F463114

General Info

Members Datasets Scaffolds Average Seq Length
555 260 1110 164

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10770458|Ga0207687_107704582
Length 187
Sequence MRDEAEHKADSGTVEVGARRCRDAEGVTLAGRAVVIRQDDVDTDVLYPGEYLNVTDVEKMTQYLFEGLDPSLRDECDGDTVLVVGSNFGAGSSREHVPQAMSASGIRFLVGKSFARIFYRNCINLGLPAVVSEAAVAAAGDGSTVELDLEDGSVLVDGERFALNPVPPFMREIFAAGGLIPWVLRQR

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.45
Rhizosphere 88.83
Stem 0
Stem Tuber 0
Unclassified 15.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10770458 3300025927 Unclassified 819
2 Ga0065704_10111544 3300005289 Bacteria 1954
3 Ga0070683_100075852 3300005329 Bacteria 3142
4 Ga0070683_100431597 3300005329 Bacteria 1257
5 Ga0070677_10117416 3300005333 Bacteria 1197
6 Ga0068869_100035231 3300005334 Bacteria 3546
7 Ga0070666_10558910 3300005335 Bacteria 833
8 Ga0070680_100004240 3300005336 Bacteria 10759
9 Ga0070680_100032110 3300005336 Bacteria 4224
10 Ga0070680_100191649 3300005336 Bacteria 1723
11 Ga0070682_100015060 3300005337 Bacteria 4476
12 Ga0070682_100104420 3300005337 Bacteria 1876
13 Ga0070682_100831500 3300005337 Bacteria 753
14 Ga0070682_101000876 3300005337 Bacteria 694
15 Ga0068868_100028582 3300005338 Bacteria 4264
16 Ga0070660_100029046 3300005339 Bacteria 4141
17 Ga0070660_100097266 3300005339 Bacteria 2328
18 Ga0070660_100310196 3300005339 Unclassified 1294
19 Ga0070687_100148560 3300005343 Unclassified 1373
20 Ga0070661_100229769 3300005344 Unclassified 1425
21 Ga0070661_101005976 3300005344 Bacteria 692
22 Ga0070692_10001475 3300005345 Bacteria 8573
23 Ga0070692_10034994 3300005345 Bacteria 2540
24 Ga0070668_100169883 3300005347 Bacteria 1775
25 Ga0070668_101134225 3300005347 Bacteria 707
26 Ga0070675_100074098 3300005354 Bacteria 2827
27 Ga0070675_100130847 3300005354 Bacteria 2138
28 Ga0070675_100381238 3300005354 Bacteria 1255
29 Ga0070675_101362982 3300005354 Unclassified 654
30 Ga0070671_100118985 3300005355 Bacteria 2222
31 Ga0070674_100006039 3300005356 Bacteria 7041
32 Ga0070674_100101570 3300005356 Bacteria 2096
33 Ga0070674_100401011 3300005356 Bacteria 1121
34 Ga0070674_101592813 3300005356 Bacteria 589
35 Ga0070673_100029852 3300005364 Bacteria 4071
36 Ga0070673_100424325 3300005364 Bacteria 1193
37 Ga0070659_100005610 3300005366 Bacteria 9022
38 Ga0070659_101281557 3300005366 Archaea 649
39 Ga0070667_100206184 3300005367 Bacteria 1746
40 Ga0070667_100217949 3300005367 Bacteria 1698
41 Ga0070667_100257953 3300005367 Bacteria 1560
42 Ga0070714_100014289 3300005435 Bacteria 6377
43 Ga0070714_100060436 3300005435 Bacteria 3252
44 Ga0070714_100340401 3300005435 Bacteria 1407
45 Ga0070714_100519126 3300005435 Unclassified 1138
46 Ga0070713_100268203 3300005436 Bacteria 1562
47 Ga0070713_100548290 3300005436 Bacteria 1095
48 Ga0070701_10003144 3300005438 Bacteria 6479
49 Ga0070700_100116152 3300005441 Bacteria 1786
50 Ga0070700_100166139 3300005441 Bacteria 1524
51 Ga0070694_100106885 3300005444 Bacteria 1988
52 Ga0070694_100243396 3300005444 Bacteria 1357
53 Ga0070663_100064075 3300005455 Bacteria 2656
54 Ga0070663_100405180 3300005455 Bacteria 1116
55 Ga0070663_100433925 3300005455 Bacteria 1080
56 Ga0070662_100002830 3300005457 Bacteria 10754
57 Ga0070662_101222263 3300005457 Bacteria 646
58 Ga0070681_10183708 3300005458 Bacteria 2012
59 Ga0070681_10591450 3300005458 Bacteria 1024
60 Ga0068867_100046254 3300005459 Bacteria 3196
61 Ga0070685_10012413 3300005466 Bacteria 4475
62 Ga0070685_10039588 3300005466 Bacteria 2679
63 Ga0070707_100332521 3300005468 Bacteria 1476
64 Ga0070698_100068034 3300005471 Bacteria 3580
65 Ga0070698_100191490 3300005471 Bacteria 1983
66 Ga0070679_100031492 3300005530 Bacteria 5240
67 Ga0070679_100099824 3300005530 Bacteria 2890
68 Ga0070679_100608435 3300005530 Bacteria 1036
69 Ga0070684_100034111 3300005535 Bacteria 4349
70 Ga0070684_100317172 3300005535 Bacteria 1432
71 Ga0070684_100474505 3300005535 Bacteria 1157
72 Ga0070684_100632775 3300005535 Unclassified 995
73 Ga0070697_100061289 3300005536 Bacteria 3068
74 Ga0070697_100513329 3300005536 Bacteria 1049
75 Ga0068853_100012064 3300005539 Bacteria 7032
76 Ga0068853_100325509 3300005539 Bacteria 1425
77 Ga0070672_100013410 3300005543 Bacteria 5790
78 Ga0070672_100014217 3300005543 Bacteria 5634
79 Ga0070672_100195591 3300005543 Bacteria 1690
80 Ga0070686_100011858 3300005544 Bacteria 4954
81 Ga0070686_100069143 3300005544 Bacteria 2305
82 Ga0070686_100218865 3300005544 Bacteria 1375
83 Ga0070696_100215411 3300005546 Bacteria 1439
84 Ga0070696_100332894 3300005546 Bacteria 1171
85 Ga0070693_100031569 3300005547 Bacteria 2905
86 Ga0070693_100152566 3300005547 Unclassified 1465
87 Ga0070693_100673204 3300005547 Bacteria 755
88 Ga0070665_100026962 3300005548 Bacteria 5785
89 Ga0070665_101066663 3300005548 Unclassified 820
90 Ga0070665_101268913 3300005548 Bacteria 747
91 Ga0068855_100046644 3300005563 Bacteria 5121
92 Ga0068855_100404871 3300005563 Unclassified 1495
93 Ga0068855_101326569 3300005563 Bacteria 744
94 Ga0070664_100027397 3300005564 Bacteria 4735
95 Ga0070664_100190857 3300005564 Bacteria 1825
96 Ga0070664_100923822 3300005564 Unclassified 819
97 Ga0068857_100033718 3300005577 Bacteria 4528
98 Ga0068857_100559053 3300005577 Bacteria 1078
99 Ga0068857_100712893 3300005577 Bacteria 954
100 Ga0068856_100123558 3300005614 Bacteria 2591
101 Ga0068856_100584829 3300005614 Bacteria 1138
102 Ga0070702_100049593 3300005615 Bacteria 2395
103 Ga0070702_100071134 3300005615 Bacteria 2055
104 Ga0068852_100003178 3300005616 Bacteria 11468
105 Ga0068852_100006006 3300005616 Bacteria 8747
106 Ga0068852_100007390 3300005616 Bacteria 8017
107 Ga0068859_100977508 3300005617 Bacteria 929
108 Ga0068864_101205095 3300005618 Unclassified 756
109 Ga0068866_10109893 3300005718 Bacteria 1536
110 Ga0068861_100041282 3300005719 Bacteria 3456
111 Ga0068861_100164236 3300005719 Bacteria 1834
112 Ga0068861_101361174 3300005719 Bacteria 692
113 Ga0068851_10102686 3300005834 Bacteria 1519
114 Ga0068851_10131559 3300005834 Unclassified 1353
115 Ga0068870_10034416 3300005840 Bacteria 2592
116 Ga0068870_10965701 3300005840 Bacteria 606
117 Ga0068863_100155746 3300005841 Bacteria 2187
118 Ga0068863_101537696 3300005841 Unclassified 674
119 Ga0068858_100138853 3300005842 Bacteria 2281
120 Ga0068858_100352316 3300005842 Bacteria 1410
121 Ga0068860_100028272 3300005843 Bacteria 5396
122 Ga0068860_101911374 3300005843 Unclassified 615
123 Ga0070717_10028126 3300006028 Bacteria 4496
124 Ga0070717_10059402 3300006028 Bacteria 3164
125 Ga0070717_10254069 3300006028 Bacteria 1553
126 Ga0070717_10299262 3300006028 Bacteria 1430
127 Ga0070712_100037161 3300006175 Bacteria 3318
128 Ga0070712_100269582 3300006175 Bacteria 1367
129 Ga0070712_100446076 3300006175 Bacteria 1077
130 Ga0070712_100666406 3300006175 Bacteria 885
131 Ga0070712_101627834 3300006175 Archaea 565
132 Ga0097621_100252836 3300006237 Bacteria 1544
133 Ga0068871_100191152 3300006358 Bacteria 1763
134 Ga0068871_100760517 3300006358 Unclassified 891
135 Ga0075428_100271740 3300006844 Bacteria 1824
136 Ga0075433_10097635 3300006852 Bacteria 2600
137 Ga0075433_10653632 3300006852 Bacteria 922
138 Ga0075434_100215737 3300006871 Bacteria 1939
139 Ga0075434_100289085 3300006871 Bacteria 1659
140 Ga0075434_100374012 3300006871 Unclassified 1446
141 Ga0075429_100808836 3300006880 Unclassified 821
142 Ga0068865_100107319 3300006881 Bacteria 2053
143 Ga0068865_100565280 3300006881 Bacteria 957
144 Ga0097620_100977646 3300006931 Bacteria 929
145 Ga0075435_100167462 3300007076 Bacteria 1853
146 Ga0075435_100964410 3300007076 Bacteria 744
147 Ga0105240_10283128 3300009093 Bacteria 1903
148 Ga0111539_10041629 3300009094 Bacteria 5521
149 Ga0111539_11763938 3300009094 Unclassified 718
150 Ga0105245_10032271 3300009098 Bacteria 4637
151 Ga0105245_10423774 3300009098 Bacteria 1334
152 Ga0105245_10619513 3300009098 Unclassified 1110
153 Ga0105245_10866720 3300009098 Unclassified 944
154 Ga0114129_10064943 3300009147 Bacteria 5094
155 Ga0105243_10006839 3300009148 Bacteria 8790
156 Ga0105243_10027681 3300009148 Bacteria 4346
157 Ga0105242_10009376 3300009176 Bacteria 7511
158 Ga0105242_10041915 3300009176 Bacteria 3694
159 Ga0105248_10095539 3300009177 Bacteria 3346
160 Ga0105248_10322382 3300009177 Bacteria 1740
161 Ga0105248_10407418 3300009177 Bacteria 1531
162 Ga0105248_10620295 3300009177 Bacteria 1220
163 Ga0105237_10107981 3300009545 Bacteria 2775
164 Ga0105237_11454720 3300009545 Bacteria 692
165 Ga0105238_10015628 3300009551 Bacteria 7682
166 Ga0105238_10140030 3300009551 Bacteria 2396
167 Ga0105238_10613778 3300009551 Bacteria 1096
168 Ga0105238_10951982 3300009551 Unclassified 878
169 Ga0105249_10262697 3300009553 Bacteria 1716
170 Ga0105239_10058537 3300010375 Bacteria 4228
171 Ga0105239_10216828 3300010375 Bacteria 2146
172 Ga0105239_10234396 3300010375 Bacteria 2060
173 Ga0105239_12029853 3300010375 Unclassified 668
174 Ga0105246_10036853 3300011119 Bacteria 3279
175 Ga0105246_10374143 3300011119 Bacteria 1175
176 Ga0105246_10552395 3300011119 Bacteria 987
177 Ga0105246_10750655 3300011119 Bacteria 861
178 Ga0105246_10957966 3300011119 Unclassified 772
179 Ga0157329_1004723 3300012491 Bacteria 894
180 Ga0157371_10044308 3300013102 Bacteria 3168
181 Ga0157371_10217498 3300013102 Unclassified 1372
182 Ga0157370_10100994 3300013104 Bacteria 2702
183 Ga0157370_10376480 3300013104 Bacteria 1308
184 Ga0157369_10016117 3300013105 Bacteria 8410
185 Ga0157369_10794781 3300013105 Bacteria 972
186 Ga0157374_10095604 3300013296 Bacteria 2841
187 Ga0157374_10856229 3300013296 Unclassified 926
188 Ga0157378_10245365 3300013297 Bacteria 1713
189 Ga0157378_12447780 3300013297 Unclassified 574
190 Ga0163162_10180489 3300013306 Bacteria 2237
191 Ga0163162_10189948 3300013306 Bacteria 2181
192 Ga0163162_10326316 3300013306 Bacteria 1667
193 Ga0163162_10836552 3300013306 Bacteria 1036
194 Ga0163162_11343077 3300013306 Bacteria 813
195 Ga0157372_10099371 3300013307 Bacteria 3319
196 Ga0157372_10162499 3300013307 Bacteria 2581
197 Ga0157375_10013904 3300013308 Bacteria 7176
198 Ga0157375_10038938 3300013308 Bacteria 4570
199 Ga0157375_10159609 3300013308 Bacteria 2396
200 Ga0157375_10297522 3300013308 Bacteria 1777
201 Ga0157375_10365265 3300013308 Bacteria 1610
202 Ga0157375_11989536 3300013308 Unclassified 691
203 Ga0163163_10084205 3300014325 Bacteria 3185
204 Ga0163163_10228670 3300014325 Bacteria 1909
205 Ga0163163_10294470 3300014325 Bacteria 1675
206 Ga0163163_10986410 3300014325 Unclassified 906
207 Ga0163163_11581904 3300014325 Unclassified 716
208 Ga0163163_11749210 3300014325 Bacteria 682
209 Ga0157380_10010228 3300014326 Bacteria 6741
210 Ga0157377_10030839 3300014745 Bacteria 2908
211 Ga0157377_10240070 3300014745 Bacteria 1169
212 Ga0157379_10083711 3300014968 Bacteria 2859
213 Ga0157379_10171881 3300014968 Bacteria 1956
214 Ga0157379_11677674 3300014968 Unclassified 622
215 Ga0157379_11704473 3300014968 Archaea 617
216 Ga0157376_10011206 3300014969 Bacteria 6598
217 Ga0157376_10167849 3300014969 Bacteria 1996
218 Ga0157376_10301632 3300014969 Bacteria 1517
219 Ga0157376_10546792 3300014969 Bacteria 1145
220 Ga0163161_10147792 3300017792 Bacteria 1784
221 Ga0163161_10228436 3300017792 Bacteria 1444
222 Ga0206356_11693033 3300020070 Unclassified 837
223 Ga0206354_10362422 3300020081 Unclassified 1338
224 Ga0206353_10603437 3300020082 Bacteria 1161
225 Ga0206353_11623298 3300020082 Bacteria 3638
226 Ga0207692_10981387 3300025898 Unclassified 557
227 Ga0207688_10000697 3300025901 Bacteria 16570
228 Ga0207688_10029210 3300025901 Bacteria 3034
229 Ga0207645_10105960 3300025907 Bacteria 1817
230 Ga0207643_10054593 3300025908 Bacteria 2271
231 Ga0207643_10532213 3300025908 Bacteria 753
232 Ga0207643_10701298 3300025908 Bacteria 654
233 Ga0207707_10145666 3300025912 Bacteria 2071
234 Ga0207707_10382612 3300025912 Bacteria 1209
235 Ga0207671_10073338 3300025914 Bacteria 2556
236 Ga0207693_10033657 3300025915 Bacteria 4043
237 Ga0207693_10486107 3300025915 Bacteria 964
238 Ga0207660_10186515 3300025917 Bacteria 1613
239 Ga0207660_10221769 3300025917 Bacteria 1484
240 Ga0207660_11026235 3300025917 Bacteria 672
241 Ga0207662_10232156 3300025918 Unclassified 1205
242 Ga0207657_10042879 3300025919 Bacteria 3989
243 Ga0207657_10088151 3300025919 Bacteria 2594
244 Ga0207657_10192302 3300025919 Bacteria 1645
245 Ga0207649_10125525 3300025920 Bacteria 1736
246 Ga0207649_10342220 3300025920 Bacteria 1105
247 Ga0207652_10141423 3300025921 Bacteria 2152
248 Ga0207652_10191762 3300025921 Bacteria 1838
249 Ga0207652_10425599 3300025921 Bacteria 1197
250 Ga0207646_10563216 3300025922 Bacteria 1024
251 Ga0207694_10155506 3300025924 Unclassified 1844
252 Ga0207694_10261927 3300025924 Bacteria 1416
253 Ga0207659_10255227 3300025926 Unclassified 1424
254 Ga0207659_10340279 3300025926 Bacteria 1242
255 Ga0207687_10115850 3300025927 Bacteria 1997
256 Ga0207687_10390077 3300025927 Bacteria 1143
257 Ga0207664_10042140 3300025929 Bacteria 3562
258 Ga0207664_10197913 3300025929 Bacteria 1733
259 Ga0207644_10190413 3300025931 Unclassified 1613
260 Ga0207690_10020153 3300025932 Bacteria 4116
261 Ga0207690_10264683 3300025932 Unclassified 1333
262 Ga0207706_10002450 3300025933 Bacteria 18110
263 Ga0207706_10221577 3300025933 Bacteria 1656
264 Ga0207706_10279694 3300025933 Bacteria 1455
265 Ga0207709_10371238 3300025935 Bacteria 1086
266 Ga0207709_10412076 3300025935 Bacteria 1036
267 Ga0207669_10037949 3300025937 Bacteria 2770
268 Ga0207704_10408543 3300025938 Bacteria 1073
269 Ga0207691_10012079 3300025940 Bacteria 8282
270 Ga0207691_10019735 3300025940 Bacteria 6373
271 Ga0207691_10088434 3300025940 Bacteria 2778
272 Ga0207691_10669623 3300025940 Bacteria 876
273 Ga0207691_10742833 3300025940 Bacteria 826
274 Ga0207711_10065890 3300025941 Bacteria 3132
275 Ga0207711_10490907 3300025941 Bacteria 1144
276 Ga0207711_10613455 3300025941 Bacteria 1015
277 Ga0207689_10020494 3300025942 Bacteria 5563
278 Ga0207689_10046823 3300025942 Bacteria 3573
279 Ga0207661_10067773 3300025944 Bacteria 2903
280 Ga0207661_10112700 3300025944 Bacteria 2303
281 Ga0207661_10146666 3300025944 Bacteria 2036
282 Ga0207679_10094044 3300025945 Bacteria 2326
283 Ga0207667_10091186 3300025949 Bacteria 3148
284 Ga0207667_10291447 3300025949 Bacteria 1667
285 Ga0207667_11812434 3300025949 Bacteria 574
286 Ga0207651_10010208 3300025960 Bacteria 5192
287 Ga0207651_10200222 3300025960 Bacteria 1600
288 Ga0207712_10119996 3300025961 Bacteria 1988
289 Ga0207712_10634852 3300025961 Bacteria 927
290 Ga0207668_10699679 3300025972 Unclassified 891
291 Ga0207640_10078264 3300025981 Bacteria 2250
292 Ga0207640_10137105 3300025981 Bacteria 1778
293 Ga0207640_10362184 3300025981 Bacteria 1169
294 Ga0207658_10134689 3300025986 Bacteria 1990
295 Ga0207658_10598803 3300025986 Bacteria 990
296 Ga0207658_10874066 3300025986 Unclassified 818
297 Ga0207677_10069176 3300026023 Bacteria 2482
298 Ga0207677_10085280 3300026023 Bacteria 2279
299 Ga0207677_10240759 3300026023 Bacteria 1464
300 Ga0207703_10321215 3300026035 Bacteria 1418
301 Ga0207703_10916619 3300026035 Bacteria 839
302 Ga0207639_10114479 3300026041 Bacteria 2204
303 Ga0207678_10006346 3300026067 Bacteria 10498
304 Ga0207678_10014451 3300026067 Bacteria 6942
305 Ga0207708_10005715 3300026075 Bacteria 9195
306 Ga0207708_10015653 3300026075 Bacteria 5690
307 Ga0207708_10179760 3300026075 Bacteria 1679
308 Ga0207702_10200232 3300026078 Bacteria 1850
309 Ga0207641_10180175 3300026088 Bacteria 1935
310 Ga0207641_10835126 3300026088 Unclassified 913
311 Ga0207648_10252805 3300026089 Bacteria 1571
312 Ga0207648_10418835 3300026089 Bacteria 1216
313 Ga0207676_10110277 3300026095 Bacteria 2301
314 Ga0207676_10911163 3300026095 Unclassified 863
315 Ga0207674_10108559 3300026116 Bacteria 2751
316 Ga0207674_10153230 3300026116 Bacteria 2261
317 Ga0207675_100550839 3300026118 Bacteria 1152
318 Ga0207683_10020655 3300026121 Bacteria 5636
319 Ga0207683_10021066 3300026121 Bacteria 5579
320 Ga0207683_10043844 3300026121 Bacteria 3909
321 Ga0207683_10220979 3300026121 Unclassified 1726
322 Ga0207683_10652580 3300026121 Bacteria 975
323 Ga0207698_10065334 3300026142 Bacteria 2857
324 Ga0207698_11226807 3300026142 Unclassified 764
325 Ga0207428_10041156 3300027907 Bacteria 3743
326 Ga0268266_10518263 3300028379 Bacteria 1140
327 Ga0268264_11752828 3300028381 Unclassified 631
328 Ga0265319_1038159 3300028563 Bacteria 1634
329 Ga0265334_10013765 3300028573 Bacteria 3381
330 Ga0265318_10007332 3300028577 Bacteria 4993
331 Ga0265318_10041276 3300028577 Bacteria 1754
332 Ga0265336_10024539 3300028666 Bacteria 1904
333 Ga0265338_10107605 3300028800 Bacteria 2254
334 Ga0265330_10051924 3300031235 Bacteria 1797
335 Ga0265320_10014781 3300031240 Bacteria 4428
336 Ga0265339_10001741 3300031249 Bacteria 16033
337 Ga0265316_10176470 3300031344 Bacteria 1592
338 Ga0265314_10029541 3300031711 Bacteria 4072
339 Ga0307412_10123364 3300031911 Archaea 1869
340 Ga0307415_100525456 3300032126 Archaea 1039
341 Ga0373948_0046040 3300034817 Bacteria 926
342 Ga0373959_0129255 3300034820 Bacteria 624
343 Ga0373929_0004932 3300035085 Bacteria 2393
344 Ga0373952_0012098 3300035092 Unclassified 1693
345 Ga0373960_0006236 3300035121 Bacteria 2791
346 Ga0373943_0137516 3300035170 Bacteria 1313
347 Ga0373946_0238734 3300035171 Bacteria 883
348 Ga0373961_0064543 3300035241 Bacteria 1119
349 Ga0373962_0023792 3300035242 Bacteria 1634
350 Ga0373935_0043343 3300035692 Bacteria 2831
351 Ga0373927_0101558 3300035695 Unclassified 1871
352 Ga0373947_0023881 3300035725 Bacteria 3559
353 Ga0373947_0029280 3300035725 Bacteria 3231
354 Ga0395900_0855671 3300037418 Bacteria 835
355 Ga0395901_0042050 3300038443 Bacteria 4737
356 Ga0395901_0627222 3300038443 Bacteria 1081
357 Ga0436365_1668866 3300039437 Archaea 977
358 Ga0451853_0816463 3300041512 Unclassified 619
359 Ga0451853_2240055 3300041512 Bacteria 2972
360 Ga0451853_2411647 3300041512 Bacteria 1189
361 Ga0466963_0080638 3300044694 Bacteria 2203
362 Ga0466967_0500158 3300045976 Unclassified 1193
363 Ga0495592_0123916 3300046454 Bacteria 1815
364 Ga0495603_0005148 3300046455 Bacteria 7809
365 Ga0495603_0035733 3300046455 Bacteria 2984
366 Ga0495603_0538664 3300046455 Bacteria 669
367 Ga0495629_0018250 3300046459 Bacteria 5024
368 Ga0495629_0098394 3300046459 Bacteria 2041
369 Ga0495641_0013797 3300046461 Bacteria 4411
370 Ga0495641_0028358 3300046461 Unclassified 2710
371 Ga0495641_0401755 3300046461 Bacteria 622
372 Ga0495651_0042943 3300046462 Unclassified 3508
373 Ga0495653_0111135 3300046463 Unclassified 1969
374 Ga0495653_0143660 3300046463 Bacteria 1675
375 Ga0495653_0252776 3300046463 Bacteria 1169
376 Ga0495653_0447683 3300046463 Bacteria 813
377 Ga0495580_0693952 3300046472 Unclassified 667
378 Ga0495582_0090177 3300046473 Bacteria 1709
379 Ga0495582_0687585 3300046473 Bacteria 592
380 Ga0495662_0055107 3300046476 Bacteria 1921
381 Ga0495664_0103288 3300046477 Bacteria 1718
382 Ga0495664_0192861 3300046477 Bacteria 1235
383 Ga0495594_0206320 3300046499 Bacteria 1120
384 Ga0495608_0002597 3300046511 Bacteria 12984
385 Ga0495608_0060213 3300046511 Bacteria 2499
386 Ga0495608_0062906 3300046511 Bacteria 2437
387 Ga0495608_0242387 3300046511 Bacteria 1126
388 Ga0495616_0107614 3300046513 Unclassified 1299
389 Ga0495618_0020118 3300046514 Bacteria 4109
390 Ga0495618_0021613 3300046514 Unclassified 3967
391 Ga0495618_0026482 3300046514 Bacteria 3606
392 Ga0495628_0044393 3300046516 Bacteria 3537
393 Ga0495628_0106706 3300046516 Unclassified 2157
394 Ga0495630_0050967 3300046517 Bacteria 3097
395 Ga0495630_0142014 3300046517 Bacteria 1826
396 Ga0495630_0225334 3300046517 Bacteria 1432
397 Ga0495630_0279794 3300046517 Bacteria 1275
398 Ga0495630_0656003 3300046517 Bacteria 803
399 Ga0495631_0116398 3300046518 Bacteria 1149
400 Ga0495652_0041249 3300046529 Bacteria 3985
401 Ga0495652_0061874 3300046529 Bacteria 3159
402 Ga0495652_0106269 3300046529 Unclassified 2267
403 Ga0495665_0095078 3300046531 Bacteria 1565
404 Ga0495665_0185315 3300046531 Bacteria 1081
405 Ga0495640_0016585 3300046533 Bacteria 5507
406 Ga0495586_0046211 3300046535 Bacteria 2347
407 Ga0495586_0067648 3300046535 Bacteria 1948
408 Ga0495586_0244443 3300046535 Bacteria 1023
409 Ga0495586_0274377 3300046535 Bacteria 964
410 Ga0495587_0064625 3300046536 Unclassified 2138
411 Ga0495645_0049653 3300046543 Bacteria 3055
412 Ga0495645_0300699 3300046543 Unclassified 1048
413 Ga0495645_0378619 3300046543 Unclassified 906
414 Ga0495622_0435100 3300046557 Unclassified 563
415 Ga0495633_0184467 3300046558 Unclassified 960
416 Ga0495667_0009991 3300046559 Bacteria 6426
417 Ga0495667_0085653 3300046559 Bacteria 2045
418 Ga0495667_0102605 3300046559 Bacteria 1850
419 Ga0495667_0190514 3300046559 Bacteria 1314
420 Ga0495656_0061700 3300046615 Bacteria 1638
421 Ga0495634_0056766 3300046642 Bacteria 2615
422 Ga0495634_0160382 3300046642 Bacteria 1418
423 Ga0495634_0358722 3300046642 Bacteria 872
424 Ga0495635_0052074 3300046663 Unclassified 2820
425 Ga0495635_0086362 3300046663 Bacteria 2147
426 Ga0495635_0163323 3300046663 Bacteria 1515
427 Ga0495635_0301565 3300046663 Bacteria 1074
428 Ga0495588_0090905 3300046674 Bacteria 1599
429 Ga0495657_0126381 3300046675 Bacteria 1606
430 Ga0495657_0133528 3300046675 Unclassified 1553
431 Ga0495657_0156848 3300046675 Bacteria 1410
432 Ga0495657_0163726 3300046675 Bacteria 1374
433 Ga0495599_0064546 3300046678 Bacteria 2287
434 Ga0495599_0183940 3300046678 Bacteria 1287
435 Ga0495599_0198767 3300046678 Bacteria 1232
436 Ga0495646_0094277 3300046680 Bacteria 1724
437 Ga0495647_0004720 3300046681 Bacteria 4446
438 Ga0495647_0135352 3300046681 Unclassified 1047
439 Ga0495658_0080520 3300046683 Bacteria 1910
440 Ga0495658_0798425 3300046683 Unclassified 604
441 Ga0495613_0045595 3300046689 Bacteria 3242
442 Ga0495613_0220538 3300046689 Bacteria 1331
443 Ga0495670_0393043 3300046691 Unclassified 749
444 Ga0495589_0048980 3300046794 Bacteria 2091
445 Ga0495589_0106144 3300046794 Bacteria 1357
446 Ga0495600_0146761 3300046809 Unclassified 1529
447 Ga0495600_0272018 3300046809 Bacteria 1074
448 Ga0495604_0183299 3300047317 Bacteria 1463
449 Ga0495604_0314106 3300047317 Bacteria 1049
450 Ga0495674_0000208 3300047319 Bacteria 48267
451 Ga0495674_0287005 3300047319 Bacteria 1347
452 Ga0495674_0459281 3300047319 Bacteria 1022
453 Ga0495676_0467931 3300047321 Bacteria 830
454 Ga0495680_0000298 3300047322 Bacteria 55499
455 Ga0495680_0002884 3300047322 Bacteria 17280
456 Ga0495680_0040803 3300047322 Bacteria 3695
457 Ga0495680_0074051 3300047322 Bacteria 2587
458 Ga0495680_0645601 3300047322 Unclassified 704
459 Ga0495675_0211228 3300047444 Bacteria 1178
460 Ga0495675_0339361 3300047444 Bacteria 886
461 Ga0495684_0018466 3300047471 Bacteria 5373
462 Ga0495684_0063770 3300047471 Unclassified 2801
463 Ga0495593_0263121 3300047673 Bacteria 863
464 Ga0495593_0310899 3300047673 Bacteria 788
465 Ga0495602_0160179 3300048088 Bacteria 1758
466 Ga0495602_0300739 3300048088 Unclassified 1174
467 Ga0495614_0121043 3300048089 Bacteria 1154
468 Ga0496100_0015252 3300048903 Bacteria 4484
469 Ga0496100_0068528 3300048903 Bacteria 2360
470 Ga0496100_0090669 3300048903 Bacteria 2085
471 Ga0496100_1165524 3300048903 Unclassified 608
472 Ga0496101_0072614 3300048904 Bacteria 2526
473 Ga0496101_0273092 3300048904 Bacteria 1320
474 Ga0496101_0355321 3300048904 Bacteria 1152
475 Ga0496101_0639948 3300048904 Bacteria 840
476 Ga0496102_0320713 3300048905 Bacteria 1460
477 Ga0496102_0339118 3300048905 Bacteria 1416
478 Ga0496103_0085821 3300048906 Bacteria 1984
479 Ga0496103_0163821 3300048906 Bacteria 1427
480 Ga0496103_0537872 3300048906 Bacteria 746
481 Ga0496104_0003247 3300048907 Bacteria 14012
482 Ga0496104_0106991 3300048907 Bacteria 2680
483 Ga0496104_0124874 3300048907 Bacteria 2471
484 Ga0496104_0194802 3300048907 Bacteria 1939
485 Ga0496104_0269610 3300048907 Bacteria 1615
486 Ga0496105_0008919 3300048908 Bacteria 7819
487 Ga0496105_0041913 3300048908 Bacteria 3773
488 Ga0496105_0062471 3300048908 Bacteria 3074
489 Ga0496105_0576631 3300048908 Bacteria 876
490 Ga0496105_0749922 3300048908 Bacteria 746
491 Ga0496106_0042148 3300048909 Bacteria 3423
492 Ga0496106_0523537 3300048909 Bacteria 952
493 Ga0496106_0796852 3300048909 Bacteria 749
494 Ga0496107_0299868 3300048910 Bacteria 1196
495 Ga0496107_0432113 3300048910 Unclassified 979
496 Ga0496108_0025528 3300048911 Bacteria 4870
497 Ga0496108_0039481 3300048911 Bacteria 3934
498 Ga0496108_0071872 3300048911 Bacteria 2920
499 Ga0496108_0215058 3300048911 Bacteria 1669
500 Ga0496108_0666046 3300048911 Bacteria 904
501 Ga0496109_0056122 3300048912 Unclassified 3594
502 Ga0496109_0091535 3300048912 Bacteria 2813
503 Ga0496109_0139601 3300048912 Bacteria 2266
504 Ga0496109_0157273 3300048912 Bacteria 2129
505 Ga0496110_0088938 3300048913 Bacteria 2759
506 Ga0496110_0744231 3300048913 Unclassified 883
507 Ga0496110_1397895 3300048913 Bacteria 609
508 Ga0496111_0053424 3300048914 Bacteria 2919
509 Ga0496111_0108704 3300048914 Bacteria 2042
510 Ga0496111_0115346 3300048914 Bacteria 1980
511 Ga0496111_0160692 3300048914 Bacteria 1668
512 Ga0496111_0571143 3300048914 Unclassified 829
513 Ga0496111_0812356 3300048914 Unclassified 676
514 Ga0496112_0117487 3300048915 Bacteria 2630
515 Ga0496112_0406193 3300048915 Unclassified 1301
516 Ga0496113_0134649 3300048916 Bacteria 1941
517 Ga0496113_0137329 3300048916 Bacteria 1922
518 Ga0496113_0538399 3300048916 Unclassified 937
519 Ga0496114_0010544 3300048917 Bacteria 7353
520 Ga0496114_0024597 3300048917 Bacteria 4917
521 Ga0496114_0122982 3300048917 Bacteria 2233
522 Ga0496114_0251517 3300048917 Bacteria 1555
523 Ga0496114_0489007 3300048917 Bacteria 1089
524 Ga0496115_0480831 3300048918 Bacteria 1000
525 Ga0496115_1022198 3300048918 Bacteria 631
526 Ga0501040_0310941 3300049576 Bacteria 1127
527 Ga0501067_0048288 3300049583 Bacteria 2360
528 Ga0501068_0756984 3300049584 Bacteria 636
529 Ga0501069_0059190 3300049585 Bacteria 2138
530 Ga0501069_0235721 3300049585 Bacteria 1066
531 Ga0501069_0304296 3300049585 Unclassified 935
532 Ga0501072_0555310 3300049588 Unclassified 907
533 Ga0501079_0207340 3300049741 Bacteria 1531
534 Ga0501081_0240839 3300049743 Bacteria 1319
535 Ga0501045_0274644 3300049824 Bacteria 1255
536 nmdc:mga05p37_420119_c1 3300050507 Bacteria 1556
537 nmdc:mga08y16_17248_c1 3300050511 Bacteria 7601
538 nmdc:mga0rr50_19457_c1 3300050513 Bacteria 4583
539 nmdc:mga08x19_122747_c1 3300050514 Bacteria 1742
540 nmdc:mga0a205_460909_c1 3300050515 Unclassified 1130
541 nmdc:mga0a205_563239_c1 3300050515 Bacteria 994
542 Ga0495601_0007888 3300053077 Bacteria 6271
543 Ga0495601_0094832 3300053077 Bacteria 1924
544 Ga0495612_0188734 3300053078 Bacteria 907
545 Ga0495595_0021265 3300053084 Bacteria 2833
546 Ga0495595_0061880 3300053084 Bacteria 1754
547 Ga0495595_0070228 3300053084 Bacteria 1654
548 Ga0495595_0209076 3300053084 Bacteria 972
549 Ga0495619_0010357 3300053085 Bacteria 5870
550 Ga0495619_0074018 3300053085 Unclassified 2283
551 Ga0495619_0079906 3300053085 Bacteria 2200
552 Ga0495619_0161659 3300053085 Bacteria 1547
553 Ga0501084_0033305 3300054114 Bacteria 4311
554 Ga0501082_0206248 3300060353 Bacteria 1710
555 Ga0530510_0509112 3300061734 Bacteria 913
556 Ga0207687_10770458
557 Ga0065704_10111544
558 Ga0070683_100075852
559 Ga0070683_100431597
560 Ga0070677_10117416
561 Ga0068869_100035231
562 Ga0070666_10558910
563 Ga0070680_100004240
564 Ga0070680_100032110
565 Ga0070680_100191649
566 Ga0070682_100015060
567 Ga0070682_100104420
568 Ga0070682_100831500
569 Ga0070682_101000876
570 Ga0068868_100028582
571 Ga0070660_100029046
572 Ga0070660_100097266
573 Ga0070660_100310196
574 Ga0070687_100148560
575 Ga0070661_100229769
576 Ga0070661_101005976
577 Ga0070692_10001475
578 Ga0070692_10034994
579 Ga0070668_100169883
580 Ga0070668_101134225
581 Ga0070675_100074098
582 Ga0070675_100130847
583 Ga0070675_100381238
584 Ga0070675_101362982
585 Ga0070671_100118985
586 Ga0070674_100006039
587 Ga0070674_100101570
588 Ga0070674_100401011
589 Ga0070674_101592813
590 Ga0070673_100029852
591 Ga0070673_100424325
592 Ga0070659_100005610
593 Ga0070659_101281557
594 Ga0070667_100206184
595 Ga0070667_100217949
596 Ga0070667_100257953
597 Ga0070714_100014289
598 Ga0070714_100060436
599 Ga0070714_100340401
600 Ga0070714_100519126
601 Ga0070713_100268203
602 Ga0070713_100548290
603 Ga0070701_10003144
604 Ga0070700_100116152
605 Ga0070700_100166139
606 Ga0070694_100106885
607 Ga0070694_100243396
608 Ga0070663_100064075
609 Ga0070663_100405180
610 Ga0070663_100433925
611 Ga0070662_100002830
612 Ga0070662_101222263
613 Ga0070681_10183708
614 Ga0070681_10591450
615 Ga0068867_100046254
616 Ga0070685_10012413
617 Ga0070685_10039588
618 Ga0070707_100332521
619 Ga0070698_100068034
620 Ga0070698_100191490
621 Ga0070679_100031492
622 Ga0070679_100099824
623 Ga0070679_100608435
624 Ga0070684_100034111
625 Ga0070684_100317172
626 Ga0070684_100474505
627 Ga0070684_100632775
628 Ga0070697_100061289
629 Ga0070697_100513329
630 Ga0068853_100012064
631 Ga0068853_100325509
632 Ga0070672_100013410
633 Ga0070672_100014217
634 Ga0070672_100195591
635 Ga0070686_100011858
636 Ga0070686_100069143
637 Ga0070686_100218865
638 Ga0070696_100215411
639 Ga0070696_100332894
640 Ga0070693_100031569
641 Ga0070693_100152566
642 Ga0070693_100673204
643 Ga0070665_100026962
644 Ga0070665_101066663
645 Ga0070665_101268913
646 Ga0068855_100046644
647 Ga0068855_100404871
648 Ga0068855_101326569
649 Ga0070664_100027397
650 Ga0070664_100190857
651 Ga0070664_100923822
652 Ga0068857_100033718
653 Ga0068857_100559053
654 Ga0068857_100712893
655 Ga0068856_100123558
656 Ga0068856_100584829
657 Ga0070702_100049593
658 Ga0070702_100071134
659 Ga0068852_100003178
660 Ga0068852_100006006
661 Ga0068852_100007390
662 Ga0068859_100977508
663 Ga0068864_101205095
664 Ga0068866_10109893
665 Ga0068861_100041282
666 Ga0068861_100164236
667 Ga0068861_101361174
668 Ga0068851_10102686
669 Ga0068851_10131559
670 Ga0068870_10034416
671 Ga0068870_10965701
672 Ga0068863_100155746
673 Ga0068863_101537696
674 Ga0068858_100138853
675 Ga0068858_100352316
676 Ga0068860_100028272
677 Ga0068860_101911374
678 Ga0070717_10028126
679 Ga0070717_10059402
680 Ga0070717_10254069
681 Ga0070717_10299262
682 Ga0070712_100037161
683 Ga0070712_100269582
684 Ga0070712_100446076
685 Ga0070712_100666406
686 Ga0070712_101627834
687 Ga0097621_100252836
688 Ga0068871_100191152
689 Ga0068871_100760517
690 Ga0075428_100271740
691 Ga0075433_10097635
692 Ga0075433_10653632
693 Ga0075434_100215737
694 Ga0075434_100289085
695 Ga0075434_100374012
696 Ga0075429_100808836
697 Ga0068865_100107319
698 Ga0068865_100565280
699 Ga0097620_100977646
700 Ga0075435_100167462
701 Ga0075435_100964410
702 Ga0105240_10283128
703 Ga0111539_10041629
704 Ga0111539_11763938
705 Ga0105245_10032271
706 Ga0105245_10423774
707 Ga0105245_10619513
708 Ga0105245_10866720
709 Ga0114129_10064943
710 Ga0105243_10006839
711 Ga0105243_10027681
712 Ga0105242_10009376
713 Ga0105242_10041915
714 Ga0105248_10095539
715 Ga0105248_10322382
716 Ga0105248_10407418
717 Ga0105248_10620295
718 Ga0105237_10107981
719 Ga0105237_11454720
720 Ga0105238_10015628
721 Ga0105238_10140030
722 Ga0105238_10613778
723 Ga0105238_10951982
724 Ga0105249_10262697
725 Ga0105239_10058537
726 Ga0105239_10216828
727 Ga0105239_10234396
728 Ga0105239_12029853
729 Ga0105246_10036853
730 Ga0105246_10374143
731 Ga0105246_10552395
732 Ga0105246_10750655
733 Ga0105246_10957966
734 Ga0157329_1004723
735 Ga0157371_10044308
736 Ga0157371_10217498
737 Ga0157370_10100994
738 Ga0157370_10376480
739 Ga0157369_10016117
740 Ga0157369_10794781
741 Ga0157374_10095604
742 Ga0157374_10856229
743 Ga0157378_10245365
744 Ga0157378_12447780
745 Ga0163162_10180489
746 Ga0163162_10189948
747 Ga0163162_10326316
748 Ga0163162_10836552
749 Ga0163162_11343077
750 Ga0157372_10099371
751 Ga0157372_10162499
752 Ga0157375_10013904
753 Ga0157375_10038938
754 Ga0157375_10159609
755 Ga0157375_10297522
756 Ga0157375_10365265
757 Ga0157375_11989536
758 Ga0163163_10084205
759 Ga0163163_10228670
760 Ga0163163_10294470
761 Ga0163163_10986410
762 Ga0163163_11581904
763 Ga0163163_11749210
764 Ga0157380_10010228
765 Ga0157377_10030839
766 Ga0157377_10240070
767 Ga0157379_10083711
768 Ga0157379_10171881
769 Ga0157379_11677674
770 Ga0157379_11704473
771 Ga0157376_10011206
772 Ga0157376_10167849
773 Ga0157376_10301632
774 Ga0157376_10546792
775 Ga0163161_10147792
776 Ga0163161_10228436
777 Ga0206356_11693033
778 Ga0206354_10362422
779 Ga0206353_10603437
780 Ga0206353_11623298
781 Ga0207692_10981387
782 Ga0207688_10000697
783 Ga0207688_10029210
784 Ga0207645_10105960
785 Ga0207643_10054593
786 Ga0207643_10532213
787 Ga0207643_10701298
788 Ga0207707_10145666
789 Ga0207707_10382612
790 Ga0207671_10073338
791 Ga0207693_10033657
792 Ga0207693_10486107
793 Ga0207660_10186515
794 Ga0207660_10221769
795 Ga0207660_11026235
796 Ga0207662_10232156
797 Ga0207657_10042879
798 Ga0207657_10088151
799 Ga0207657_10192302
800 Ga0207649_10125525
801 Ga0207649_10342220
802 Ga0207652_10141423
803 Ga0207652_10191762
804 Ga0207652_10425599
805 Ga0207646_10563216
806 Ga0207694_10155506
807 Ga0207694_10261927
808 Ga0207659_10255227
809 Ga0207659_10340279
810 Ga0207687_10115850
811 Ga0207687_10390077
812 Ga0207664_10042140
813 Ga0207664_10197913
814 Ga0207644_10190413
815 Ga0207690_10020153
816 Ga0207690_10264683
817 Ga0207706_10002450
818 Ga0207706_10221577
819 Ga0207706_10279694
820 Ga0207709_10371238
821 Ga0207709_10412076
822 Ga0207669_10037949
823 Ga0207704_10408543
824 Ga0207691_10012079
825 Ga0207691_10019735
826 Ga0207691_10088434
827 Ga0207691_10669623
828 Ga0207691_10742833
829 Ga0207711_10065890
830 Ga0207711_10490907
831 Ga0207711_10613455
832 Ga0207689_10020494
833 Ga0207689_10046823
834 Ga0207661_10067773
835 Ga0207661_10112700
836 Ga0207661_10146666
837 Ga0207679_10094044
838 Ga0207667_10091186
839 Ga0207667_10291447
840 Ga0207667_11812434
841 Ga0207651_10010208
842 Ga0207651_10200222
843 Ga0207712_10119996
844 Ga0207712_10634852
845 Ga0207668_10699679
846 Ga0207640_10078264
847 Ga0207640_10137105
848 Ga0207640_10362184
849 Ga0207658_10134689
850 Ga0207658_10598803
851 Ga0207658_10874066
852 Ga0207677_10069176
853 Ga0207677_10085280
854 Ga0207677_10240759
855 Ga0207703_10321215
856 Ga0207703_10916619
857 Ga0207639_10114479
858 Ga0207678_10006346
859 Ga0207678_10014451
860 Ga0207708_10005715
861 Ga0207708_10015653
862 Ga0207708_10179760
863 Ga0207702_10200232
864 Ga0207641_10180175
865 Ga0207641_10835126
866 Ga0207648_10252805
867 Ga0207648_10418835
868 Ga0207676_10110277
869 Ga0207676_10911163
870 Ga0207674_10108559
871 Ga0207674_10153230
872 Ga0207675_100550839
873 Ga0207683_10020655
874 Ga0207683_10021066
875 Ga0207683_10043844
876 Ga0207683_10220979
877 Ga0207683_10652580
878 Ga0207698_10065334
879 Ga0207698_11226807
880 Ga0207428_10041156
881 Ga0268266_10518263
882 Ga0268264_11752828
883 Ga0265319_1038159
884 Ga0265334_10013765
885 Ga0265318_10007332
886 Ga0265318_10041276
887 Ga0265336_10024539
888 Ga0265338_10107605
889 Ga0265330_10051924
890 Ga0265320_10014781
891 Ga0265339_10001741
892 Ga0265316_10176470
893 Ga0265314_10029541
894 Ga0307412_10123364
895 Ga0307415_100525456
896 Ga0373948_0046040
897 Ga0373959_0129255
898 Ga0373929_0004932
899 Ga0373952_0012098
900 Ga0373960_0006236
901 Ga0373943_0137516
902 Ga0373946_0238734
903 Ga0373961_0064543
904 Ga0373962_0023792
905 Ga0373935_0043343
906 Ga0373927_0101558
907 Ga0373947_0023881
908 Ga0373947_0029280
909 Ga0395900_0855671
910 Ga0395901_0042050
911 Ga0395901_0627222
912 Ga0436365_1668866
913 Ga0451853_0816463
914 Ga0451853_2240055
915 Ga0451853_2411647
916 Ga0466963_0080638
917 Ga0466967_0500158
918 Ga0495592_0123916
919 Ga0495603_0005148
920 Ga0495603_0035733
921 Ga0495603_0538664
922 Ga0495629_0018250
923 Ga0495629_0098394
924 Ga0495641_0013797
925 Ga0495641_0028358
926 Ga0495641_0401755
927 Ga0495651_0042943
928 Ga0495653_0111135
929 Ga0495653_0143660
930 Ga0495653_0252776
931 Ga0495653_0447683
932 Ga0495580_0693952
933 Ga0495582_0090177
934 Ga0495582_0687585
935 Ga0495662_0055107
936 Ga0495664_0103288
937 Ga0495664_0192861
938 Ga0495594_0206320
939 Ga0495608_0002597
940 Ga0495608_0060213
941 Ga0495608_0062906
942 Ga0495608_0242387
943 Ga0495616_0107614
944 Ga0495618_0020118
945 Ga0495618_0021613
946 Ga0495618_0026482
947 Ga0495628_0044393
948 Ga0495628_0106706
949 Ga0495630_0050967
950 Ga0495630_0142014
951 Ga0495630_0225334
952 Ga0495630_0279794
953 Ga0495630_0656003
954 Ga0495631_0116398
955 Ga0495652_0041249
956 Ga0495652_0061874
957 Ga0495652_0106269
958 Ga0495665_0095078
959 Ga0495665_0185315
960 Ga0495640_0016585
961 Ga0495586_0046211
962 Ga0495586_0067648
963 Ga0495586_0244443
964 Ga0495586_0274377
965 Ga0495587_0064625
966 Ga0495645_0049653
967 Ga0495645_0300699
968 Ga0495645_0378619
969 Ga0495622_0435100
970 Ga0495633_0184467
971 Ga0495667_0009991
972 Ga0495667_0085653
973 Ga0495667_0102605
974 Ga0495667_0190514
975 Ga0495656_0061700
976 Ga0495634_0056766
977 Ga0495634_0160382
978 Ga0495634_0358722
979 Ga0495635_0052074
980 Ga0495635_0086362
981 Ga0495635_0163323
982 Ga0495635_0301565
983 Ga0495588_0090905
984 Ga0495657_0126381
985 Ga0495657_0133528
986 Ga0495657_0156848
987 Ga0495657_0163726
988 Ga0495599_0064546
989 Ga0495599_0183940
990 Ga0495599_0198767
991 Ga0495646_0094277
992 Ga0495647_0004720
993 Ga0495647_0135352
994 Ga0495658_0080520
995 Ga0495658_0798425
996 Ga0495613_0045595
997 Ga0495613_0220538
998 Ga0495670_0393043
999 Ga0495589_0048980
1000 Ga0495589_0106144
1001 Ga0495600_0146761
1002 Ga0495600_0272018
1003 Ga0495604_0183299
1004 Ga0495604_0314106
1005 Ga0495674_0000208
1006 Ga0495674_0287005
1007 Ga0495674_0459281
1008 Ga0495676_0467931
1009 Ga0495680_0000298
1010 Ga0495680_0002884
1011 Ga0495680_0040803
1012 Ga0495680_0074051
1013 Ga0495680_0645601
1014 Ga0495675_0211228
1015 Ga0495675_0339361
1016 Ga0495684_0018466
1017 Ga0495684_0063770
1018 Ga0495593_0263121
1019 Ga0495593_0310899
1020 Ga0495602_0160179
1021 Ga0495602_0300739
1022 Ga0495614_0121043
1023 Ga0496100_0015252
1024 Ga0496100_0068528
1025 Ga0496100_0090669
1026 Ga0496100_1165524
1027 Ga0496101_0072614
1028 Ga0496101_0273092
1029 Ga0496101_0355321
1030 Ga0496101_0639948
1031 Ga0496102_0320713
1032 Ga0496102_0339118
1033 Ga0496103_0085821
1034 Ga0496103_0163821
1035 Ga0496103_0537872
1036 Ga0496104_0003247
1037 Ga0496104_0106991
1038 Ga0496104_0124874
1039 Ga0496104_0194802
1040 Ga0496104_0269610
1041 Ga0496105_0008919
1042 Ga0496105_0041913
1043 Ga0496105_0062471
1044 Ga0496105_0576631
1045 Ga0496105_0749922
1046 Ga0496106_0042148
1047 Ga0496106_0523537
1048 Ga0496106_0796852
1049 Ga0496107_0299868
1050 Ga0496107_0432113
1051 Ga0496108_0025528
1052 Ga0496108_0039481
1053 Ga0496108_0071872
1054 Ga0496108_0215058
1055 Ga0496108_0666046
1056 Ga0496109_0056122
1057 Ga0496109_0091535
1058 Ga0496109_0139601
1059 Ga0496109_0157273
1060 Ga0496110_0088938
1061 Ga0496110_0744231
1062 Ga0496110_1397895
1063 Ga0496111_0053424
1064 Ga0496111_0108704
1065 Ga0496111_0115346
1066 Ga0496111_0160692
1067 Ga0496111_0571143
1068 Ga0496111_0812356
1069 Ga0496112_0117487
1070 Ga0496112_0406193
1071 Ga0496113_0134649
1072 Ga0496113_0137329
1073 Ga0496113_0538399
1074 Ga0496114_0010544
1075 Ga0496114_0024597
1076 Ga0496114_0122982
1077 Ga0496114_0251517
1078 Ga0496114_0489007
1079 Ga0496115_0480831
1080 Ga0496115_1022198
1081 Ga0501040_0310941
1082 Ga0501067_0048288
1083 Ga0501068_0756984
1084 Ga0501069_0059190
1085 Ga0501069_0235721
1086 Ga0501069_0304296
1087 Ga0501072_0555310
1088 Ga0501079_0207340
1089 Ga0501081_0240839
1090 Ga0501045_0274644
1091 nmdc:mga05p37_420119_c1
1092 nmdc:mga08y16_17248_c1
1093 nmdc:mga0rr50_19457_c1
1094 nmdc:mga08x19_122747_c1
1095 nmdc:mga0a205_460909_c1
1096 nmdc:mga0a205_563239_c1
1097 Ga0495601_0007888
1098 Ga0495601_0094832
1099 Ga0495612_0188734
1100 Ga0495595_0021265
1101 Ga0495595_0061880
1102 Ga0495595_0070228
1103 Ga0495595_0209076
1104 Ga0495619_0010357
1105 Ga0495619_0074018
1106 Ga0495619_0079906
1107 Ga0495619_0161659
1108 Ga0501084_0033305
1109 Ga0501082_0206248
1110 Ga0530510_0509112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

33

134

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vba-assembly2.cif.gz_D crystal structure of methanogen 3-isopropylmalate isomerase small subunit 0.9782 2 160
2pkp-assembly1.cif.gz_A crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) 0.9563 1 161
3vba-assembly2.cif.gz_D crystal structure of methanogen 3-isopropylmalate isomerase small subunit 0.9488 2 160
1v7l-assembly1.cif.gz_B structure of 3-isopropylmalate isomerase small subunit from pyrococcus horikoshii 0.9329 1 163
2pkp-assembly1.cif.gz_A crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) 0.9226 1 161
ID Description Score Start End Superfamily
2pkpA01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.957 1 160 3.20.19.10
1v7lB01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9458 1 160 3.20.19.10
2pkpA01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9454 1 160 3.20.19.10
1v7lB01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9343 1 160 3.20.19.10
af_I1KVC1_66_241_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8774 1 164 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A7C6QJL9-F1-model_v4 deleted 0.987 3 142
AF-A0A6A0RAH1-F1-model_v4 3-isopropylmalate dehydratase 0.9869 42 161 GO:0016836
AF-A0A833A9A3-F1-model_v4 deleted 0.986 17 161
AF-A0A101WEU4-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9852 3 161 GO:0003861
GO:0009098
AF-A0A7X2XF48-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.984 2 163 GO:0003861
GO:0009098

Map