361 from micromonospora sp. in complex with nadp+ | 0.975 | 5 | 34 |
| 5a9s-assembly1.cif.gz_B | nadph complex of imine reductase from amycolatopsis orientalis | 0.9748 | 5 | 34 |
| 5ocm-assembly1.cif.gz_A | imine reductase from streptosporangium roseum in complex with nadp+ and 2,2,2-trifluoroacetophenone hydrate | 0.9731 | 4 | 34 |
| 8ozw-assembly1.cif.gz_A | imine reductase from ajellomyces dermatitidis in complex nadph4 | 0.9713 | 5 | 34 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4j0fB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9883 | 5 | 32 | 3.40.50.720 |
| af_P9WN19_146_269_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9798 | 6 | 35 | 3.50.50.60 |
| 4dnaB02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9773 | 5 | 35 | 3.50.50.60 |
| 5a9sB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9748 | 5 | 34 | 3.40.50.720 |
| 5z2gB02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9713 | 6 | 33 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A355BFS1-F1-model_v4 | L-aspartate oxidase | 0.9114 | 4 | 156 |
GO:0008734
GO:0034628 |
| AF-A0A7V9VK89-F1-model_v4 | FAD-dependent oxidoreductase | 0.91 | 1 | 147 |
GO:0008734
GO:0034628 |
| AF-A0A523WG10-F1-model_v4 | FAD-binding protein | 0.9098 | 5 | 179 |
GO:0016491
|
| AF-A0A3B8V2N6-F1-model_v4 | L-aspartate oxidase | 0.9081 | 4 | 141 |
GO:0008734
GO:0034628 |
| AF-A0A2M7PMY7-F1-model_v4 | L-aspartate oxidase | 0.9036 | 4 | 142 |
GO:0008734
GO:0034628 |