F463103

General Info

Members Datasets Scaffolds Average Seq Length
555 254 1110 109

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10796950|Ga0105246_107969502
Length 127
Sequence VYSIAAFGSTTPHQEDAMQLIKAIVRPDKVDDVKDALTAMHVAGMTVSEVRGHGKQKGHTAIYRGKEYQVTLLPKMQIETVVPDEVVDAAVEAIIGAARTGEIGDGRVFVTPVTRSYKIRTGESDTI

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
175 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
176 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 3.06
Rhizosphere 95.5
Stem 0
Stem Tuber 0
Unclassified 21.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10796950 3300011119 Bacteria 838
2 Ga0065704_10163460 3300005289 Bacteria 1338
3 Ga0065704_10732492 3300005289 Bacteria 549
4 Ga0065712_10586129 3300005290 Bacteria 581
5 Ga0065707_10083557 3300005295 Bacteria 8786
6 Ga0065707_10118409 3300005295 Bacteria 2186
7 Ga0065707_10570370 3300005295 Bacteria 705
8 Ga0065707_10733594 3300005295 Bacteria 625
9 Ga0070676_10515548 3300005328 Bacteria 851
10 Ga0070683_100108609 3300005329 Bacteria 2616
11 Ga0070683_100838961 3300005329 Bacteria 881
12 Ga0070690_101167332 3300005330 Bacteria 613
13 Ga0070690_101193577 3300005330 Bacteria 607
14 Ga0070677_10618516 3300005333 Unclassified 602
15 Ga0068869_100078340 3300005334 Bacteria 2461
16 Ga0068869_100245109 3300005334 Bacteria 1429
17 Ga0070666_10028953 3300005335 Bacteria 3638
18 Ga0070666_10225423 3300005335 Bacteria 1323
19 Ga0070666_10628729 3300005335 Unclassified 784
20 Ga0070666_11063782 3300005335 Unclassified 601
21 Ga0070666_11220879 3300005335 Unclassified 560
22 Ga0070682_101125986 3300005337 Bacteria 658
23 Ga0068868_100197718 3300005338 Bacteria 1674
24 Ga0068868_102121758 3300005338 Unclassified 535
25 Ga0070689_100687037 3300005340 Bacteria 893
26 Ga0070689_102188791 3300005340 Bacteria 507
27 Ga0070661_100261954 3300005344 Bacteria 1337
28 Ga0070668_100198377 3300005347 Bacteria 1647
29 Ga0070669_100048519 3300005353 Bacteria 3099
30 Ga0070669_100301199 3300005353 Bacteria 1289
31 Ga0070671_100387968 3300005355 Unclassified 1194
32 Ga0070671_100625910 3300005355 Unclassified 931
33 Ga0070674_100111723 3300005356 Bacteria 2007
34 Ga0070674_100337468 3300005356 Unclassified 1213
35 Ga0070674_100714442 3300005356 Unclassified 858
36 Ga0070674_100746140 3300005356 Unclassified 841
37 Ga0070673_100503180 3300005364 Bacteria 1096
38 Ga0070673_100759909 3300005364 Bacteria 893
39 Ga0070688_100547876 3300005365 Bacteria 879
40 Ga0070667_101038742 3300005367 Unclassified 765
41 Ga0070709_10017380 3300005434 Archaea 4124
42 Ga0070709_10104973 3300005434 Bacteria 1889
43 Ga0070709_10897446 3300005434 Bacteria 701
44 Ga0070713_100059621 3300005436 Bacteria 3188
45 Ga0070713_100112975 3300005436 Archaea 2371
46 Ga0070713_100324724 3300005436 Bacteria 1422
47 Ga0070713_102014778 3300005436 Bacteria 560
48 Ga0070710_10111310 3300005437 Unclassified 1645
49 Ga0070710_10235488 3300005437 Bacteria 1171
50 Ga0070710_10779956 3300005437 Bacteria 681
51 Ga0070710_11147459 3300005437 Unclassified 572
52 Ga0070701_10131207 3300005438 Bacteria 1424
53 Ga0070701_11070864 3300005438 Bacteria 566
54 Ga0070711_100107374 3300005439 Unclassified 2043
55 Ga0070711_100448049 3300005439 Bacteria 1056
56 Ga0070700_100282126 3300005441 Bacteria 1205
57 Ga0070694_100609239 3300005444 Bacteria 880
58 Ga0070708_101166056 3300005445 Bacteria 721
59 Ga0070663_101517625 3300005455 Bacteria 596
60 Ga0070678_100260327 3300005456 Bacteria 1459
61 Ga0068867_100080360 3300005459 Bacteria 2455
62 Ga0068867_100217756 3300005459 Bacteria 1537
63 Ga0068867_100552260 3300005459 Bacteria 998
64 Ga0068867_101999614 3300005459 Bacteria 548
65 Ga0070685_10376814 3300005466 Bacteria 977
66 Ga0070706_100331077 3300005467 Bacteria 1420
67 Ga0070706_100501139 3300005467 Bacteria 1130
68 Ga0070707_100599821 3300005468 Bacteria 1064
69 Ga0070707_100827654 3300005468 Bacteria 890
70 Ga0070707_101597455 3300005468 Unclassified 619
71 Ga0070707_101968761 3300005468 Unclassified 552
72 Ga0070698_101173658 3300005471 Bacteria 717
73 Ga0070699_101529041 3300005518 Bacteria 612
74 Ga0070684_100007368 3300005535 Bacteria 8554
75 Ga0070684_100067502 3300005535 Bacteria 3142
76 Ga0070684_100173494 3300005535 Bacteria 1959
77 Ga0070697_100911321 3300005536 Bacteria 780
78 Ga0068853_100102374 3300005539 Bacteria 2534
79 Ga0070672_100999973 3300005543 Unclassified 741
80 Ga0070686_100081299 3300005544 Bacteria 2146
81 Ga0070686_100094260 3300005544 Unclassified 2009
82 Ga0070686_100239558 3300005544 Bacteria 1320
83 Ga0070686_100440394 3300005544 Bacteria 999
84 Ga0070696_100374636 3300005546 Bacteria 1108
85 Ga0070693_100882969 3300005547 Bacteria 669
86 Ga0070665_100063866 3300005548 Bacteria 3692
87 Ga0070665_100441986 3300005548 Bacteria 1310
88 Ga0070665_100461344 3300005548 Bacteria 1280
89 Ga0070665_100824689 3300005548 Bacteria 941
90 Ga0070665_100950803 3300005548 Bacteria 872
91 Ga0070704_102192522 3300005549 Bacteria 514
92 Ga0070704_102217548 3300005549 Bacteria 511
93 Ga0068855_100620540 3300005563 Bacteria 1164
94 Ga0068855_100831911 3300005563 Bacteria 979
95 Ga0068854_100214109 3300005578 Unclassified 1521
96 Ga0068854_100929552 3300005578 Bacteria 766
97 Ga0068854_101363731 3300005578 Bacteria 640
98 Ga0068854_101727019 3300005578 Unclassified 573
99 Ga0068859_100204614 3300005617 Bacteria 2059
100 Ga0068859_101153790 3300005617 Unclassified 853
101 Ga0068859_101230646 3300005617 Bacteria 825
102 Ga0068859_102334303 3300005617 Bacteria 590
103 Ga0068864_100464819 3300005618 Unclassified 1212
104 Ga0068866_10319535 3300005718 Bacteria 976
105 Ga0068866_10411753 3300005718 Bacteria 875
106 Ga0068866_10686878 3300005718 Bacteria 701
107 Ga0068861_100128333 3300005719 Bacteria 2055
108 Ga0068861_100485146 3300005719 Bacteria 1114
109 Ga0068863_100004473 3300005841 Bacteria 13781
110 Ga0068863_101166152 3300005841 Bacteria 776
111 Ga0068858_100190462 3300005842 Bacteria 1938
112 Ga0068858_100551220 3300005842 Unclassified 1116
113 Ga0068860_100030204 3300005843 Bacteria 5212
114 Ga0068860_100765505 3300005843 Bacteria 978
115 Ga0068860_101450211 3300005843 Bacteria 708
116 Ga0068860_102671673 3300005843 Unclassified 518
117 Ga0068862_100006474 3300005844 Bacteria 9726
118 Ga0068862_100074086 3300005844 Bacteria 2943
119 Ga0068862_100762974 3300005844 Bacteria 942
120 Ga0068862_101793796 3300005844 Bacteria 623
121 Ga0081455_10024815 3300005937 Bacteria 5542
122 Ga0070717_11246846 3300006028 Bacteria 676
123 Ga0070717_11396096 3300006028 Bacteria 636
124 Ga0070715_10084071 3300006163 Bacteria 1451
125 Ga0070715_10272905 3300006163 Bacteria 893
126 Ga0070715_10281998 3300006163 Bacteria 881
127 Ga0070715_10706654 3300006163 Bacteria 603
128 Ga0070715_11008028 3300006163 Bacteria 519
129 Ga0070716_100620833 3300006173 Bacteria 816
130 Ga0070716_100794673 3300006173 Unclassified 732
131 Ga0070716_101250938 3300006173 Bacteria 598
132 Ga0070716_101270474 3300006173 Unclassified 594
133 Ga0070712_100744897 3300006175 Bacteria 838
134 Ga0070712_100979661 3300006175 Unclassified 731
135 Ga0097621_100002713 3300006237 Bacteria 12121
136 Ga0097621_100002991 3300006237 Bacteria 11613
137 Ga0097621_100016060 3300006237 Bacteria 5650
138 Ga0097621_100034270 3300006237 Bacteria 4049
139 Ga0097621_100082800 3300006237 Bacteria 2672
140 Ga0097621_100127283 3300006237 Bacteria 2164
141 Ga0097621_100660378 3300006237 Bacteria 960
142 Ga0097621_100987639 3300006237 Bacteria 787
143 Ga0068871_100007078 3300006358 Bacteria 7998
144 Ga0068871_100018716 3300006358 Bacteria 5273
145 Ga0068871_100105881 3300006358 Unclassified 2361
146 Ga0068871_100116670 3300006358 Bacteria 2251
147 Ga0068871_100134989 3300006358 Bacteria 2095
148 Ga0068871_100244304 3300006358 Bacteria 1562
149 Ga0068871_100915617 3300006358 Bacteria 813
150 Ga0075428_100000085 3300006844 Bacteria 78003
151 Ga0075428_100042098 3300006844 Bacteria 5024
152 Ga0075428_100087643 3300006844 Bacteria 3395
153 Ga0075428_100099712 3300006844 Bacteria 3167
154 Ga0075428_100212698 3300006844 Bacteria 2089
155 Ga0075428_100818469 3300006844 Bacteria 989
156 Ga0075428_101509711 3300006844 Unclassified 704
157 Ga0075431_100342408 3300006847 Bacteria 1504
158 Ga0075431_100765167 3300006847 Unclassified 940
159 Ga0075431_101409282 3300006847 Unclassified 656
160 Ga0075431_101562765 3300006847 Bacteria 618
161 Ga0075433_10032134 3300006852 Bacteria 4493
162 Ga0075433_10074991 3300006852 Bacteria 2977
163 Ga0075433_10409883 3300006852 Unclassified 1196
164 Ga0075434_100000085 3300006871 Bacteria 50753
165 Ga0075434_100022800 3300006871 Bacteria 6097
166 Ga0075434_100029700 3300006871 Bacteria 5380
167 Ga0075434_100096386 3300006871 Unclassified 2963
168 Ga0075434_100260158 3300006871 Bacteria 1754
169 Ga0075434_100939000 3300006871 Bacteria 879
170 Ga0075434_101048032 3300006871 Unclassified 829
171 Ga0075429_100193354 3300006880 Bacteria 1782
172 Ga0075429_100283581 3300006880 Bacteria 1451
173 Ga0075429_100445853 3300006880 Bacteria 1134
174 Ga0068865_100031553 3300006881 Unclassified 3533
175 Ga0068865_100040802 3300006881 Bacteria 3156
176 Ga0068865_100075482 3300006881 Bacteria 2404
177 Ga0075436_100015315 3300006914 Bacteria 5254
178 Ga0075436_100063925 3300006914 Bacteria 2543
179 Ga0075436_100649449 3300006914 Unclassified 779
180 Ga0097620_100204607 3300006931 Bacteria 2059
181 Ga0097620_101153893 3300006931 Unclassified 853
182 Ga0097620_101230673 3300006931 Bacteria 825
183 Ga0097620_102334055 3300006931 Bacteria 590
184 Ga0075435_100000001 3300007076 Bacteria 207579
185 Ga0075435_100028174 3300007076 Bacteria 4403
186 Ga0075435_100033345 3300007076 Unclassified 4071
187 Ga0075435_100059501 3300007076 Unclassified 3097
188 Ga0075435_100800647 3300007076 Bacteria 821
189 Ga0075435_100991164 3300007076 Bacteria 734
190 Ga0075435_101213105 3300007076 Bacteria 660
191 Ga0105250_10394844 3300009092 Bacteria 612
192 Ga0105240_10204206 3300009093 Unclassified 2314
193 Ga0105240_10549408 3300009093 Unclassified 1278
194 Ga0111539_10000043 3300009094 Bacteria 128570
195 Ga0111539_10122437 3300009094 Unclassified 3048
196 Ga0111539_10164803 3300009094 Bacteria 2592
197 Ga0105245_10005298 3300009098 Bacteria 11331
198 Ga0105245_10030802 3300009098 Bacteria 4745
199 Ga0105245_10180246 3300009098 Unclassified 2018
200 Ga0105245_10277825 3300009098 Bacteria 1636
201 Ga0105245_10438579 3300009098 Bacteria 1312
202 Ga0105245_11027368 3300009098 Bacteria 869
203 Ga0105245_12544436 3300009098 Unclassified 565
204 Ga0105247_10053239 3300009101 Bacteria 2496
205 Ga0105247_10061820 3300009101 Bacteria 2322
206 Ga0105247_10626096 3300009101 Bacteria 801
207 Ga0114129_10000851 3300009147 Bacteria 39513
208 Ga0114129_10037873 3300009147 Bacteria 6805
209 Ga0114129_10245042 3300009147 Bacteria 2408
210 Ga0114129_10263555 3300009147 Bacteria 2308
211 Ga0114129_10296499 3300009147 Bacteria 2156
212 Ga0114129_10299402 3300009147 Bacteria 2144
213 Ga0114129_10333413 3300009147 Bacteria 2014
214 Ga0114129_10390603 3300009147 Unclassified 1835
215 Ga0105243_10711889 3300009148 Bacteria 980
216 Ga0105243_11143055 3300009148 Unclassified 789
217 Ga0105242_10011164 3300009176 Bacteria 6902
218 Ga0105242_10014727 3300009176 Bacteria 6056
219 Ga0105242_10023087 3300009176 Bacteria 4903
220 Ga0105242_10225499 3300009176 Bacteria 1677
221 Ga0105242_10681766 3300009176 Bacteria 1003
222 Ga0105248_10031705 3300009177 Bacteria 5905
223 Ga0105248_10039452 3300009177 Bacteria 5289
224 Ga0105248_10156218 3300009177 Bacteria 2574
225 Ga0105248_10290482 3300009177 Bacteria 1841
226 Ga0105248_10629968 3300009177 Unclassified 1210
227 Ga0105248_10639481 3300009177 Bacteria 1200
228 Ga0105237_11783917 3300009545 Bacteria 623
229 Ga0105238_10747288 3300009551 Bacteria 992
230 Ga0105238_12585614 3300009551 Unclassified 544
231 Ga0105249_10121514 3300009553 Bacteria 2482
232 Ga0105249_10407791 3300009553 Bacteria 1390
233 Ga0105239_11671067 3300010375 Bacteria 737
234 Ga0105246_10719422 3300011119 Bacteria 877
235 Ga0105246_10764990 3300011119 Unclassified 853
236 Ga0157343_1008537 3300012488 Unclassified 739
237 Ga0157374_10084750 3300013296 Bacteria 3012
238 Ga0157374_10433060 3300013296 Bacteria 1315
239 Ga0157374_10459226 3300013296 Bacteria 1276
240 Ga0157374_12273655 3300013296 Unclassified 569
241 Ga0157378_10013431 3300013297 Bacteria 7159
242 Ga0157378_10404684 3300013297 Bacteria 1346
243 Ga0157378_10972983 3300013297 Unclassified 882
244 Ga0157378_12007130 3300013297 Unclassified 628
245 Ga0163162_10010181 3300013306 Bacteria 9134
246 Ga0163162_11261502 3300013306 Bacteria 839
247 Ga0163162_13070760 3300013306 Unclassified 536
248 Ga0157372_13067173 3300013307 Bacteria 534
249 Ga0157375_10079820 3300013308 Bacteria 3309
250 Ga0157375_10197192 3300013308 Bacteria 2169
251 Ga0157375_10321694 3300013308 Bacteria 1711
252 Ga0157375_10329417 3300013308 Bacteria 1692
253 Ga0157375_10688787 3300013308 Unclassified 1176
254 Ga0157375_12413563 3300013308 Bacteria 627
255 Ga0163163_10062931 3300014325 Bacteria 3678
256 Ga0163163_10273243 3300014325 Bacteria 1741
257 Ga0163163_10345572 3300014325 Bacteria 1543
258 Ga0163163_10545746 3300014325 Unclassified 1222
259 Ga0163163_11468380 3300014325 Unclassified 743
260 Ga0157380_10105017 3300014326 Bacteria 2361
261 Ga0157380_10115200 3300014326 Bacteria 2266
262 Ga0157377_10205091 3300014745 Bacteria 1254
263 Ga0157379_10629648 3300014968 Bacteria 1003
264 Ga0157376_10073218 3300014969 Bacteria 2917
265 Ga0157376_10134437 3300014969 Bacteria 2211
266 Ga0157376_10142045 3300014969 Bacteria 2155
267 Ga0157376_10457390 3300014969 Bacteria 1246
268 Ga0157376_10623583 3300014969 Bacteria 1076
269 Ga0157376_10687103 3300014969 Unclassified 1027
270 Ga0157376_11569597 3300014969 Bacteria 692
271 Ga0157376_12367141 3300014969 Bacteria 570
272 Ga0163161_10385404 3300017792 Unclassified 1121
273 Ga0163161_10784059 3300017792 Bacteria 800
274 Ga0213876_10083768 3300021384 Bacteria 1687
275 Ga0213876_10152224 3300021384 Bacteria 1230
276 Ga0207682_10363134 3300025893 Unclassified 683
277 Ga0207692_10267069 3300025898 Bacteria 1031
278 Ga0207642_10171370 3300025899 Bacteria 1175
279 Ga0207642_10390938 3300025899 Bacteria 830
280 Ga0207642_10936491 3300025899 Unclassified 556
281 Ga0207710_10112750 3300025900 Bacteria 1292
282 Ga0207680_10266183 3300025903 Unclassified 1188
283 Ga0207685_10182104 3300025905 Bacteria 975
284 Ga0207699_10021295 3300025906 Bacteria 3492
285 Ga0207699_10049219 3300025906 Archaea 2480
286 Ga0207645_10040024 3300025907 Bacteria 3002
287 Ga0207645_10166101 3300025907 Bacteria 1445
288 Ga0207645_11055052 3300025907 Bacteria 549
289 Ga0207684_10139283 3300025910 Bacteria 2085
290 Ga0207707_10686702 3300025912 Unclassified 861
291 Ga0207693_10106448 3300025915 Bacteria 2200
292 Ga0207663_10388450 3300025916 Bacteria 1065
293 Ga0207663_10574945 3300025916 Bacteria 883
294 Ga0207660_10487777 3300025917 Unclassified 999
295 Ga0207662_10422416 3300025918 Bacteria 907
296 Ga0207681_10173227 3300025923 Bacteria 1637
297 Ga0207681_10181593 3300025923 Bacteria 1603
298 Ga0207687_10002484 3300025927 Bacteria 12528
299 Ga0207687_10064674 3300025927 Bacteria 2595
300 Ga0207687_10082911 3300025927 Unclassified 2320
301 Ga0207700_10139226 3300025928 Archaea 1992
302 Ga0207700_10220685 3300025928 Bacteria 1607
303 Ga0207644_11802701 3300025931 Unclassified 512
304 Ga0207706_11444560 3300025933 Unclassified 563
305 Ga0207686_10011052 3300025934 Bacteria 4931
306 Ga0207686_10398743 3300025934 Bacteria 1047
307 Ga0207686_10740275 3300025934 Unclassified 784
308 Ga0207686_11287533 3300025934 Bacteria 600
309 Ga0207709_10779893 3300025935 Unclassified 770
310 Ga0207670_10574188 3300025936 Bacteria 924
311 Ga0207669_10131421 3300025937 Bacteria 1721
312 Ga0207669_10380967 3300025937 Bacteria 1099
313 Ga0207669_10917045 3300025937 Bacteria 733
314 Ga0207669_11925766 3300025937 Bacteria 505
315 Ga0207704_10012887 3300025938 Bacteria 4164
316 Ga0207704_10107242 3300025938 Bacteria 1878
317 Ga0207704_10177056 3300025938 Unclassified 1537
318 Ga0207665_10791225 3300025939 Archaea 749
319 Ga0207691_10579543 3300025940 Unclassified 950
320 Ga0207691_11230800 3300025940 Unclassified 620
321 Ga0207711_10033081 3300025941 Unclassified 4374
322 Ga0207711_10087352 3300025941 Unclassified 2736
323 Ga0207711_10159158 3300025941 Bacteria 2043
324 Ga0207711_10285906 3300025941 Bacteria 1519
325 Ga0207711_10852378 3300025941 Bacteria 848
326 Ga0207689_10091879 3300025942 Bacteria 2493
327 Ga0207689_10093220 3300025942 Bacteria 2474
328 Ga0207689_10656629 3300025942 Unclassified 884
329 Ga0207689_10951157 3300025942 Unclassified 725
330 Ga0207661_10178702 3300025944 Bacteria 1852
331 Ga0207667_10716096 3300025949 Bacteria 1002
332 Ga0207651_11359260 3300025960 Bacteria 639
333 Ga0207651_11971490 3300025960 Bacteria 525
334 Ga0207712_10278809 3300025961 Bacteria 1363
335 Ga0207712_10462038 3300025961 Bacteria 1078
336 Ga0207712_10551590 3300025961 Bacteria 991
337 Ga0207712_11612331 3300025961 Bacteria 582
338 Ga0207668_11162057 3300025972 Bacteria 693
339 Ga0207640_10100463 3300025981 Bacteria 2027
340 Ga0207677_10142359 3300026023 Bacteria 1838
341 Ga0207677_10718443 3300026023 Bacteria 888
342 Ga0207703_10124261 3300026035 Bacteria 2219
343 Ga0207703_10143058 3300026035 Bacteria 2078
344 Ga0207703_10352368 3300026035 Bacteria 1355
345 Ga0207703_12225081 3300026035 Bacteria 524
346 Ga0207639_10162393 3300026041 Bacteria 1884
347 Ga0207702_10674086 3300026078 Unclassified 1018
348 Ga0207641_10002015 3300026088 Bacteria 19360
349 Ga0207641_11147465 3300026088 Bacteria 776
350 Ga0207648_10033527 3300026089 Bacteria 4529
351 Ga0207648_10071495 3300026089 Bacteria 3023
352 Ga0207648_10096068 3300026089 Bacteria 2593
353 Ga0207648_10169196 3300026089 Bacteria 1931
354 Ga0207648_11071286 3300026089 Unclassified 756
355 Ga0207648_11869887 3300026089 Bacteria 562
356 Ga0207675_100128327 3300026118 Unclassified 2403
357 Ga0207675_100853179 3300026118 Bacteria 926
358 Ga0207675_100993377 3300026118 Bacteria 857
359 Ga0207683_10058327 3300026121 Unclassified 3389
360 Ga0207683_10257949 3300026121 Bacteria 1592
361 Ga0207683_11401804 3300026121 Unclassified 646
362 Ga0207698_10998131 3300026142 Bacteria 848
363 Ga0207428_10000195 3300027907 Bacteria 84698
364 Ga0207428_10077239 3300027907 Bacteria 2607
365 Ga0207428_10307634 3300027907 Bacteria 1172
366 Ga0268266_10021531 3300028379 Bacteria 5492
367 Ga0268266_10177553 3300028379 Bacteria 1937
368 Ga0268266_10451281 3300028379 Bacteria 1222
369 Ga0268265_10024449 3300028380 Bacteria 4274
370 Ga0268265_10308442 3300028380 Bacteria 1428
371 Ga0268265_10650619 3300028380 Bacteria 1013
372 Ga0268265_11037563 3300028380 Unclassified 811
373 Ga0268264_10078081 3300028381 Bacteria 2822
374 Ga0268264_10728599 3300028381 Bacteria 986
375 Ga0268264_11517457 3300028381 Bacteria 681
376 Ga0268264_11535339 3300028381 Bacteria 677
377 Ga0268264_12507982 3300028381 Unclassified 521
378 Ga0265338_10085959 3300028800 Bacteria 2620
379 Ga0307408_100714785 3300031548 Unclassified 902
380 Ga0307405_11172564 3300031731 Unclassified 663
381 Ga0307410_10617835 3300031852 Unclassified 906
382 Ga0307406_10348456 3300031901 Bacteria 1156
383 Ga0373944_0016733 3300035089 Bacteria 2073
384 Ga0373923_0211975 3300035111 Unclassified 898
385 Ga0373936_0033656 3300035113 Bacteria 2032
386 Ga0373936_0124883 3300035113 Bacteria 1102
387 Ga0373945_0102974 3300035116 Bacteria 1119
388 Ga0373954_0049680 3300035118 Bacteria 1967
389 Ga0373956_0093869 3300035119 Unclassified 1386
390 Ga0373956_0109548 3300035119 Unclassified 1285
391 Ga0373957_0063682 3300035120 Unclassified 1433
392 Ga0373943_0000751 3300035170 Bacteria 14122
393 Ga0373943_0005925 3300035170 Bacteria 5485
394 Ga0373943_0156167 3300035170 Unclassified 1239
395 Ga0373946_0002324 3300035171 Bacteria 6722
396 Ga0373946_0285811 3300035171 Bacteria 812
397 Ga0373955_0046703 3300035172 Bacteria 2342
398 Ga0373962_0032983 3300035242 Bacteria 1427
399 Ga0373924_0010628 3300035410 Bacteria 3402
400 Ga0373924_0011570 3300035410 Bacteria 3280
401 Ga0373924_0021713 3300035410 Bacteria 2505
402 Ga0373931_1148272 3300035691 Viruses 530
403 Ga0373935_0003264 3300035692 Bacteria 9380
404 Ga0373933_0259122 3300035724 Bacteria 1121
405 Ga0373933_0282059 3300035724 Bacteria 1073
406 Ga0373933_0714953 3300035724 Bacteria 659
407 Ga0373947_0015231 3300035725 Bacteria 4415
408 Ga0373937_0819846 3300036401 Bacteria 879
409 Ga0373937_0983131 3300036401 Bacteria 793
410 Ga0373925_0005913 3300037068 Bacteria 9074
411 Ga0373925_0010105 3300037068 Bacteria 6856
412 Ga0373925_0185479 3300037068 Bacteria 1649
413 Ga0373925_0841424 3300037068 Unclassified 756
414 Ga0395901_1416638 3300038443 Unclassified 653
415 Ga0436365_0221320 3300039437 Bacteria 1782
416 Ga0436365_1514592 3300039437 Bacteria 1449
417 Ga0436363_0633943 3300039450 Bacteria 856
418 Ga0451847_0697781 3300041503 Bacteria 548
419 Ga0451853_3468055 3300041512 Bacteria 968
420 Ga0439443_113893 3300042003 Unclassified 527
421 Ga0439451_113435 3300042009 Unclassified 550
422 Ga0450898_064284 3300042134 Bacteria 726
423 Ga0451577_1603679 3300042876 Bacteria 574
424 Ga0451576_2698672 3300045051 Bacteria 506
425 Ga0495592_0499940 3300046454 Unclassified 754
426 Ga0495603_0113042 3300046455 Bacteria 1583
427 Ga0495629_0004994 3300046459 Bacteria 9951
428 Ga0495629_0280701 3300046459 Bacteria 1143
429 Ga0495651_0082174 3300046462 Bacteria 2431
430 Ga0495653_0842191 3300046463 Bacteria 549
431 Ga0495580_0042660 3300046472 Bacteria 3231
432 Ga0495580_0088083 3300046472 Bacteria 2162
433 Ga0495580_0120835 3300046472 Bacteria 1819
434 Ga0495639_0692946 3300046475 Bacteria 526
435 Ga0495662_0056096 3300046476 Bacteria 1903
436 Ga0495664_0357993 3300046477 Unclassified 878
437 Ga0495608_0001222 3300046511 Bacteria 18213
438 Ga0495608_0018056 3300046511 Bacteria 4873
439 Ga0495618_0120898 3300046514 Bacteria 1677
440 Ga0495628_0447505 3300046516 Bacteria 938
441 Ga0495630_0024937 3300046517 Unclassified 4421
442 Ga0495630_0282241 3300046517 Bacteria 1269
443 Ga0495652_0177803 3300046529 Bacteria 1636
444 Ga0495652_0309452 3300046529 Bacteria 1145
445 Ga0495665_0054153 3300046531 Unclassified 2120
446 Ga0495665_0349285 3300046531 Unclassified 753
447 Ga0495640_0707934 3300046533 Bacteria 604
448 Ga0495586_0124077 3300046535 Unclassified 1444
449 Ga0495586_0163779 3300046535 Bacteria 1255
450 Ga0495645_0069646 3300046543 Bacteria 2539
451 Ga0495667_0018429 3300046559 Bacteria 4715
452 Ga0495667_0069098 3300046559 Bacteria 2306
453 Ga0495656_0339141 3300046615 Bacteria 777
454 Ga0495659_0170877 3300046664 Bacteria 882
455 Ga0495588_0227121 3300046674 Unclassified 985
456 Ga0495657_0142849 3300046675 Bacteria 1491
457 Ga0495599_0202561 3300046678 Bacteria 1219
458 Ga0495623_0115334 3300046679 Bacteria 1624
459 Ga0495646_0584364 3300046680 Unclassified 568
460 Ga0495647_0342382 3300046681 Bacteria 680
461 Ga0495658_0029043 3300046683 Bacteria 2989
462 Ga0495658_0562182 3300046683 Bacteria 730
463 Ga0495669_0003165 3300046684 Bacteria 6778
464 Ga0495613_0003599 3300046689 Bacteria 11610
465 Ga0495613_0004058 3300046689 Bacteria 10955
466 Ga0495613_0257815 3300046689 Bacteria 1216
467 Ga0495624_0510694 3300046690 Unclassified 719
468 Ga0495600_0080432 3300046809 Bacteria 2127
469 Ga0495581_0080034 3300047315 Bacteria 1891
470 Ga0495581_0145696 3300047315 Bacteria 1382
471 Ga0495604_0017776 3300047317 Bacteria 5689
472 Ga0495674_0017776 3300047319 Bacteria 6621
473 Ga0495674_0019831 3300047319 Bacteria 6233
474 Ga0495676_0061867 3300047321 Bacteria 2926
475 Ga0495680_0182024 3300047322 Bacteria 1516
476 Ga0495680_0259731 3300047322 Unclassified 1228
477 Ga0495675_0102504 3300047444 Bacteria 1790
478 Ga0495677_0114803 3300047445 Bacteria 1025
479 Ga0495681_0254039 3300047470 Unclassified 693
480 Ga0495684_0000378 3300047471 Bacteria 36403
481 Ga0495684_0002490 3300047471 Bacteria 14678
482 Ga0495684_0177605 3300047471 Bacteria 1580
483 Ga0495686_0081859 3300047472 Bacteria 1970
484 Ga0495602_0658946 3300048088 Bacteria 714
485 Ga0495602_0726123 3300048088 Bacteria 672
486 Ga0496100_0092359 3300048903 Bacteria 2068
487 Ga0496101_0009187 3300048904 Bacteria 6488
488 Ga0496102_1013183 3300048905 Bacteria 751
489 Ga0496102_1846025 3300048905 Bacteria 521
490 Ga0496103_0785041 3300048906 Bacteria 601
491 Ga0496104_0015034 3300048907 Bacteria 7003
492 Ga0496105_0122740 3300048908 Bacteria 2142
493 Ga0496112_0095992 3300048915 Unclassified 2935
494 Ga0496112_0325616 3300048915 Bacteria 1481
495 Ga0496114_0000791 3300048917 Bacteria 23646
496 Ga0496114_0158617 3300048917 Bacteria 1966
497 Ga0496114_0164460 3300048917 Bacteria 1931
498 Ga0496114_0347884 3300048917 Bacteria 1311
499 Ga0496114_0809523 3300048917 Bacteria 816
500 Ga0496114_1056422 3300048917 Bacteria 696
501 Ga0496114_1253080 3300048917 Unclassified 628
502 Ga0496115_0655556 3300048918 Bacteria 829
503 Ga0501070_1436734 3300049586 Bacteria 523
504 Ga0501072_0068987 3300049588 Bacteria 2791
505 Ga0501074_0643591 3300049590 Bacteria 749
506 Ga0501076_0053348 3300049592 Bacteria 3204
507 Ga0501080_1183898 3300049742 Bacteria 657
508 Ga0501081_0092702 3300049743 Bacteria 2126
509 Ga0501045_0115538 3300049824 Bacteria 1990
510 nmdc:mga0k408_627019_c1 3300050493 Bacteria 633
511 nmdc:mga05p37_12980_c1 3300050507 Bacteria 9967
512 nmdc:mga05p37_175625_c1 3300050507 Bacteria 2610
513 nmdc:mga05p37_18164_c1 3300050507 Bacteria 8497
514 nmdc:mga05p37_33512_c1 3300050507 Bacteria 6291
515 nmdc:mga05p37_43498_c1 3300050507 Bacteria 5526
516 nmdc:mga05p37_56005_c1 3300050507 Bacteria 4854
517 nmdc:mga09592_418788_c1 3300050508 Bacteria 1157
518 nmdc:mga09592_774466_c1 3300050508 Bacteria 813
519 nmdc:mga06r32_91532_c1 3300050510 Bacteria 2972
520 nmdc:mga08y16_25_c1 3300050511 Bacteria 235789
521 nmdc:mga08y16_303168_c1 3300050511 Bacteria 1022
522 nmdc:mga08y16_52220_c1 3300050511 Bacteria 4277
523 nmdc:mga08y16_754242_c1 3300050511 Bacteria 969
524 nmdc:mga0n895_103098_c1 3300050512 Bacteria 2864
525 nmdc:mga0n895_1280103_c1 3300050512 Unclassified 705
526 nmdc:mga0n895_218523_c1 3300050512 Unclassified 1935
527 nmdc:mga0n895_23_c1 3300050512 Bacteria 92165
528 nmdc:mga0n895_285953_c1 3300050512 Bacteria 1672
529 nmdc:mga0n895_7801_c1 3300050512 Bacteria 9223
530 nmdc:mga0rr50_106086_c1 3300050513 Bacteria 2216
531 nmdc:mga0rr50_11_c1 3300050513 Bacteria 216152
532 nmdc:mga0rr50_210660_c1 3300050513 Bacteria 1601
533 nmdc:mga0rr50_30611_c1 3300050513 Unclassified 3812
534 nmdc:mga0rr50_388026_c1 3300050513 Bacteria 1178
535 nmdc:mga0rr50_83600_c1 3300050513 Unclassified 2468
536 nmdc:mga08x19_573_c1 3300050514 Bacteria 24020
537 nmdc:mga0a205_1083831_c1 3300050515 Unclassified 648
538 nmdc:mga0a205_1148907_c1 3300050515 Unclassified 624
539 nmdc:mga0a205_220907_c1 3300050515 Bacteria 1780
540 nmdc:mga0a205_44672_c1 3300050515 Bacteria 4272
541 nmdc:mga0a205_547151_c1 3300050515 Unclassified 1013
542 nmdc:mga0a205_95012_c1 3300050515 Unclassified 2880
543 Ga0495601_0004097 3300053077 Bacteria 8402
544 Ga0495601_0017309 3300053077 Bacteria 4373
545 Ga0495601_0225843 3300053077 Bacteria 1223
546 Ga0495612_0498331 3300053078 Unclassified 559
547 Ga0495595_0130098 3300053084 Bacteria 1230
548 Ga0495595_0321207 3300053084 Bacteria 779
549 Ga0495619_0001016 3300053085 Bacteria 18376
550 Ga0495619_0006919 3300053085 Bacteria 7171
551 Ga0495619_0009585 3300053085 Bacteria 6108
552 Ga0590071_000251 3300059421 Bacteria 15535
553 Ga0590075_006199 3300059424 Bacteria 2834
554 Ga0590077_000612 3300059426 Bacteria 9645
555 Ga0530510_0024207 3300061734 Bacteria 4332
556 Ga0105246_10796950
557 Ga0065704_10163460
558 Ga0065704_10732492
559 Ga0065712_10586129
560 Ga0065707_10083557
561 Ga0065707_10118409
562 Ga0065707_10570370
563 Ga0065707_10733594
564 Ga0070676_10515548
565 Ga0070683_100108609
566 Ga0070683_100838961
567 Ga0070690_101167332
568 Ga0070690_101193577
569 Ga0070677_10618516
570 Ga0068869_100078340
571 Ga0068869_100245109
572 Ga0070666_10028953
573 Ga0070666_10225423
574 Ga0070666_10628729
575 Ga0070666_11063782
576 Ga0070666_11220879
577 Ga0070682_101125986
578 Ga0068868_100197718
579 Ga0068868_102121758
580 Ga0070689_100687037
581 Ga0070689_102188791
582 Ga0070661_100261954
583 Ga0070668_100198377
584 Ga0070669_100048519
585 Ga0070669_100301199
586 Ga0070671_100387968
587 Ga0070671_100625910
588 Ga0070674_100111723
589 Ga0070674_100337468
590 Ga0070674_100714442
591 Ga0070674_100746140
592 Ga0070673_100503180
593 Ga0070673_100759909
594 Ga0070688_100547876
595 Ga0070667_101038742
596 Ga0070709_10017380
597 Ga0070709_10104973
598 Ga0070709_10897446
599 Ga0070713_100059621
600 Ga0070713_100112975
601 Ga0070713_100324724
602 Ga0070713_102014778
603 Ga0070710_10111310
604 Ga0070710_10235488
605 Ga0070710_10779956
606 Ga0070710_11147459
607 Ga0070701_10131207
608 Ga0070701_11070864
609 Ga0070711_100107374
610 Ga0070711_100448049
611 Ga0070700_100282126
612 Ga0070694_100609239
613 Ga0070708_101166056
614 Ga0070663_101517625
615 Ga0070678_100260327
616 Ga0068867_100080360
617 Ga0068867_100217756
618 Ga0068867_100552260
619 Ga0068867_101999614
620 Ga0070685_10376814
621 Ga0070706_100331077
622 Ga0070706_100501139
623 Ga0070707_100599821
624 Ga0070707_100827654
625 Ga0070707_101597455
626 Ga0070707_101968761
627 Ga0070698_101173658
628 Ga0070699_101529041
629 Ga0070684_100007368
630 Ga0070684_100067502
631 Ga0070684_100173494
632 Ga0070697_100911321
633 Ga0068853_100102374
634 Ga0070672_100999973
635 Ga0070686_100081299
636 Ga0070686_100094260
637 Ga0070686_100239558
638 Ga0070686_100440394
639 Ga0070696_100374636
640 Ga0070693_100882969
641 Ga0070665_100063866
642 Ga0070665_100441986
643 Ga0070665_100461344
644 Ga0070665_100824689
645 Ga0070665_100950803
646 Ga0070704_102192522
647 Ga0070704_102217548
648 Ga0068855_100620540
649 Ga0068855_100831911
650 Ga0068854_100214109
651 Ga0068854_100929552
652 Ga0068854_101363731
653 Ga0068854_101727019
654 Ga0068859_100204614
655 Ga0068859_101153790
656 Ga0068859_101230646
657 Ga0068859_102334303
658 Ga0068864_100464819
659 Ga0068866_10319535
660 Ga0068866_10411753
661 Ga0068866_10686878
662 Ga0068861_100128333
663 Ga0068861_100485146
664 Ga0068863_100004473
665 Ga0068863_101166152
666 Ga0068858_100190462
667 Ga0068858_100551220
668 Ga0068860_100030204
669 Ga0068860_100765505
670 Ga0068860_101450211
671 Ga0068860_102671673
672 Ga0068862_100006474
673 Ga0068862_100074086
674 Ga0068862_100762974
675 Ga0068862_101793796
676 Ga0081455_10024815
677 Ga0070717_11246846
678 Ga0070717_11396096
679 Ga0070715_10084071
680 Ga0070715_10272905
681 Ga0070715_10281998
682 Ga0070715_10706654
683 Ga0070715_11008028
684 Ga0070716_100620833
685 Ga0070716_100794673
686 Ga0070716_101250938
687 Ga0070716_101270474
688 Ga0070712_100744897
689 Ga0070712_100979661
690 Ga0097621_100002713
691 Ga0097621_100002991
692 Ga0097621_100016060
693 Ga0097621_100034270
694 Ga0097621_100082800
695 Ga0097621_100127283
696 Ga0097621_100660378
697 Ga0097621_100987639
698 Ga0068871_100007078
699 Ga0068871_100018716
700 Ga0068871_100105881
701 Ga0068871_100116670
702 Ga0068871_100134989
703 Ga0068871_100244304
704 Ga0068871_100915617
705 Ga0075428_100000085
706 Ga0075428_100042098
707 Ga0075428_100087643
708 Ga0075428_100099712
709 Ga0075428_100212698
710 Ga0075428_100818469
711 Ga0075428_101509711
712 Ga0075431_100342408
713 Ga0075431_100765167
714 Ga0075431_101409282
715 Ga0075431_101562765
716 Ga0075433_10032134
717 Ga0075433_10074991
718 Ga0075433_10409883
719 Ga0075434_100000085
720 Ga0075434_100022800
721 Ga0075434_100029700
722 Ga0075434_100096386
723 Ga0075434_100260158
724 Ga0075434_100939000
725 Ga0075434_101048032
726 Ga0075429_100193354
727 Ga0075429_100283581
728 Ga0075429_100445853
729 Ga0068865_100031553
730 Ga0068865_100040802
731 Ga0068865_100075482
732 Ga0075436_100015315
733 Ga0075436_100063925
734 Ga0075436_100649449
735 Ga0097620_100204607
736 Ga0097620_101153893
737 Ga0097620_101230673
738 Ga0097620_102334055
739 Ga0075435_100000001
740 Ga0075435_100028174
741 Ga0075435_100033345
742 Ga0075435_100059501
743 Ga0075435_100800647
744 Ga0075435_100991164
745 Ga0075435_101213105
746 Ga0105250_10394844
747 Ga0105240_10204206
748 Ga0105240_10549408
749 Ga0111539_10000043
750 Ga0111539_10122437
751 Ga0111539_10164803
752 Ga0105245_10005298
753 Ga0105245_10030802
754 Ga0105245_10180246
755 Ga0105245_10277825
756 Ga0105245_10438579
757 Ga0105245_11027368
758 Ga0105245_12544436
759 Ga0105247_10053239
760 Ga0105247_10061820
761 Ga0105247_10626096
762 Ga0114129_10000851
763 Ga0114129_10037873
764 Ga0114129_10245042
765 Ga0114129_10263555
766 Ga0114129_10296499
767 Ga0114129_10299402
768 Ga0114129_10333413
769 Ga0114129_10390603
770 Ga0105243_10711889
771 Ga0105243_11143055
772 Ga0105242_10011164
773 Ga0105242_10014727
774 Ga0105242_10023087
775 Ga0105242_10225499
776 Ga0105242_10681766
777 Ga0105248_10031705
778 Ga0105248_10039452
779 Ga0105248_10156218
780 Ga0105248_10290482
781 Ga0105248_10629968
782 Ga0105248_10639481
783 Ga0105237_11783917
784 Ga0105238_10747288
785 Ga0105238_12585614
786 Ga0105249_10121514
787 Ga0105249_10407791
788 Ga0105239_11671067
789 Ga0105246_10719422
790 Ga0105246_10764990
791 Ga0157343_1008537
792 Ga0157374_10084750
793 Ga0157374_10433060
794 Ga0157374_10459226
795 Ga0157374_12273655
796 Ga0157378_10013431
797 Ga0157378_10404684
798 Ga0157378_10972983
799 Ga0157378_12007130
800 Ga0163162_10010181
801 Ga0163162_11261502
802 Ga0163162_13070760
803 Ga0157372_13067173
804 Ga0157375_10079820
805 Ga0157375_10197192
806 Ga0157375_10321694
807 Ga0157375_10329417
808 Ga0157375_10688787
809 Ga0157375_12413563
810 Ga0163163_10062931
811 Ga0163163_10273243
812 Ga0163163_10345572
813 Ga0163163_10545746
814 Ga0163163_11468380
815 Ga0157380_10105017
816 Ga0157380_10115200
817 Ga0157377_10205091
818 Ga0157379_10629648
819 Ga0157376_10073218
820 Ga0157376_10134437
821 Ga0157376_10142045
822 Ga0157376_10457390
823 Ga0157376_10623583
824 Ga0157376_10687103
825 Ga0157376_11569597
826 Ga0157376_12367141
827 Ga0163161_10385404
828 Ga0163161_10784059
829 Ga0213876_10083768
830 Ga0213876_10152224
831 Ga0207682_10363134
832 Ga0207692_10267069
833 Ga0207642_10171370
834 Ga0207642_10390938
835 Ga0207642_10936491
836 Ga0207710_10112750
837 Ga0207680_10266183
838 Ga0207685_10182104
839 Ga0207699_10021295
840 Ga0207699_10049219
841 Ga0207645_10040024
842 Ga0207645_10166101
843 Ga0207645_11055052
844 Ga0207684_10139283
845 Ga0207707_10686702
846 Ga0207693_10106448
847 Ga0207663_10388450
848 Ga0207663_10574945
849 Ga0207660_10487777
850 Ga0207662_10422416
851 Ga0207681_10173227
852 Ga0207681_10181593
853 Ga0207687_10002484
854 Ga0207687_10064674
855 Ga0207687_10082911
856 Ga0207700_10139226
857 Ga0207700_10220685
858 Ga0207644_11802701
859 Ga0207706_11444560
860 Ga0207686_10011052
861 Ga0207686_10398743
862 Ga0207686_10740275
863 Ga0207686_11287533
864 Ga0207709_10779893
865 Ga0207670_10574188
866 Ga0207669_10131421
867 Ga0207669_10380967
868 Ga0207669_10917045
869 Ga0207669_11925766
870 Ga0207704_10012887
871 Ga0207704_10107242
872 Ga0207704_10177056
873 Ga0207665_10791225
874 Ga0207691_10579543
875 Ga0207691_11230800
876 Ga0207711_10033081
877 Ga0207711_10087352
878 Ga0207711_10159158
879 Ga0207711_10285906
880 Ga0207711_10852378
881 Ga0207689_10091879
882 Ga0207689_10093220
883 Ga0207689_10656629
884 Ga0207689_10951157
885 Ga0207661_10178702
886 Ga0207667_10716096
887 Ga0207651_11359260
888 Ga0207651_11971490
889 Ga0207712_10278809
890 Ga0207712_10462038
891 Ga0207712_10551590
892 Ga0207712_11612331
893 Ga0207668_11162057
894 Ga0207640_10100463
895 Ga0207677_10142359
896 Ga0207677_10718443
897 Ga0207703_10124261
898 Ga0207703_10143058
899 Ga0207703_10352368
900 Ga0207703_12225081
901 Ga0207639_10162393
902 Ga0207702_10674086
903 Ga0207641_10002015
904 Ga0207641_11147465
905 Ga0207648_10033527
906 Ga0207648_10071495
907 Ga0207648_10096068
908 Ga0207648_10169196
909 Ga0207648_11071286
910 Ga0207648_11869887
911 Ga0207675_100128327
912 Ga0207675_100853179
913 Ga0207675_100993377
914 Ga0207683_10058327
915 Ga0207683_10257949
916 Ga0207683_11401804
917 Ga0207698_10998131
918 Ga0207428_10000195
919 Ga0207428_10077239
920 Ga0207428_10307634
921 Ga0268266_10021531
922 Ga0268266_10177553
923 Ga0268266_10451281
924 Ga0268265_10024449
925 Ga0268265_10308442
926 Ga0268265_10650619
927 Ga0268265_11037563
928 Ga0268264_10078081
929 Ga0268264_10728599
930 Ga0268264_11517457
931 Ga0268264_11535339
932 Ga0268264_12507982
933 Ga0265338_10085959
934 Ga0307408_100714785
935 Ga0307405_11172564
936 Ga0307410_10617835
937 Ga0307406_10348456
938 Ga0373944_0016733
939 Ga0373923_0211975
940 Ga0373936_0033656
941 Ga0373936_0124883
942 Ga0373945_0102974
943 Ga0373954_0049680
944 Ga0373956_0093869
945 Ga0373956_0109548
946 Ga0373957_0063682
947 Ga0373943_0000751
948 Ga0373943_0005925
949 Ga0373943_0156167
950 Ga0373946_0002324
951 Ga0373946_0285811
952 Ga0373955_0046703
953 Ga0373962_0032983
954 Ga0373924_0010628
955 Ga0373924_0011570
956 Ga0373924_0021713
957 Ga0373931_1148272
958 Ga0373935_0003264
959 Ga0373933_0259122
960 Ga0373933_0282059
961 Ga0373933_0714953
962 Ga0373947_0015231
963 Ga0373937_0819846
964 Ga0373937_0983131
965 Ga0373925_0005913
966 Ga0373925_0010105
967 Ga0373925_0185479
968 Ga0373925_0841424
969 Ga0395901_1416638
970 Ga0436365_0221320
971 Ga0436365_1514592
972 Ga0436363_0633943
973 Ga0451847_0697781
974 Ga0451853_3468055
975 Ga0439443_113893
976 Ga0439451_113435
977 Ga0450898_064284
978 Ga0451577_1603679
979 Ga0451576_2698672
980 Ga0495592_0499940
981 Ga0495603_0113042
982 Ga0495629_0004994
983 Ga0495629_0280701
984 Ga0495651_0082174
985 Ga0495653_0842191
986 Ga0495580_0042660
987 Ga0495580_0088083
988 Ga0495580_0120835
989 Ga0495639_0692946
990 Ga0495662_0056096
991 Ga0495664_0357993
992 Ga0495608_0001222
993 Ga0495608_0018056
994 Ga0495618_0120898
995 Ga0495628_0447505
996 Ga0495630_0024937
997 Ga0495630_0282241
998 Ga0495652_0177803
999 Ga0495652_0309452
1000 Ga0495665_0054153
1001 Ga0495665_0349285
1002 Ga0495640_0707934
1003 Ga0495586_0124077
1004 Ga0495586_0163779
1005 Ga0495645_0069646
1006 Ga0495667_0018429
1007 Ga0495667_0069098
1008 Ga0495656_0339141
1009 Ga0495659_0170877
1010 Ga0495588_0227121
1011 Ga0495657_0142849
1012 Ga0495599_0202561
1013 Ga0495623_0115334
1014 Ga0495646_0584364
1015 Ga0495647_0342382
1016 Ga0495658_0029043
1017 Ga0495658_0562182
1018 Ga0495669_0003165
1019 Ga0495613_0003599
1020 Ga0495613_0004058
1021 Ga0495613_0257815
1022 Ga0495624_0510694
1023 Ga0495600_0080432
1024 Ga0495581_0080034
1025 Ga0495581_0145696
1026 Ga0495604_0017776
1027 Ga0495674_0017776
1028 Ga0495674_0019831
1029 Ga0495676_0061867
1030 Ga0495680_0182024
1031 Ga0495680_0259731
1032 Ga0495675_0102504
1033 Ga0495677_0114803
1034 Ga0495681_0254039
1035 Ga0495684_0000378
1036 Ga0495684_0002490
1037 Ga0495684_0177605
1038 Ga0495686_0081859
1039 Ga0495602_0658946
1040 Ga0495602_0726123
1041 Ga0496100_0092359
1042 Ga0496101_0009187
1043 Ga0496102_1013183
1044 Ga0496102_1846025
1045 Ga0496103_0785041
1046 Ga0496104_0015034
1047 Ga0496105_0122740
1048 Ga0496112_0095992
1049 Ga0496112_0325616
1050 Ga0496114_0000791
1051 Ga0496114_0158617
1052 Ga0496114_0164460
1053 Ga0496114_0347884
1054 Ga0496114_0809523
1055 Ga0496114_1056422
1056 Ga0496114_1253080
1057 Ga0496115_0655556
1058 Ga0501070_1436734
1059 Ga0501072_0068987
1060 Ga0501074_0643591
1061 Ga0501076_0053348
1062 Ga0501080_1183898
1063 Ga0501081_0092702
1064 Ga0501045_0115538
1065 nmdc:mga0k408_627019_c1
1066 nmdc:mga05p37_12980_c1
1067 nmdc:mga05p37_175625_c1
1068 nmdc:mga05p37_18164_c1
1069 nmdc:mga05p37_33512_c1
1070 nmdc:mga05p37_43498_c1
1071 nmdc:mga05p37_56005_c1
1072 nmdc:mga09592_418788_c1
1073 nmdc:mga09592_774466_c1
1074 nmdc:mga06r32_91532_c1
1075 nmdc:mga08y16_25_c1
1076 nmdc:mga08y16_303168_c1
1077 nmdc:mga08y16_52220_c1
1078 nmdc:mga08y16_754242_c1
1079 nmdc:mga0n895_103098_c1
1080 nmdc:mga0n895_1280103_c1
1081 nmdc:mga0n895_218523_c1
1082 nmdc:mga0n895_23_c1
1083 nmdc:mga0n895_285953_c1
1084 nmdc:mga0n895_7801_c1
1085 nmdc:mga0rr50_106086_c1
1086 nmdc:mga0rr50_11_c1
1087 nmdc:mga0rr50_210660_c1
1088 nmdc:mga0rr50_30611_c1
1089 nmdc:mga0rr50_388026_c1
1090 nmdc:mga0rr50_83600_c1
1091 nmdc:mga08x19_573_c1
1092 nmdc:mga0a205_1083831_c1
1093 nmdc:mga0a205_1148907_c1
1094 nmdc:mga0a205_220907_c1
1095 nmdc:mga0a205_44672_c1
1096 nmdc:mga0a205_547151_c1
1097 nmdc:mga0a205_95012_c1
1098 Ga0495601_0004097
1099 Ga0495601_0017309
1100 Ga0495601_0225843
1101 Ga0495612_0498331
1102 Ga0495595_0130098
1103 Ga0495595_0321207
1104 Ga0495619_0001016
1105 Ga0495619_0006919
1106 Ga0495619_0009585
1107 Ga0590071_000251
1108 Ga0590075_006199
1109 Ga0590077_000612
1110 Ga0530510_0024207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

18

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.9404 1 108
3t9z-assembly1.cif.gz_A a. fulgidus glnk3, ligand-free 0.931 1 108
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.9304 1 108
1v9o-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.9302 1 108
1v3s-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.9285 1 108
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9087 1 108 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9018 2 109 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8985 2 107 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8732 1 108 3.30.70.120
3l7pE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8676 2 102 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A1F4A1X4-F1-model_v4 Transcriptional regulator 0.8998 2 109 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A447JM51-F1-model_v4 Nitrogen regulatory protein P-II 0.8971 1 90 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1F4CL60-F1-model_v4 Transcriptional regulator 0.8958 2 109 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-X8E8Y3-F1-model_v4 Nitrogen regulatory P-II domain protein 0.895 2 97 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A6L8C7Q2-F1-model_v4 Nitrogen regulatory protein P-II 0.8932 1 97 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Map