F463149

General Info

Members Datasets Scaffolds Average Seq Length
555 248 1110 396

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0073033|Ga0496110_0073033_998_2212
Length 404
Sequence MLAVADRVSFDVLVVGSGASGLAAALSAERAGARVALVSKGSLQSCNSAKAQGGIQAAFGEDDSPEQHADDVWQSSHETADRSLVEVLTAEAPGAIHWLEEQGVEFTRENGGYRLARCGGATRKRLLQVGDRTGHAITTALRDAYTASGGESFPNAPLVALEQSENGWVATCRRKSGDELVIGAGAVVLAAGGRCYRVAEELGELSTNHPGATGEVTELALDLGAESRDLDALQYHPNGGAWPPTMQGYSIPETTRAYGATLLNADGDEFTDPLGPRDAVSQAIFEEVDAGRGVETPDGRPAVYLDTTRIAEHDAEISLPYMLRRYRSAGIDPLREPILTFPVLHYQNGGLVIDEHGETTLPGLYACGEIAGGTHGRNRMMGNSLLECTVFGRRAGLAAAGRAA

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
153 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 12.61
Rhizosphere 85.95
Stem 0
Stem Tuber 0
Unclassified 13.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0073033 3300048913 Bacteria 3044
2 Ga0070658_10002497 3300005327 Bacteria 15366
3 Ga0070658_10011603 3300005327 Bacteria 7067
4 Ga0070658_10030991 3300005327 Bacteria 4294
5 Ga0070683_100006342 3300005329 Bacteria 9917
6 Ga0070683_100008056 3300005329 Bacteria 8949
7 Ga0070683_100140085 3300005329 Bacteria 2291
8 Ga0070690_100045366 3300005330 Unclassified 2792
9 Ga0068869_100124303 3300005334 Bacteria 1977
10 Ga0070680_100022365 3300005336 Bacteria 5036
11 Ga0070660_100013533 3300005339 Bacteria 5854
12 Ga0070660_100058974 3300005339 Unclassified 2976
13 Ga0070661_100140376 3300005344 Bacteria 1820
14 Ga0070692_10027195 3300005345 Unclassified 2833
15 Ga0070674_100119587 3300005356 Bacteria 1948
16 Ga0070673_100096373 3300005364 Bacteria 2428
17 Ga0070659_100093069 3300005366 Unclassified 2418
18 Ga0070703_10000997 3300005406 Bacteria 8911
19 Ga0070709_10031557 3300005434 Bacteria 3188
20 Ga0070714_100031260 3300005435 Bacteria 4441
21 Ga0070714_100083586 3300005435 Bacteria 2784
22 Ga0070714_100162190 3300005435 Unclassified 2023
23 Ga0070714_100201560 3300005435 Bacteria 1820
24 Ga0070710_10004658 3300005437 Bacteria 6485
25 Ga0070710_10022551 3300005437 Unclassified 3294
26 Ga0070710_10102676 3300005437 Unclassified 1705
27 Ga0070701_10013537 3300005438 Bacteria 3714
28 Ga0070711_100006010 3300005439 Bacteria 7289
29 Ga0070711_100011069 3300005439 Bacteria 5597
30 Ga0070705_100129196 3300005440 Bacteria 1645
31 Ga0070700_100127726 3300005441 Bacteria 1711
32 Ga0070708_100109578 3300005445 Bacteria 2537
33 Ga0070678_100000610 3300005456 Bacteria 17560
34 Ga0070662_100165283 3300005457 Bacteria 1734
35 Ga0070681_10014785 3300005458 Bacteria 7762
36 Ga0070681_10056775 3300005458 Bacteria 3896
37 Ga0070681_10093019 3300005458 Bacteria 2964
38 Ga0070681_10097558 3300005458 Bacteria 2886
39 Ga0070681_10271645 3300005458 Bacteria 1607
40 Ga0068867_100149575 3300005459 Bacteria 1833
41 Ga0070685_10003502 3300005466 Bacteria 7986
42 Ga0070706_100023630 3300005467 Bacteria 5659
43 Ga0070706_100066471 3300005467 Unclassified 3335
44 Ga0070706_100134741 3300005467 Bacteria 2306
45 Ga0070707_100000909 3300005468 Bacteria 29346
46 Ga0070707_100021091 3300005468 Bacteria 6154
47 Ga0070707_100061874 3300005468 Bacteria 3590
48 Ga0070707_100247195 3300005468 Bacteria 1736
49 Ga0070698_100040788 3300005471 Bacteria 4769
50 Ga0070698_100048974 3300005471 Bacteria 4316
51 Ga0070684_100003041 3300005535 Bacteria 12512
52 Ga0070686_100001075 3300005544 Bacteria 15758
53 Ga0070693_100024887 3300005547 Unclassified 3216
54 Ga0068855_100190228 3300005563 Unclassified 2315
55 Ga0068857_100000231 3300005577 Bacteria 37351
56 Ga0068864_100337364 3300005618 Unclassified 1419
57 Ga0068866_10101416 3300005718 Unclassified 1588
58 Ga0068860_100297273 3300005843 Bacteria 1581
59 Ga0081455_10018564 3300005937 Bacteria 6617
60 Ga0081455_10041173 3300005937 Bacteria 4066
61 Ga0081538_10000055 3300005981 Bacteria 106524
62 Ga0081538_10000181 3300005981 Bacteria 68890
63 Ga0081538_10000872 3300005981 Bacteria 32589
64 Ga0081538_10008020 3300005981 Bacteria 9028
65 Ga0081538_10009342 3300005981 Bacteria 8199
66 Ga0081538_10010401 3300005981 Bacteria 7627
67 Ga0081539_10009081 3300005985 Bacteria 8421
68 Ga0081539_10011735 3300005985 Bacteria 6870
69 Ga0070717_10140931 3300006028 Bacteria 2079
70 Ga0075365_10006295 3300006038 Bacteria 6517
71 Ga0075432_10007642 3300006058 Bacteria 3688
72 Ga0070716_100021290 3300006173 Bacteria 3414
73 Ga0070716_100025433 3300006173 Unclassified 3159
74 Ga0070712_100008079 3300006175 Bacteria 6604
75 Ga0075367_10006846 3300006178 Bacteria 5797
76 Ga0068871_100047960 3300006358 Bacteria 3446
77 Ga0075428_100038921 3300006844 Bacteria 5232
78 Ga0075431_100064278 3300006847 Bacteria 3789
79 Ga0075433_10076977 3300006852 Unclassified 2938
80 Ga0075433_10080223 3300006852 Bacteria 2876
81 Ga0075433_10158230 3300006852 Unclassified 2016
82 Ga0075434_100013050 3300006871 Bacteria 7889
83 Ga0075434_100185299 3300006871 Unclassified 2102
84 Ga0068865_100002992 3300006881 Bacteria 10087
85 Ga0068865_100025608 3300006881 Bacteria 3882
86 Ga0068865_100144978 3300006881 Bacteria 1795
87 Ga0075436_100007008 3300006914 Bacteria 7719
88 Ga0075436_100131273 3300006914 Bacteria 1757
89 Ga0075435_100005525 3300007076 Bacteria 8839
90 Ga0075435_100011437 3300007076 Bacteria 6530
91 Ga0075435_100029327 3300007076 Bacteria 4317
92 Ga0105240_10575253 3300009093 Bacteria 1243
93 Ga0111539_10001013 3300009094 Bacteria 36808
94 Ga0111539_10017759 3300009094 Bacteria 8807
95 Ga0111539_10040161 3300009094 Bacteria 5634
96 Ga0111539_10082834 3300009094 Bacteria 3773
97 Ga0111539_10424541 3300009094 Bacteria 1548
98 Ga0105245_10032880 3300009098 Bacteria 4594
99 Ga0105245_10131761 3300009098 Unclassified 2346
100 Ga0105245_10298648 3300009098 Unclassified 1580
101 Ga0114129_10035516 3300009147 Bacteria 7041
102 Ga0114129_10057122 3300009147 Bacteria 5464
103 Ga0105243_10132670 3300009148 Bacteria 2115
104 Ga0105243_10336103 3300009148 Bacteria 1382
105 Ga0105241_10026624 3300009174 Bacteria 4304
106 Ga0105242_10007056 3300009176 Bacteria 8677
107 Ga0105248_10019066 3300009177 Bacteria 7585
108 Ga0105237_10077396 3300009545 Unclassified 3316
109 Ga0105249_10174862 3300009553 Bacteria 2085
110 Ga0105239_10088185 3300010375 Unclassified 3421
111 Ga0105239_10098494 3300010375 Unclassified 3232
112 Ga0105239_10259299 3300010375 Bacteria 1953
113 Ga0157370_10075852 3300013104 Bacteria 3169
114 Ga0157370_10076775 3300013104 Bacteria 3147
115 Ga0157369_10084687 3300013105 Bacteria 3388
116 Ga0157369_10116774 3300013105 Bacteria 2833
117 Ga0157369_10353044 3300013105 Unclassified 1527
118 Ga0157378_10178628 3300013297 Unclassified 1995
119 Ga0157378_10206406 3300013297 Bacteria 1861
120 Ga0163162_10003800 3300013306 Bacteria 14483
121 Ga0157375_10019240 3300013308 Bacteria 6208
122 Ga0157380_10031370 3300014326 Bacteria 4079
123 Ga0182008_10051517 3300014497 Bacteria 2042
124 Ga0157377_10058567 3300014745 Unclassified 2194
125 Ga0157377_10068877 3300014745 Unclassified 2040
126 Ga0182006_1041689 3300015261 Bacteria 1801
127 Ga0182007_10011690 3300015262 Bacteria 3410
128 Ga0163161_10143296 3300017792 Unclassified 1811
129 Ga0206354_11363323 3300020081 Bacteria 1944
130 Ga0206353_10834556 3300020082 Bacteria 3725
131 Ga0206353_11109028 3300020082 Bacteria 4218
132 Ga0206353_11156630 3300020082 Bacteria 1755
133 Ga0207653_10000538 3300025885 Bacteria 14123
134 Ga0207692_10141593 3300025898 Bacteria 1368
135 Ga0207692_10158823 3300025898 Bacteria 1301
136 Ga0207705_10076550 3300025909 Bacteria 2432
137 Ga0207705_10130500 3300025909 Bacteria 1870
138 Ga0207705_10222652 3300025909 Unclassified 1434
139 Ga0207684_10042505 3300025910 Bacteria 3853
140 Ga0207684_10086381 3300025910 Bacteria 2672
141 Ga0207684_10122505 3300025910 Bacteria 2230
142 Ga0207654_10115657 3300025911 Bacteria 1676
143 Ga0207707_10048000 3300025912 Bacteria 3719
144 Ga0207707_10162294 3300025912 Bacteria 1954
145 Ga0207695_10128568 3300025913 Bacteria 2493
146 Ga0207693_10001397 3300025915 Bacteria 21388
147 Ga0207693_10002189 3300025915 Bacteria 17038
148 Ga0207693_10012137 3300025915 Bacteria 6961
149 Ga0207693_10067196 3300025915 Unclassified 2807
150 Ga0207663_10005437 3300025916 Bacteria 6418
151 Ga0207660_10017078 3300025917 Bacteria 4815
152 Ga0207660_10204699 3300025917 Bacteria 1543
153 Ga0207657_10014881 3300025919 Bacteria 7569
154 Ga0207657_10029232 3300025919 Bacteria 5019
155 Ga0207657_10033185 3300025919 Bacteria 4655
156 Ga0207652_10018363 3300025921 Bacteria 5735
157 Ga0207646_10005164 3300025922 Bacteria 13824
158 Ga0207646_10018786 3300025922 Bacteria 6440
159 Ga0207646_10201646 3300025922 Unclassified 1797
160 Ga0207646_10223216 3300025922 Bacteria 1702
161 Ga0207646_10402114 3300025922 Unclassified 1237
162 Ga0207700_10000001 3300025928 Bacteria 1122509
163 Ga0207664_10104803 3300025929 Bacteria 2342
164 Ga0207664_10177422 3300025929 Bacteria 1827
165 Ga0207664_10318314 3300025929 Bacteria 1372
166 Ga0207706_10076507 3300025933 Bacteria 2943
167 Ga0207709_10002296 3300025935 Bacteria 12127
168 Ga0207669_10001101 3300025937 Bacteria 11546
169 Ga0207704_10070630 3300025938 Bacteria 2212
170 Ga0207665_10017671 3300025939 Bacteria 4687
171 Ga0207665_10042628 3300025939 Unclassified 3034
172 Ga0207711_10037642 3300025941 Bacteria 4111
173 Ga0207689_10076567 3300025942 Bacteria 2750
174 Ga0207661_10001980 3300025944 Bacteria 14091
175 Ga0207661_10074547 3300025944 Unclassified 2781
176 Ga0207661_10136065 3300025944 Unclassified 2110
177 Ga0207667_10062529 3300025949 Bacteria 3892
178 Ga0207667_10131563 3300025949 Unclassified 2577
179 Ga0207651_10042114 3300025960 Bacteria 3037
180 Ga0207668_10090913 3300025972 Bacteria 2242
181 Ga0207640_10045927 3300025981 Bacteria 2807
182 Ga0207640_10096421 3300025981 Bacteria 2062
183 Ga0207658_10019445 3300025986 Bacteria 4697
184 Ga0207703_10264424 3300026035 Bacteria 1556
185 Ga0207678_10011108 3300026067 Bacteria 7911
186 Ga0207708_10000318 3300026075 Bacteria 38045
187 Ga0207708_10029838 3300026075 Bacteria 4135
188 Ga0207648_10058319 3300026089 Bacteria 3367
189 Ga0207648_10059968 3300026089 Bacteria 3318
190 Ga0207676_10156544 3300026095 Bacteria 1969
191 Ga0207674_10000602 3300026116 Bacteria 47280
192 Ga0207674_10001034 3300026116 Bacteria 36274
193 Ga0207675_100158994 3300026118 Bacteria 2154
194 Ga0207675_100175106 3300026118 Unclassified 2052
195 Ga0207683_10001788 3300026121 Bacteria 19030
196 Ga0207683_10002095 3300026121 Bacteria 17570
197 Ga0207428_10012917 3300027907 Bacteria 7322
198 Ga0207428_10084990 3300027907 Unclassified 2465
199 Ga0268266_10087460 3300028379 Unclassified 2726
200 Ga0265319_1001078 3300028563 Bacteria 16951
201 Ga0265334_10018145 3300028573 Bacteria 2901
202 Ga0265318_10014025 3300028577 Bacteria 3368
203 Ga0265323_10043426 3300028653 Unclassified 1623
204 Ga0265338_10044423 3300028800 Bacteria 4103
205 Ga0265338_10166260 3300028800 Bacteria 1697
206 Ga0265325_10011530 3300031241 Bacteria 5076
207 Ga0265339_10051826 3300031249 Bacteria 2238
208 Ga0265316_10007718 3300031344 Bacteria 10084
209 Ga0307408_100075736 3300031548 Bacteria 2501
210 Ga0265314_10061158 3300031711 Bacteria 2566
211 Ga0307405_10016729 3300031731 Bacteria 4007
212 Ga0307410_10082830 3300031852 Unclassified 2257
213 Ga0307406_10052447 3300031901 Bacteria 2594
214 Ga0307407_10031183 3300031903 Bacteria 2884
215 Ga0307412_10069142 3300031911 Bacteria 2403
216 Ga0307416_100005331 3300032002 Bacteria 7883
217 Ga0307416_100080229 3300032002 Bacteria 2753
218 Ga0307414_10028627 3300032004 Bacteria 3616
219 Ga0307415_100019373 3300032126 Bacteria 4130
220 Ga0373950_0006939 3300034818 Bacteria 1744
221 Ga0373940_0029624 3300035088 Bacteria 1451
222 Ga0373949_0002319 3300035090 Bacteria 4943
223 Ga0373932_0010090 3300035112 Bacteria 2280
224 Ga0373939_0002365 3300035114 Bacteria 4458
225 Ga0373943_0077163 3300035170 Unclassified 1701
226 Ga0373947_0005766 3300035725 Bacteria 7224
227 Ga0395899_0004381 3300037312 Bacteria 11006
228 Ga0395899_0030795 3300037312 Bacteria 4034
229 Ga0395899_0059061 3300037312 Bacteria 2827
230 Ga0395899_0070298 3300037312 Unclassified 2562
231 Ga0395899_0174027 3300037312 Unclassified 1514
232 Ga0395900_0002094 3300037418 Bacteria 22368
233 Ga0395900_0009598 3300037418 Bacteria 9921
234 Ga0395900_0009995 3300037418 Bacteria 9711
235 Ga0395900_0010324 3300037418 Bacteria 9554
236 Ga0395900_0019705 3300037418 Bacteria 6877
237 Ga0395900_0022951 3300037418 Bacteria 6385
238 Ga0395900_0023499 3300037418 Bacteria 6308
239 Ga0395900_0023983 3300037418 Bacteria 6243
240 Ga0395900_0026396 3300037418 Bacteria 5947
241 Ga0395900_0030634 3300037418 Bacteria 5525
242 Ga0395900_0036482 3300037418 Bacteria 5069
243 Ga0395900_0120185 3300037418 Bacteria 2696
244 Ga0395900_0143904 3300037418 Unclassified 2439
245 Ga0395900_0289670 3300037418 Bacteria 1626
246 Ga0395900_0327171 3300037418 Bacteria 1511
247 Ga0395900_0361240 3300037418 Bacteria 1423
248 Ga0395900_0393440 3300037418 Bacteria 1351
249 Ga0395898_0006254 3300037466 Bacteria 12740
250 Ga0395898_0007652 3300037466 Bacteria 11472
251 Ga0395898_0007665 3300037466 Bacteria 11462
252 Ga0395898_0008336 3300037466 Bacteria 10957
253 Ga0395898_0017671 3300037466 Bacteria 7279
254 Ga0395898_0035492 3300037466 Bacteria 4956
255 Ga0395898_0052659 3300037466 Bacteria 3976
256 Ga0395905_0002243 3300037471 Bacteria 21739
257 Ga0395905_0004096 3300037471 Bacteria 15274
258 Ga0395905_0006717 3300037471 Bacteria 11518
259 Ga0395905_0007605 3300037471 Bacteria 10757
260 Ga0395905_0034427 3300037471 Bacteria 4756
261 Ga0395905_0052264 3300037471 Bacteria 3825
262 Ga0395905_0070289 3300037471 Bacteria 3280
263 Ga0395905_0340004 3300037471 Bacteria 1392
264 Ga0395901_0000679 3300038443 Bacteria 39130
265 Ga0395901_0004266 3300038443 Bacteria 14419
266 Ga0395901_0004685 3300038443 Bacteria 13791
267 Ga0395901_0014531 3300038443 Bacteria 8005
268 Ga0395901_0025690 3300038443 Bacteria 6047
269 Ga0395901_0025864 3300038443 Bacteria 6027
270 Ga0395901_0026811 3300038443 Bacteria 5917
271 Ga0395901_0031766 3300038443 Bacteria 5444
272 Ga0395901_0050388 3300038443 Bacteria 4326
273 Ga0395901_0056061 3300038443 Bacteria 4099
274 Ga0395901_0059978 3300038443 Bacteria 3958
275 Ga0395901_0078231 3300038443 Bacteria 3453
276 Ga0395901_0086399 3300038443 Unclassified 3279
277 Ga0395901_0093902 3300038443 Unclassified 3142
278 Ga0395901_0099589 3300038443 Bacteria 3048
279 Ga0395901_0162729 3300038443 Unclassified 2343
280 Ga0395901_0204413 3300038443 Bacteria 2069
281 Ga0395901_0227206 3300038443 Bacteria 1949
282 Ga0395901_0267817 3300038443 Bacteria 1777
283 Ga0395901_0455944 3300038443 Bacteria 1307
284 Ga0436360_1216471 3300039438 Bacteria 7799
285 Ga0439465_0023195 3300041413 Bacteria 1953
286 Ga0451791_0728893 3300041451 Bacteria 1766
287 Ga0451793_0183820 3300041452 Bacteria 2295
288 Ga0451800_0225652 3300041459 Unclassified 1444
289 Ga0451804_1051464 3300041463 Bacteria 2590
290 Ga0451835_0833935 3300041492 Bacteria 2198
291 Ga0451839_0511163 3300041496 Bacteria 2099
292 Ga0451855_0329514 3300041511 Bacteria 2942
293 Ga0451853_0738620 3300041512 Bacteria 3884
294 Ga0451853_0991702 3300041512 Unclassified 1919
295 Ga0439448_0046533 3300042005 Bacteria 1414
296 Ga0439451_012009 3300042009 Bacteria 1747
297 Ga0466963_0005407 3300044694 Bacteria 7479
298 Ga0466963_0007388 3300044694 Bacteria 6546
299 Ga0466963_0091927 3300044694 Bacteria 2067
300 Ga0466964_0004105 3300044706 Bacteria 5361
301 Ga0466964_0011971 3300044706 Bacteria 3280
302 Ga0466964_0091193 3300044706 Bacteria 1326
303 Ga0466957_0080740 3300044842 Unclassified 2025
304 Ga0466960_0048986 3300044901 Bacteria 2032
305 Ga0466958_0020019 3300045836 Bacteria 3899
306 Ga0466958_0077415 3300045836 Bacteria 2042
307 Ga0466967_0000140 3300045976 Bacteria 27968
308 Ga0466967_0024531 3300045976 Bacteria 4960
309 Ga0466967_0042391 3300045976 Bacteria 3932
310 Ga0466967_0246691 3300045976 Bacteria 1704
311 Ga0495603_0003282 3300046455 Bacteria 9635
312 Ga0495629_0050057 3300046459 Unclassified 2927
313 Ga0495629_0054348 3300046459 Bacteria 2801
314 Ga0495653_0031044 3300046463 Bacteria 4250
315 Ga0495582_0081045 3300046473 Unclassified 1802
316 Ga0495639_0030088 3300046475 Unclassified 2412
317 Ga0495662_0069337 3300046476 Unclassified 1708
318 Ga0495584_0071685 3300046491 Bacteria 1741
319 Ga0495596_0006468 3300046500 Bacteria 5386
320 Ga0495596_0059220 3300046500 Bacteria 1493
321 Ga0495618_0038202 3300046514 Unclassified 3016
322 Ga0495663_0008620 3300046525 Bacteria 2828
323 Ga0495652_0123290 3300046529 Bacteria 2063
324 Ga0495652_0159289 3300046529 Bacteria 1754
325 Ga0495640_0075685 3300046533 Bacteria 2248
326 Ga0495586_0009265 3300046535 Bacteria 5235
327 Ga0495586_0062370 3300046535 Unclassified 2029
328 Ga0495587_0111456 3300046536 Unclassified 1571
329 Ga0495609_0029147 3300046538 Bacteria 2515
330 Ga0495609_0049985 3300046538 Bacteria 1865
331 Ga0495645_0110910 3300046543 Bacteria 1941
332 Ga0495668_0008769 3300046616 Bacteria 6272
333 Ga0495634_0094305 3300046642 Bacteria 1940
334 Ga0495659_0007230 3300046664 Unclassified 3518
335 Ga0495658_0034360 3300046683 Bacteria 2782
336 Ga0495613_0019816 3300046689 Bacteria 5013
337 Ga0495624_0051428 3300046690 Bacteria 2607
338 Ga0495589_0120582 3300046794 Bacteria 1263
339 Ga0495674_0083070 3300047319 Bacteria 2746
340 Ga0495676_0035297 3300047321 Bacteria 4184
341 Ga0495676_0048669 3300047321 Bacteria 3416
342 Ga0496100_0068030 3300048903 Unclassified 2367
343 Ga0496101_0005040 3300048904 Bacteria 8398
344 Ga0496101_0013586 3300048904 Bacteria 5459
345 Ga0496101_0156209 3300048904 Bacteria 1747
346 Ga0496102_0041058 3300048905 Bacteria 4188
347 Ga0496102_0067252 3300048905 Bacteria 3286
348 Ga0496102_0089251 3300048905 Bacteria 2851
349 Ga0496103_0001259 3300048906 Bacteria 17295
350 Ga0496103_0062515 3300048906 Bacteria 2317
351 Ga0496103_0089831 3300048906 Bacteria 1938
352 Ga0496104_0000467 3300048907 Bacteria 34852
353 Ga0496104_0009032 3300048907 Bacteria 8862
354 Ga0496104_0048549 3300048907 Unclassified 4001
355 Ga0496104_0115818 3300048907 Unclassified 2572
356 Ga0496105_0000255 3300048908 Bacteria 35883
357 Ga0496105_0007003 3300048908 Bacteria 8684
358 Ga0496105_0050536 3300048908 Bacteria 3434
359 Ga0496105_0085231 3300048908 Bacteria 2610
360 Ga0496105_0108267 3300048908 Bacteria 2294
361 Ga0496105_0120374 3300048908 Unclassified 2165
362 Ga0496105_0126678 3300048908 Bacteria 2105
363 Ga0496106_0002668 3300048909 Bacteria 13276
364 Ga0496106_0119720 3300048909 Bacteria 2057
365 Ga0496106_0134349 3300048909 Bacteria 1942
366 Ga0496106_0284687 3300048909 Bacteria 1324
367 Ga0496107_0004641 3300048910 Bacteria 9318
368 Ga0496107_0033783 3300048910 Bacteria 3661
369 Ga0496107_0065242 3300048910 Bacteria 2639
370 Ga0496107_0085355 3300048910 Bacteria 2304
371 Ga0496107_0121379 3300048910 Bacteria 1925
372 Ga0496108_0001345 3300048911 Bacteria 19324
373 Ga0496108_0023573 3300048911 Bacteria 5065
374 Ga0496109_0002827 3300048912 Bacteria 14545
375 Ga0496109_0003229 3300048912 Bacteria 13575
376 Ga0496109_0008994 3300048912 Bacteria 8504
377 Ga0496109_0011113 3300048912 Bacteria 7721
378 Ga0496109_0014142 3300048912 Bacteria 6938
379 Ga0496109_0065349 3300048912 Bacteria 3330
380 Ga0496109_0186752 3300048912 Bacteria 1947
381 Ga0496110_0000642 3300048913 Bacteria 23961
382 Ga0496110_0000980 3300048913 Bacteria 20040
383 Ga0496110_0001410 3300048913 Bacteria 17372
384 Ga0496110_0020491 3300048913 Bacteria 5584
385 Ga0496110_0027995 3300048913 Bacteria 4836
386 Ga0496110_0212562 3300048913 Bacteria 1758
387 Ga0496110_0270967 3300048913 Unclassified 1546
388 Ga0496111_0000034 3300048914 Bacteria 54519
389 Ga0496111_0000243 3300048914 Bacteria 26096
390 Ga0496111_0035431 3300048914 Bacteria 3566
391 Ga0496111_0053149 3300048914 Bacteria 2926
392 Ga0496111_0057237 3300048914 Bacteria 2822
393 Ga0496111_0242754 3300048914 Unclassified 1337
394 Ga0496112_0013402 3300048915 Bacteria 7567
395 Ga0496112_0022926 3300048915 Bacteria 5957
396 Ga0496112_0038276 3300048915 Bacteria 4683
397 Ga0496112_0076921 3300048915 Bacteria 3300
398 Ga0496112_0080747 3300048915 Bacteria 3216
399 Ga0496112_0090903 3300048915 Bacteria 3022
400 Ga0496112_0402704 3300048915 Bacteria 1308
401 Ga0496112_0422746 3300048915 Unclassified 1271
402 Ga0496113_0004448 3300048916 Bacteria 8622
403 Ga0496113_0022158 3300048916 Bacteria 4489
404 Ga0496113_0059049 3300048916 Bacteria 2889
405 Ga0496113_0271998 3300048916 Bacteria 1354
406 Ga0496113_0273859 3300048916 Bacteria 1349
407 Ga0501031_0000809 3300049568 Bacteria 18820
408 Ga0501031_0078585 3300049568 Bacteria 2150
409 Ga0501032_0001991 3300049569 Bacteria 16082
410 Ga0501032_0021004 3300049569 Bacteria 4542
411 Ga0501033_0026981 3300049570 Bacteria 4320
412 Ga0501033_0074410 3300049570 Bacteria 2493
413 Ga0501034_0111256 3300049571 Bacteria 2729
414 Ga0501034_0142319 3300049571 Bacteria 2377
415 Ga0501036_0001855 3300049572 Bacteria 16381
416 Ga0501036_0010472 3300049572 Bacteria 7660
417 Ga0501037_0001119 3300049573 Bacteria 19924
418 Ga0501037_0055067 3300049573 Bacteria 2908
419 Ga0501037_0088720 3300049573 Bacteria 2238
420 Ga0501038_0001475 3300049574 Bacteria 21645
421 Ga0501038_0047704 3300049574 Bacteria 3709
422 Ga0501038_0138177 3300049574 Unclassified 1995
423 Ga0501039_0002978 3300049575 Bacteria 12671
424 Ga0501039_0003282 3300049575 Bacteria 12099
425 Ga0501039_0004066 3300049575 Bacteria 10996
426 Ga0501040_0000239 3300049576 Bacteria 32294
427 Ga0501040_0007338 3300049576 Bacteria 7139
428 Ga0501040_0010305 3300049576 Bacteria 6113
429 Ga0501040_0062421 3300049576 Viruses 2563
430 Ga0501041_0001644 3300049577 Bacteria 12491
431 Ga0501041_0001805 3300049577 Bacteria 11993
432 Ga0501041_0063065 3300049577 Archaea 2269
433 Ga0501042_0000014 3300049578 Bacteria 53046
434 Ga0501042_0000366 3300049578 Bacteria 22815
435 Ga0501042_0031456 3300049578 Bacteria 3753
436 Ga0501042_0031988 3300049578 Unclassified 3723
437 Ga0501042_0065987 3300049578 Bacteria 2586
438 Ga0501043_0000092 3300049579 Bacteria 80825
439 Ga0501043_0025248 3300049579 Unclassified 4661
440 Ga0501043_0034523 3300049579 Bacteria 3977
441 Ga0501046_0006406 3300049580 Bacteria 10436
442 Ga0501046_0009463 3300049580 Bacteria 8420
443 Ga0501046_0018063 3300049580 Bacteria 5875
444 Ga0501047_0000188 3300049581 Bacteria 75057
445 Ga0501047_0056067 3300049581 Bacteria 3809
446 Ga0501047_0230370 3300049581 Bacteria 1706
447 Ga0501048_0001148 3300049582 Bacteria 19885
448 Ga0501048_0002599 3300049582 Bacteria 13837
449 Ga0501048_0014104 3300049582 Bacteria 5922
450 Ga0501048_0019697 3300049582 Unclassified 4948
451 Ga0501048_0025833 3300049582 Bacteria 4278
452 Ga0501048_0152818 3300049582 Bacteria 1633
453 Ga0501067_0032509 3300049583 Bacteria 2896
454 Ga0501068_0000009 3300049584 Bacteria 67122
455 Ga0501068_0000647 3300049584 Bacteria 17830
456 Ga0501068_0050246 3300049584 Bacteria 2521
457 Ga0501068_0076916 3300049584 Bacteria 2043
458 Ga0501069_0000274 3300049585 Bacteria 23403
459 Ga0501069_0015507 3300049585 Bacteria 4085
460 Ga0501069_0056216 3300049585 Archaea 2192
461 Ga0501070_0006278 3300049586 Bacteria 10114
462 Ga0501070_0010603 3300049586 Bacteria 7789
463 Ga0501070_0029858 3300049586 Bacteria 4567
464 Ga0501070_0055748 3300049586 Unclassified 3276
465 Ga0501070_0096568 3300049586 Bacteria 2445
466 Ga0501071_0002211 3300049587 Bacteria 11702
467 Ga0501071_0003256 3300049587 Bacteria 10130
468 Ga0501071_0003286 3300049587 Bacteria 10096
469 Ga0501071_0026363 3300049587 Bacteria 4078
470 Ga0501071_0056346 3300049587 Bacteria 2839
471 Ga0501071_0093523 3300049587 Bacteria 2210
472 Ga0501072_0000600 3300049588 Bacteria 25969
473 Ga0501072_0003371 3300049588 Bacteria 12014
474 Ga0501072_0007835 3300049588 Bacteria 8113
475 Ga0501072_0011137 3300049588 Bacteria 6863
476 Ga0501072_0072434 3300049588 Bacteria 2723
477 Ga0501072_0089110 3300049588 Bacteria 2448
478 Ga0501073_0008092 3300049589 Bacteria 7800
479 Ga0501073_0064552 3300049589 Bacteria 2553
480 Ga0501074_0000215 3300049590 Bacteria 31741
481 Ga0501074_0004956 3300049590 Bacteria 9541
482 Ga0501075_0000006 3300049591 Bacteria 111683
483 Ga0501075_0008445 3300049591 Bacteria 7184
484 Ga0501075_0011175 3300049591 Bacteria 6345
485 Ga0501075_0019283 3300049591 Bacteria 4945
486 Ga0501075_0060230 3300049591 Bacteria 2861
487 Ga0501075_0060270 3300049591 Bacteria 2859
488 Ga0501075_0130615 3300049591 Bacteria 1914
489 Ga0501076_0001522 3300049592 Bacteria 15527
490 Ga0501076_0002138 3300049592 Bacteria 13566
491 Ga0501076_0014684 3300049592 Bacteria 5904
492 Ga0501076_0042629 3300049592 Bacteria 3573
493 Ga0501076_0209398 3300049592 Bacteria 1593
494 Ga0501077_0004148 3300049593 Bacteria 8755
495 Ga0501077_0011970 3300049593 Bacteria 5427
496 Ga0501077_0043141 3300049593 Bacteria 2866
497 Ga0501079_0000902 3300049741 Bacteria 20349
498 Ga0501079_0001040 3300049741 Bacteria 19219
499 Ga0501079_0015041 3300049741 Bacteria 5899
500 Ga0501079_0051488 3300049741 Unclassified 3179
501 Ga0501079_0134237 3300049741 Bacteria 1926
502 Ga0501079_0349509 3300049741 Bacteria 1158
503 Ga0501080_0000026 3300049742 Bacteria 89548
504 Ga0501080_0001089 3300049742 Bacteria 22370
505 Ga0501080_0004898 3300049742 Bacteria 11932
506 Ga0501081_0000069 3300049743 Bacteria 39558
507 Ga0501081_0003757 3300049743 Bacteria 9719
508 Ga0501081_0011707 3300049743 Bacteria 5741
509 Ga0501081_0031631 3300049743 Unclassified 3586
510 Ga0501081_0035688 3300049743 Bacteria 3385
511 Ga0501081_0067284 3300049743 Bacteria 2493
512 Ga0501083_0001321 3300049744 Bacteria 16805
513 Ga0501083_0021115 3300049744 Bacteria 4526
514 Ga0501035_0000499 3300049822 Bacteria 44174
515 Ga0501035_0099439 3300049822 Bacteria 2553
516 Ga0501044_0004392 3300049823 Bacteria 15777
517 Ga0501044_0055463 3300049823 Bacteria 4070
518 Ga0501044_0139262 3300049823 Bacteria 2415
519 Ga0501045_0000110 3300049824 Bacteria 41325
520 Ga0501045_0000585 3300049824 Bacteria 22890
521 Ga0501045_0013642 3300049824 Bacteria 5743
522 Ga0501045_0034975 3300049824 Bacteria 3647
523 nmdc:mga06z11_97347_c1 3300050494 Bacteria 1608
524 nmdc:mga05p37_1860_c1 3300050507 Bacteria 24585
525 nmdc:mga05p37_57956_c1 3300050507 Bacteria 4770
526 nmdc:mga06r32_39864_c1 3300050510 Bacteria 4458
527 nmdc:mga08y16_120186_c1 3300050511 Bacteria 2734
528 nmdc:mga08y16_134480_c1 3300050511 Bacteria 2570
529 nmdc:mga08y16_2814_c1 3300050511 Bacteria 17864
530 nmdc:mga08y16_31729_c1 3300050511 Bacteria 5555
531 nmdc:mga0n895_17560_c1 3300050512 Bacteria 6598
532 nmdc:mga0n895_179516_c1 3300050512 Unclassified 2148
533 nmdc:mga0n895_21959_c1 3300050512 Bacteria 5979
534 nmdc:mga0n895_75067_c1 3300050512 Bacteria 3360
535 nmdc:mga0rr50_14547_c1 3300050513 Bacteria 5166
536 nmdc:mga0rr50_5540_c1 3300050513 Bacteria 7547
537 nmdc:mga08x19_20950_c1 3300050514 Unclassified 4032
538 nmdc:mga08x19_41424_c1 3300050514 Bacteria 2933
539 nmdc:mga08x19_9545_c1 3300050514 Bacteria 5809
540 nmdc:mga0a205_206003_c1 3300050515 Unclassified 1856
541 Ga0495601_0039079 3300053077 Unclassified 2970
542 Ga0495619_0011726 3300053085 Bacteria 5523
543 Ga0495619_0047560 3300053085 Bacteria 2825
544 Ga0495619_0105576 3300053085 Bacteria 1920
545 Ga0501084_0000105 3300054114 Bacteria 62464
546 Ga0501084_0002637 3300054114 Bacteria 14452
547 Ga0501084_0059032 3300054114 Bacteria 3210
548 Ga0501082_0000453 3300060353 Bacteria 36303
549 Ga0501082_0001714 3300060353 Bacteria 19338
550 Ga0501082_0011424 3300060353 Bacteria 7639
551 Ga0530510_0001130 3300061734 Bacteria 17735
552 Ga0530510_0001571 3300061734 Bacteria 15385
553 Ga0530510_0006616 3300061734 Bacteria 8081
554 Ga0530510_0015884 3300061734 Bacteria 5323
555 Ga0530510_0044221 3300061734 Bacteria 3218
556 Ga0496110_0073033
557 Ga0070658_10002497
558 Ga0070658_10011603
559 Ga0070658_10030991
560 Ga0070683_100006342
561 Ga0070683_100008056
562 Ga0070683_100140085
563 Ga0070690_100045366
564 Ga0068869_100124303
565 Ga0070680_100022365
566 Ga0070660_100013533
567 Ga0070660_100058974
568 Ga0070661_100140376
569 Ga0070692_10027195
570 Ga0070674_100119587
571 Ga0070673_100096373
572 Ga0070659_100093069
573 Ga0070703_10000997
574 Ga0070709_10031557
575 Ga0070714_100031260
576 Ga0070714_100083586
577 Ga0070714_100162190
578 Ga0070714_100201560
579 Ga0070710_10004658
580 Ga0070710_10022551
581 Ga0070710_10102676
582 Ga0070701_10013537
583 Ga0070711_100006010
584 Ga0070711_100011069
585 Ga0070705_100129196
586 Ga0070700_100127726
587 Ga0070708_100109578
588 Ga0070678_100000610
589 Ga0070662_100165283
590 Ga0070681_10014785
591 Ga0070681_10056775
592 Ga0070681_10093019
593 Ga0070681_10097558
594 Ga0070681_10271645
595 Ga0068867_100149575
596 Ga0070685_10003502
597 Ga0070706_100023630
598 Ga0070706_100066471
599 Ga0070706_100134741
600 Ga0070707_100000909
601 Ga0070707_100021091
602 Ga0070707_100061874
603 Ga0070707_100247195
604 Ga0070698_100040788
605 Ga0070698_100048974
606 Ga0070684_100003041
607 Ga0070686_100001075
608 Ga0070693_100024887
609 Ga0068855_100190228
610 Ga0068857_100000231
611 Ga0068864_100337364
612 Ga0068866_10101416
613 Ga0068860_100297273
614 Ga0081455_10018564
615 Ga0081455_10041173
616 Ga0081538_10000055
617 Ga0081538_10000181
618 Ga0081538_10000872
619 Ga0081538_10008020
620 Ga0081538_10009342
621 Ga0081538_10010401
622 Ga0081539_10009081
623 Ga0081539_10011735
624 Ga0070717_10140931
625 Ga0075365_10006295
626 Ga0075432_10007642
627 Ga0070716_100021290
628 Ga0070716_100025433
629 Ga0070712_100008079
630 Ga0075367_10006846
631 Ga0068871_100047960
632 Ga0075428_100038921
633 Ga0075431_100064278
634 Ga0075433_10076977
635 Ga0075433_10080223
636 Ga0075433_10158230
637 Ga0075434_100013050
638 Ga0075434_100185299
639 Ga0068865_100002992
640 Ga0068865_100025608
641 Ga0068865_100144978
642 Ga0075436_100007008
643 Ga0075436_100131273
644 Ga0075435_100005525
645 Ga0075435_100011437
646 Ga0075435_100029327
647 Ga0105240_10575253
648 Ga0111539_10001013
649 Ga0111539_10017759
650 Ga0111539_10040161
651 Ga0111539_10082834
652 Ga0111539_10424541
653 Ga0105245_10032880
654 Ga0105245_10131761
655 Ga0105245_10298648
656 Ga0114129_10035516
657 Ga0114129_10057122
658 Ga0105243_10132670
659 Ga0105243_10336103
660 Ga0105241_10026624
661 Ga0105242_10007056
662 Ga0105248_10019066
663 Ga0105237_10077396
664 Ga0105249_10174862
665 Ga0105239_10088185
666 Ga0105239_10098494
667 Ga0105239_10259299
668 Ga0157370_10075852
669 Ga0157370_10076775
670 Ga0157369_10084687
671 Ga0157369_10116774
672 Ga0157369_10353044
673 Ga0157378_10178628
674 Ga0157378_10206406
675 Ga0163162_10003800
676 Ga0157375_10019240
677 Ga0157380_10031370
678 Ga0182008_10051517
679 Ga0157377_10058567
680 Ga0157377_10068877
681 Ga0182006_1041689
682 Ga0182007_10011690
683 Ga0163161_10143296
684 Ga0206354_11363323
685 Ga0206353_10834556
686 Ga0206353_11109028
687 Ga0206353_11156630
688 Ga0207653_10000538
689 Ga0207692_10141593
690 Ga0207692_10158823
691 Ga0207705_10076550
692 Ga0207705_10130500
693 Ga0207705_10222652
694 Ga0207684_10042505
695 Ga0207684_10086381
696 Ga0207684_10122505
697 Ga0207654_10115657
698 Ga0207707_10048000
699 Ga0207707_10162294
700 Ga0207695_10128568
701 Ga0207693_10001397
702 Ga0207693_10002189
703 Ga0207693_10012137
704 Ga0207693_10067196
705 Ga0207663_10005437
706 Ga0207660_10017078
707 Ga0207660_10204699
708 Ga0207657_10014881
709 Ga0207657_10029232
710 Ga0207657_10033185
711 Ga0207652_10018363
712 Ga0207646_10005164
713 Ga0207646_10018786
714 Ga0207646_10201646
715 Ga0207646_10223216
716 Ga0207646_10402114
717 Ga0207700_10000001
718 Ga0207664_10104803
719 Ga0207664_10177422
720 Ga0207664_10318314
721 Ga0207706_10076507
722 Ga0207709_10002296
723 Ga0207669_10001101
724 Ga0207704_10070630
725 Ga0207665_10017671
726 Ga0207665_10042628
727 Ga0207711_10037642
728 Ga0207689_10076567
729 Ga0207661_10001980
730 Ga0207661_10074547
731 Ga0207661_10136065
732 Ga0207667_10062529
733 Ga0207667_10131563
734 Ga0207651_10042114
735 Ga0207668_10090913
736 Ga0207640_10045927
737 Ga0207640_10096421
738 Ga0207658_10019445
739 Ga0207703_10264424
740 Ga0207678_10011108
741 Ga0207708_10000318
742 Ga0207708_10029838
743 Ga0207648_10058319
744 Ga0207648_10059968
745 Ga0207676_10156544
746 Ga0207674_10000602
747 Ga0207674_10001034
748 Ga0207675_100158994
749 Ga0207675_100175106
750 Ga0207683_10001788
751 Ga0207683_10002095
752 Ga0207428_10012917
753 Ga0207428_10084990
754 Ga0268266_10087460
755 Ga0265319_1001078
756 Ga0265334_10018145
757 Ga0265318_10014025
758 Ga0265323_10043426
759 Ga0265338_10044423
760 Ga0265338_10166260
761 Ga0265325_10011530
762 Ga0265339_10051826
763 Ga0265316_10007718
764 Ga0307408_100075736
765 Ga0265314_10061158
766 Ga0307405_10016729
767 Ga0307410_10082830
768 Ga0307406_10052447
769 Ga0307407_10031183
770 Ga0307412_10069142
771 Ga0307416_100005331
772 Ga0307416_100080229
773 Ga0307414_10028627
774 Ga0307415_100019373
775 Ga0373950_0006939
776 Ga0373940_0029624
777 Ga0373949_0002319
778 Ga0373932_0010090
779 Ga0373939_0002365
780 Ga0373943_0077163
781 Ga0373947_0005766
782 Ga0395899_0004381
783 Ga0395899_0030795
784 Ga0395899_0059061
785 Ga0395899_0070298
786 Ga0395899_0174027
787 Ga0395900_0002094
788 Ga0395900_0009598
789 Ga0395900_0009995
790 Ga0395900_0010324
791 Ga0395900_0019705
792 Ga0395900_0022951
793 Ga0395900_0023499
794 Ga0395900_0023983
795 Ga0395900_0026396
796 Ga0395900_0030634
797 Ga0395900_0036482
798 Ga0395900_0120185
799 Ga0395900_0143904
800 Ga0395900_0289670
801 Ga0395900_0327171
802 Ga0395900_0361240
803 Ga0395900_0393440
804 Ga0395898_0006254
805 Ga0395898_0007652
806 Ga0395898_0007665
807 Ga0395898_0008336
808 Ga0395898_0017671
809 Ga0395898_0035492
810 Ga0395898_0052659
811 Ga0395905_0002243
812 Ga0395905_0004096
813 Ga0395905_0006717
814 Ga0395905_0007605
815 Ga0395905_0034427
816 Ga0395905_0052264
817 Ga0395905_0070289
818 Ga0395905_0340004
819 Ga0395901_0000679
820 Ga0395901_0004266
821 Ga0395901_0004685
822 Ga0395901_0014531
823 Ga0395901_0025690
824 Ga0395901_0025864
825 Ga0395901_0026811
826 Ga0395901_0031766
827 Ga0395901_0050388
828 Ga0395901_0056061
829 Ga0395901_0059978
830 Ga0395901_0078231
831 Ga0395901_0086399
832 Ga0395901_0093902
833 Ga0395901_0099589
834 Ga0395901_0162729
835 Ga0395901_0204413
836 Ga0395901_0227206
837 Ga0395901_0267817
838 Ga0395901_0455944
839 Ga0436360_1216471
840 Ga0439465_0023195
841 Ga0451791_0728893
842 Ga0451793_0183820
843 Ga0451800_0225652
844 Ga0451804_1051464
845 Ga0451835_0833935
846 Ga0451839_0511163
847 Ga0451855_0329514
848 Ga0451853_0738620
849 Ga0451853_0991702
850 Ga0439448_0046533
851 Ga0439451_012009
852 Ga0466963_0005407
853 Ga0466963_0007388
854 Ga0466963_0091927
855 Ga0466964_0004105
856 Ga0466964_0011971
857 Ga0466964_0091193
858 Ga0466957_0080740
859 Ga0466960_0048986
860 Ga0466958_0020019
861 Ga0466958_0077415
862 Ga0466967_0000140
863 Ga0466967_0024531
864 Ga0466967_0042391
865 Ga0466967_0246691
866 Ga0495603_0003282
867 Ga0495629_0050057
868 Ga0495629_0054348
869 Ga0495653_0031044
870 Ga0495582_0081045
871 Ga0495639_0030088
872 Ga0495662_0069337
873 Ga0495584_0071685
874 Ga0495596_0006468
875 Ga0495596_0059220
876 Ga0495618_0038202
877 Ga0495663_0008620
878 Ga0495652_0123290
879 Ga0495652_0159289
880 Ga0495640_0075685
881 Ga0495586_0009265
882 Ga0495586_0062370
883 Ga0495587_0111456
884 Ga0495609_0029147
885 Ga0495609_0049985
886 Ga0495645_0110910
887 Ga0495668_0008769
888 Ga0495634_0094305
889 Ga0495659_0007230
890 Ga0495658_0034360
891 Ga0495613_0019816
892 Ga0495624_0051428
893 Ga0495589_0120582
894 Ga0495674_0083070
895 Ga0495676_0035297
896 Ga0495676_0048669
897 Ga0496100_0068030
898 Ga0496101_0005040
899 Ga0496101_0013586
900 Ga0496101_0156209
901 Ga0496102_0041058
902 Ga0496102_0067252
903 Ga0496102_0089251
904 Ga0496103_0001259
905 Ga0496103_0062515
906 Ga0496103_0089831
907 Ga0496104_0000467
908 Ga0496104_0009032
909 Ga0496104_0048549
910 Ga0496104_0115818
911 Ga0496105_0000255
912 Ga0496105_0007003
913 Ga0496105_0050536
914 Ga0496105_0085231
915 Ga0496105_0108267
916 Ga0496105_0120374
917 Ga0496105_0126678
918 Ga0496106_0002668
919 Ga0496106_0119720
920 Ga0496106_0134349
921 Ga0496106_0284687
922 Ga0496107_0004641
923 Ga0496107_0033783
924 Ga0496107_0065242
925 Ga0496107_0085355
926 Ga0496107_0121379
927 Ga0496108_0001345
928 Ga0496108_0023573
929 Ga0496109_0002827
930 Ga0496109_0003229
931 Ga0496109_0008994
932 Ga0496109_0011113
933 Ga0496109_0014142
934 Ga0496109_0065349
935 Ga0496109_0186752
936 Ga0496110_0000642
937 Ga0496110_0000980
938 Ga0496110_0001410
939 Ga0496110_0020491
940 Ga0496110_0027995
941 Ga0496110_0212562
942 Ga0496110_0270967
943 Ga0496111_0000034
944 Ga0496111_0000243
945 Ga0496111_0035431
946 Ga0496111_0053149
947 Ga0496111_0057237
948 Ga0496111_0242754
949 Ga0496112_0013402
950 Ga0496112_0022926
951 Ga0496112_0038276
952 Ga0496112_0076921
953 Ga0496112_0080747
954 Ga0496112_0090903
955 Ga0496112_0402704
956 Ga0496112_0422746
957 Ga0496113_0004448
958 Ga0496113_0022158
959 Ga0496113_0059049
960 Ga0496113_0271998
961 Ga0496113_0273859
962 Ga0501031_0000809
963 Ga0501031_0078585
964 Ga0501032_0001991
965 Ga0501032_0021004
966 Ga0501033_0026981
967 Ga0501033_0074410
968 Ga0501034_0111256
969 Ga0501034_0142319
970 Ga0501036_0001855
971 Ga0501036_0010472
972 Ga0501037_0001119
973 Ga0501037_0055067
974 Ga0501037_0088720
975 Ga0501038_0001475
976 Ga0501038_0047704
977 Ga0501038_0138177
978 Ga0501039_0002978
979 Ga0501039_0003282
980 Ga0501039_0004066
981 Ga0501040_0000239
982 Ga0501040_0007338
983 Ga0501040_0010305
984 Ga0501040_0062421
985 Ga0501041_0001644
986 Ga0501041_0001805
987 Ga0501041_0063065
988 Ga0501042_0000014
989 Ga0501042_0000366
990 Ga0501042_0031456
991 Ga0501042_0031988
992 Ga0501042_0065987
993 Ga0501043_0000092
994 Ga0501043_0025248
995 Ga0501043_0034523
996 Ga0501046_0006406
997 Ga0501046_0009463
998 Ga0501046_0018063
999 Ga0501047_0000188
1000 Ga0501047_0056067
1001 Ga0501047_0230370
1002 Ga0501048_0001148
1003 Ga0501048_0002599
1004 Ga0501048_0014104
1005 Ga0501048_0019697
1006 Ga0501048_0025833
1007 Ga0501048_0152818
1008 Ga0501067_0032509
1009 Ga0501068_0000009
1010 Ga0501068_0000647
1011 Ga0501068_0050246
1012 Ga0501068_0076916
1013 Ga0501069_0000274
1014 Ga0501069_0015507
1015 Ga0501069_0056216
1016 Ga0501070_0006278
1017 Ga0501070_0010603
1018 Ga0501070_0029858
1019 Ga0501070_0055748
1020 Ga0501070_0096568
1021 Ga0501071_0002211
1022 Ga0501071_0003256
1023 Ga0501071_0003286
1024 Ga0501071_0026363
1025 Ga0501071_0056346
1026 Ga0501071_0093523
1027 Ga0501072_0000600
1028 Ga0501072_0003371
1029 Ga0501072_0007835
1030 Ga0501072_0011137
1031 Ga0501072_0072434
1032 Ga0501072_0089110
1033 Ga0501073_0008092
1034 Ga0501073_0064552
1035 Ga0501074_0000215
1036 Ga0501074_0004956
1037 Ga0501075_0000006
1038 Ga0501075_0008445
1039 Ga0501075_0011175
1040 Ga0501075_0019283
1041 Ga0501075_0060230
1042 Ga0501075_0060270
1043 Ga0501075_0130615
1044 Ga0501076_0001522
1045 Ga0501076_0002138
1046 Ga0501076_0014684
1047 Ga0501076_0042629
1048 Ga0501076_0209398
1049 Ga0501077_0004148
1050 Ga0501077_0011970
1051 Ga0501077_0043141
1052 Ga0501079_0000902
1053 Ga0501079_0001040
1054 Ga0501079_0015041
1055 Ga0501079_0051488
1056 Ga0501079_0134237
1057 Ga0501079_0349509
1058 Ga0501080_0000026
1059 Ga0501080_0001089
1060 Ga0501080_0004898
1061 Ga0501081_0000069
1062 Ga0501081_0003757
1063 Ga0501081_0011707
1064 Ga0501081_0031631
1065 Ga0501081_0035688
1066 Ga0501081_0067284
1067 Ga0501083_0001321
1068 Ga0501083_0021115
1069 Ga0501035_0000499
1070 Ga0501035_0099439
1071 Ga0501044_0004392
1072 Ga0501044_0055463
1073 Ga0501044_0139262
1074 Ga0501045_0000110
1075 Ga0501045_0000585
1076 Ga0501045_0013642
1077 Ga0501045_0034975
1078 nmdc:mga06z11_97347_c1
1079 nmdc:mga05p37_1860_c1
1080 nmdc:mga05p37_57956_c1
1081 nmdc:mga06r32_39864_c1
1082 nmdc:mga08y16_120186_c1
1083 nmdc:mga08y16_134480_c1
1084 nmdc:mga08y16_2814_c1
1085 nmdc:mga08y16_31729_c1
1086 nmdc:mga0n895_17560_c1
1087 nmdc:mga0n895_179516_c1
1088 nmdc:mga0n895_21959_c1
1089 nmdc:mga0n895_75067_c1
1090 nmdc:mga0rr50_14547_c1
1091 nmdc:mga0rr50_5540_c1
1092 nmdc:mga08x19_20950_c1
1093 nmdc:mga08x19_41424_c1
1094 nmdc:mga08x19_9545_c1
1095 nmdc:mga0a205_206003_c1
1096 Ga0495601_0039079
1097 Ga0495619_0011726
1098 Ga0495619_0047560
1099 Ga0495619_0105576
1100 Ga0501084_0000105
1101 Ga0501084_0002637
1102 Ga0501084_0059032
1103 Ga0501082_0000453
1104 Ga0501082_0001714
1105 Ga0501082_0011424
1106 Ga0530510_0001130
1107 Ga0530510_0001571
1108 Ga0530510_0006616
1109 Ga0530510_0015884
1110 Ga0530510_0044221

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12831

FAD_oxidored

FAD dependent oxidoreductase

11

44

0.95

PF00890

FAD_binding_2

FAD binding domain

11

385

0.94

PF01266

DAO

FAD dependent oxidoreductase

11

136

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jyt-assembly1.cif.gz_A ancestral imine reducatase n560 0.9758 5 34
7osn-assembly3.cif.gz_F ired361 from micromonospora sp. in complex with nadp+ 0.975 5 34
5a9s-assembly1.cif.gz_B nadph complex of imine reductase from amycolatopsis orientalis 0.9748 5 34
5ocm-assembly1.cif.gz_A imine reductase from streptosporangium roseum in complex with nadp+ and 2,2,2-trifluoroacetophenone hydrate 0.9731 4 34
8ozw-assembly1.cif.gz_A imine reductase from ajellomyces dermatitidis in complex nadph4 0.9713 5 34
ID Description Score Start End Superfamily
4j0fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9883 5 32 3.40.50.720
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9798 6 35 3.50.50.60
4dnaB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9773 5 35 3.50.50.60
5a9sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9748 5 34 3.40.50.720
5z2gB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9713 6 33 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A355BFS1-F1-model_v4 L-aspartate oxidase 0.9114 4 156 GO:0008734
GO:0034628
AF-A0A7V9VK89-F1-model_v4 FAD-dependent oxidoreductase 0.91 1 147 GO:0008734
GO:0034628
AF-A0A523WG10-F1-model_v4 FAD-binding protein 0.9098 5 179 GO:0016491
AF-A0A3B8V2N6-F1-model_v4 L-aspartate oxidase 0.9081 4 141 GO:0008734
GO:0034628
AF-A0A2M7PMY7-F1-model_v4 L-aspartate oxidase 0.9036 4 142 GO:0008734
GO:0034628

Map