F463102

General Info

Members Datasets Scaffolds Average Seq Length
555 308 1110 132

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_13104116|Ga0105249_131041161
Length 156
Sequence MAQHAKKGVAMPTVRGSCLCGGVKFEIEGPLLRPLNCHCTFCRKQQGAAFRSRARVRRDDFKWLQGEELLTYYEATPGYRRGFCRVCGSPIVNRAEPSSPLAQHNPQSLDEFGIALAVLDDDPSVRPESHCFVASKAPWFEITDDLPQYPGYPPAG

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
104 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
105 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
286 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
305 2739367700 Dyella sp. YR388 Isolate Unclassified
306 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
307 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
308 2928963466 Dyella japonica 1073 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0.36
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0
Rhizoplane 9.37
Rhizosphere 84.68
Stem 0
Stem Tuber 0
Unclassified 10.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_13104116 3300009553 Bacteria 534
2 JGI24745J21846_1023844 3300002073 Bacteria 725
3 JGI25162J39368_1001372 3300002737 Bacteria 13387
4 rootH1_10099588 3300003323 Bacteria 5788
5 Ga0055542_1000098 3300003762 Bacteria 117711
6 Ga0065715_10970841 3300005293 Bacteria 553
7 Ga0070676_11252677 3300005328 Bacteria 565
8 Ga0070683_100005861 3300005329 Bacteria 10282
9 Ga0070683_100051897 3300005329 Bacteria 3798
10 Ga0070683_100076814 3300005329 Bacteria 3122
11 Ga0070683_100181126 3300005329 Bacteria 2000
12 Ga0070683_100830557 3300005329 Bacteria 886
13 Ga0068869_100068199 3300005334 Bacteria 2627
14 Ga0068869_100119905 3300005334 Bacteria 2011
15 Ga0068869_100989006 3300005334 Bacteria 732
16 Ga0070666_10296539 3300005335 Bacteria 1151
17 Ga0070682_100006996 3300005337 Bacteria 6345
18 Ga0070682_100018769 3300005337 Bacteria 4048
19 Ga0068868_100009919 3300005338 Bacteria 6879
20 Ga0068868_100518866 3300005338 Bacteria 1046
21 Ga0068868_100542364 3300005338 Bacteria 1024
22 Ga0068868_100803367 3300005338 Bacteria 849
23 Ga0070660_100035660 3300005339 Bacteria 3766
24 Ga0070660_100042408 3300005339 Bacteria 3473
25 Ga0070689_100667273 3300005340 Bacteria 906
26 Ga0070689_101636149 3300005340 Bacteria 585
27 Ga0070691_10089692 3300005341 Bacteria 1514
28 Ga0070687_100425400 3300005343 Bacteria 877
29 Ga0070661_100302253 3300005344 Bacteria 1246
30 Ga0070668_100397849 3300005347 Bacteria 1176
31 Ga0070668_100953572 3300005347 Bacteria 769
32 Ga0070668_101132416 3300005347 Unclassified 707
33 Ga0070668_101180594 3300005347 Bacteria 693
34 Ga0070669_100050717 3300005353 Bacteria 3031
35 Ga0070675_100134451 3300005354 Bacteria 2110
36 Ga0070675_100203636 3300005354 Bacteria 1718
37 Ga0070671_100274666 3300005355 Bacteria 1432
38 Ga0070671_100377826 3300005355 Bacteria 1211
39 Ga0070674_100033154 3300005356 Bacteria 3436
40 Ga0070674_100175799 3300005356 Bacteria 1636
41 Ga0070674_100855447 3300005356 Bacteria 789
42 Ga0070673_100140426 3300005364 Bacteria 2037
43 Ga0070688_100047976 3300005365 Bacteria 2652
44 Ga0070709_10070067 3300005434 Bacteria 2259
45 Ga0070709_10380816 3300005434 Bacteria 1049
46 Ga0070709_10391082 3300005434 Unclassified 1036
47 Ga0070709_10742231 3300005434 Bacteria 767
48 Ga0070714_100009206 3300005435 Bacteria 7755
49 Ga0070714_100019007 3300005435 Bacteria 5592
50 Ga0070714_100082044 3300005435 Bacteria 2808
51 Ga0070714_101575307 3300005435 Unclassified 642
52 Ga0070713_100171758 3300005436 Bacteria 1942
53 Ga0070713_100775026 3300005436 Bacteria 918
54 Ga0070710_10688079 3300005437 Bacteria 720
55 Ga0070701_10532750 3300005438 Unclassified 768
56 Ga0070701_10534934 3300005438 Bacteria 766
57 Ga0070711_100005082 3300005439 Bacteria 7831
58 Ga0070711_100330805 3300005439 Bacteria 1219
59 Ga0070711_100687200 3300005439 Bacteria 861
60 Ga0070705_100608845 3300005440 Bacteria 846
61 Ga0070705_101124176 3300005440 Bacteria 644
62 Ga0070700_100110955 3300005441 Bacteria 1823
63 Ga0070700_100304482 3300005441 Unclassified 1165
64 Ga0070700_101088534 3300005441 Bacteria 662
65 Ga0070694_100426200 3300005444 Bacteria 1043
66 Ga0070708_100098453 3300005445 Bacteria 2674
67 Ga0070708_101469299 3300005445 Unclassified 635
68 Ga0070663_100295347 3300005455 Bacteria 1295
69 Ga0070678_100122651 3300005456 Bacteria 2052
70 Ga0070678_100402952 3300005456 Bacteria 1189
71 Ga0070662_100084835 3300005457 Bacteria 2366
72 Ga0070662_100678281 3300005457 Bacteria 871
73 Ga0070662_101066153 3300005457 Bacteria 693
74 Ga0070681_10831344 3300005458 Bacteria 841
75 Ga0068867_100284902 3300005459 Unclassified 1356
76 Ga0068867_100626840 3300005459 Bacteria 941
77 Ga0070685_10001199 3300005466 Bacteria 13817
78 Ga0070685_10262657 3300005466 Bacteria 1149
79 Ga0070685_10853729 3300005466 Bacteria 675
80 Ga0070706_100066850 3300005467 Bacteria 3325
81 Ga0070707_100045842 3300005468 Bacteria 4184
82 Ga0070707_101542674 3300005468 Bacteria 631
83 Ga0070698_100030092 3300005471 Bacteria 5633
84 Ga0070698_100089162 3300005471 Bacteria 3068
85 Ga0070698_100222996 3300005471 Bacteria 1819
86 Ga0070698_101334104 3300005471 Bacteria 668
87 Ga0070698_101704010 3300005471 Bacteria 583
88 Ga0070699_100028774 3300005518 Bacteria 4791
89 Ga0070679_100941930 3300005530 Bacteria 807
90 Ga0070684_100000816 3300005535 Bacteria 21766
91 Ga0070684_100014440 3300005535 Bacteria 6399
92 Ga0070697_100255062 3300005536 Unclassified 1500
93 Ga0070697_100408047 3300005536 Bacteria 1180
94 Ga0068853_100183921 3300005539 Bacteria 1896
95 Ga0068853_100200937 3300005539 Bacteria 1814
96 Ga0070672_100129618 3300005543 Bacteria 2072
97 Ga0070672_100415541 3300005543 Bacteria 1155
98 Ga0070686_100426234 3300005544 Bacteria 1015
99 Ga0070686_100463382 3300005544 Bacteria 977
100 Ga0070695_100821544 3300005545 Bacteria 746
101 Ga0070696_100263781 3300005546 Unclassified 1307
102 Ga0070693_100062364 3300005547 Bacteria 2169
103 Ga0070693_100069381 3300005547 Bacteria 2072
104 Ga0070704_101511669 3300005549 Bacteria 618
105 Ga0068855_100190108 3300005563 Bacteria 2316
106 Ga0068855_100525171 3300005563 Bacteria 1284
107 Ga0068855_100626408 3300005563 Bacteria 1158
108 Ga0068855_100964841 3300005563 Bacteria 897
109 Ga0070664_100037589 3300005564 Bacteria 4071
110 Ga0070664_100052709 3300005564 Bacteria 3447
111 Ga0070664_100203897 3300005564 Bacteria 1766
112 Ga0068857_100021154 3300005577 Bacteria 5724
113 Ga0068857_100131911 3300005577 Bacteria 2253
114 Ga0068854_100309394 3300005578 Bacteria 1281
115 Ga0068854_100806108 3300005578 Bacteria 819
116 Ga0068856_100354216 3300005614 Bacteria 1486
117 Ga0068856_101187466 3300005614 Bacteria 779
118 Ga0070702_100032679 3300005615 Bacteria 2856
119 Ga0070702_100079788 3300005615 Bacteria 1957
120 Ga0068852_100034171 3300005616 Bacteria 4228
121 Ga0068859_100532592 3300005617 Bacteria 1269
122 Ga0068859_100898253 3300005617 Bacteria 971
123 Ga0068864_100274495 3300005618 Bacteria 1572
124 Ga0068864_100714390 3300005618 Bacteria 980
125 Ga0068866_10263610 3300005718 Bacteria 1060
126 Ga0068861_100098032 3300005719 Bacteria 2326
127 Ga0068861_100470608 3300005719 Bacteria 1130
128 Ga0068861_100669294 3300005719 Bacteria 961
129 Ga0068851_10758548 3300005834 Bacteria 601
130 Ga0068870_10157158 3300005840 Bacteria 1345
131 Ga0068863_101295934 3300005841 Bacteria 735
132 Ga0068858_100156610 3300005842 Bacteria 2144
133 Ga0068858_100310410 3300005842 Unclassified 1506
134 Ga0068860_100242659 3300005843 Bacteria 1753
135 Ga0068860_100596021 3300005843 Bacteria 1110
136 Ga0068860_100754319 3300005843 Bacteria 985
137 Ga0081455_10003888 3300005937 Bacteria 17011
138 Ga0081455_10133626 3300005937 Bacteria 1936
139 Ga0070717_10183151 3300006028 Bacteria 1827
140 Ga0070717_10313424 3300006028 Bacteria 1397
141 Ga0070717_10738914 3300006028 Bacteria 895
142 Ga0070717_10954475 3300006028 Unclassified 781
143 Ga0075365_10018959 3300006038 Bacteria 4238
144 Ga0075432_10119833 3300006058 Bacteria 988
145 Ga0075432_10273224 3300006058 Bacteria 693
146 Ga0070716_100210579 3300006173 Bacteria 1299
147 Ga0070716_101671010 3300006173 Bacteria 525
148 Ga0070712_100085360 3300006175 Bacteria 2298
149 Ga0070712_100126735 3300006175 Bacteria 1929
150 Ga0070712_100282786 3300006175 Unclassified 1337
151 Ga0070712_100377162 3300006175 Bacteria 1167
152 Ga0070712_100439420 3300006175 Unclassified 1084
153 Ga0075362_10006716 3300006177 Bacteria 4299
154 Ga0097621_100093764 3300006237 Bacteria 2516
155 Ga0097621_100896750 3300006237 Bacteria 826
156 Ga0097621_101296393 3300006237 Bacteria 688
157 Ga0068871_101267301 3300006358 Bacteria 693
158 Ga0075428_101710821 3300006844 Bacteria 656
159 Ga0075431_100332879 3300006847 Bacteria 1529
160 Ga0075433_10033054 3300006852 Unclassified 4434
161 Ga0075433_10077160 3300006852 Bacteria 2935
162 Ga0075433_10138619 3300006852 Bacteria 2162
163 Ga0075434_100004292 3300006871 Bacteria 12805
164 Ga0075434_100014875 3300006871 Bacteria 7444
165 Ga0075434_100254882 3300006871 Unclassified 1773
166 Ga0075434_100629283 3300006871 Bacteria 1092
167 Ga0075434_101921116 3300006871 Bacteria 598
168 Ga0075434_102263903 3300006871 Bacteria 547
169 Ga0068865_100364182 3300006881 Bacteria 1175
170 Ga0068865_100518296 3300006881 Bacteria 997
171 Ga0075436_100170180 3300006914 Bacteria 1538
172 Ga0075436_100418431 3300006914 Bacteria 973
173 Ga0097620_100532641 3300006931 Bacteria 1269
174 Ga0097620_100898283 3300006931 Bacteria 971
175 Ga0075435_100033163 3300007076 Bacteria 4081
176 Ga0075435_100095653 3300007076 Bacteria 2456
177 Ga0075435_100206437 3300007076 Bacteria 1665
178 Ga0075435_100249193 3300007076 Bacteria 1512
179 Ga0099794_10599303 3300007265 Bacteria 583
180 Ga0099795_10115431 3300007788 Unclassified 1068
181 Ga0105240_10495762 3300009093 Bacteria 1359
182 Ga0105240_11381759 3300009093 Bacteria 741
183 Ga0111539_10257024 3300009094 Bacteria 2034
184 Ga0105245_10009770 3300009098 Bacteria 8360
185 Ga0105245_10058395 3300009098 Bacteria 3472
186 Ga0105245_10084512 3300009098 Bacteria 2908
187 Ga0105245_10455464 3300009098 Bacteria 1289
188 Ga0105247_10253329 3300009101 Bacteria 1204
189 Ga0114129_10482972 3300009147 Bacteria 1621
190 Ga0114129_11175781 3300009147 Bacteria 957
191 Ga0114129_11598245 3300009147 Bacteria 798
192 Ga0114129_11842199 3300009147 Unclassified 735
193 Ga0114129_12051702 3300009147 Bacteria 691
194 Ga0105243_10097293 3300009148 Bacteria 2436
195 Ga0105243_10160114 3300009148 Bacteria 1940
196 Ga0105243_10376404 3300009148 Bacteria 1312
197 Ga0105241_10207580 3300009174 Unclassified 1640
198 Ga0105241_10721368 3300009174 Unclassified 912
199 Ga0105242_10035333 3300009176 Bacteria 4008
200 Ga0105242_10104602 3300009176 Bacteria 2403
201 Ga0105242_10711742 3300009176 Bacteria 984
202 Ga0105242_10714306 3300009176 Bacteria 982
203 Ga0105248_10160378 3300009177 Bacteria 2537
204 Ga0105237_10114356 3300009545 Bacteria 2691
205 Ga0105238_10019520 3300009551 Bacteria 6903
206 Ga0105238_10881987 3300009551 Unclassified 913
207 Ga0105249_10498699 3300009553 Bacteria 1262
208 Ga0105249_10823431 3300009553 Bacteria 993
209 Ga0105249_12317971 3300009553 Bacteria 610
210 Ga0105239_10054049 3300010375 Bacteria 4404
211 Ga0105239_10170786 3300010375 Bacteria 2431
212 Ga0105239_10350668 3300010375 Bacteria 1666
213 Ga0105239_10766833 3300010375 Bacteria 1104
214 Ga0105239_11126954 3300010375 Bacteria 903
215 Ga0105246_10022018 3300011119 Bacteria 4110
216 Ga0105246_11099006 3300011119 Bacteria 726
217 Ga0157336_1024308 3300012477 Bacteria 569
218 Ga0157347_1023295 3300012502 Bacteria 737
219 Ga0157327_1056391 3300012512 Bacteria 573
220 Ga0157371_11107994 3300013102 Bacteria 607
221 Ga0157369_12089370 3300013105 Bacteria 574
222 Ga0157374_10043384 3300013296 Bacteria 4155
223 Ga0157378_11121471 3300013297 Bacteria 824
224 Ga0163162_10038264 3300013306 Bacteria 4787
225 Ga0163162_10132110 3300013306 Bacteria 2605
226 Ga0163162_10632706 3300013306 Bacteria 1194
227 Ga0157372_10415699 3300013307 Unclassified 1567
228 Ga0157372_10478754 3300013307 Bacteria 1451
229 Ga0157375_10198258 3300013308 Bacteria 2163
230 Ga0163163_10017274 3300014325 Bacteria 6727
231 Ga0163163_10444573 3300014325 Bacteria 1356
232 Ga0163163_11871499 3300014325 Bacteria 660
233 Ga0157380_11295191 3300014326 Bacteria 776
234 Ga0157377_10030596 3300014745 Bacteria 2917
235 Ga0157377_10068056 3300014745 Unclassified 2051
236 Ga0157379_10097057 3300014968 Bacteria 2645
237 Ga0157376_10033534 3300014969 Bacteria 4134
238 Ga0157376_11751765 3300014969 Unclassified 657
239 Ga0163161_10058571 3300017792 Bacteria 2800
240 Ga0163161_10884589 3300017792 Bacteria 756
241 Ga0197907_11015145 3300020069 Bacteria 610
242 Ga0213873_10030602 3300021358 Unclassified 1334
243 Ga0213876_10670357 3300021384 Bacteria 552
244 Ga0213875_10366306 3300021388 Bacteria 685
245 Ga0224712_10285935 3300022467 Bacteria 768
246 Ga0209672_100523 3300025228 Bacteria 21003
247 Ga0207427_102837 3300025231 Bacteria 4199
248 Ga0209437_100151 3300025233 Bacteria 156418
249 Ga0209437_104021 3300025233 Bacteria 2610
250 Ga0209026_1004977 3300025250 Bacteria 3725
251 Ga0209148_1000005 3300025254 Bacteria 1806504
252 Ga0209233_1024989 3300025261 Bacteria 1485
253 Ga0209455_1002274 3300025272 Bacteria 7557
254 Ga0209675_1051717 3300025291 Bacteria 845
255 Ga0207692_10023996 3300025898 Bacteria 2829
256 Ga0207692_10187021 3300025898 Bacteria 1210
257 Ga0207710_10169548 3300025900 Bacteria 1067
258 Ga0207688_10077114 3300025901 Bacteria 1899
259 Ga0207688_10097015 3300025901 Bacteria 1698
260 Ga0207685_10194436 3300025905 Bacteria 949
261 Ga0207699_10088086 3300025906 Bacteria 1942
262 Ga0207643_10286177 3300025908 Bacteria 1023
263 Ga0207684_11739960 3300025910 Bacteria 501
264 Ga0207654_10278685 3300025911 Bacteria 1130
265 Ga0207695_10410660 3300025913 Bacteria 1238
266 Ga0207671_10131700 3300025914 Bacteria 1920
267 Ga0207693_10018753 3300025915 Bacteria 5506
268 Ga0207693_10081030 3300025915 Bacteria 2541
269 Ga0207693_10340112 3300025915 Unclassified 1174
270 Ga0207693_10889427 3300025915 Bacteria 684
271 Ga0207663_10005397 3300025916 Bacteria 6435
272 Ga0207663_10036621 3300025916 Bacteria 2953
273 Ga0207663_10251709 3300025916 Unclassified 1300
274 Ga0207663_10384728 3300025916 Bacteria 1069
275 Ga0207662_10488911 3300025918 Bacteria 846
276 Ga0207657_10017661 3300025919 Bacteria 6836
277 Ga0207657_10078525 3300025919 Bacteria 2779
278 Ga0207649_10369981 3300025920 Bacteria 1066
279 Ga0207652_10118303 3300025921 Bacteria 2355
280 Ga0207646_10203151 3300025922 Bacteria 1790
281 Ga0207646_11164489 3300025922 Bacteria 677
282 Ga0207681_10114544 3300025923 Unclassified 1967
283 Ga0207650_10023700 3300025925 Unclassified 4357
284 Ga0207659_10171235 3300025926 Bacteria 1713
285 Ga0207687_10006136 3300025927 Bacteria 7952
286 Ga0207687_10036753 3300025927 Bacteria 3337
287 Ga0207687_10355296 3300025927 Unclassified 1195
288 Ga0207687_11592387 3300025927 Bacteria 561
289 Ga0207700_10000001 3300025928 Bacteria 1122509
290 Ga0207700_10817916 3300025928 Bacteria 833
291 Ga0207664_10240255 3300025929 Bacteria 1577
292 Ga0207664_10884210 3300025929 Bacteria 802
293 Ga0207664_11976760 3300025929 Bacteria 506
294 Ga0207644_10512160 3300025931 Bacteria 991
295 Ga0207690_10047373 3300025932 Bacteria 2852
296 Ga0207706_10013156 3300025933 Bacteria 7530
297 Ga0207706_10248978 3300025933 Bacteria 1552
298 Ga0207706_10588216 3300025933 Bacteria 957
299 Ga0207706_10871565 3300025933 Bacteria 762
300 Ga0207706_10988898 3300025933 Bacteria 707
301 Ga0207686_10068020 3300025934 Bacteria 2280
302 Ga0207686_10687491 3300025934 Bacteria 812
303 Ga0207709_10061296 3300025935 Bacteria 2350
304 Ga0207709_10076561 3300025935 Bacteria 2142
305 Ga0207709_10162684 3300025935 Bacteria 1558
306 Ga0207709_10247365 3300025935 Bacteria 1300
307 Ga0207670_11361633 3300025936 Bacteria 602
308 Ga0207704_10027115 3300025938 Bacteria 3155
309 Ga0207665_10001078 3300025939 Bacteria 18369
310 Ga0207665_10024992 3300025939 Bacteria 3938
311 Ga0207691_10143726 3300025940 Bacteria 2101
312 Ga0207691_10310654 3300025940 Bacteria 1353
313 Ga0207689_10095046 3300025942 Bacteria 2448
314 Ga0207689_10363478 3300025942 Bacteria 1204
315 Ga0207661_10122502 3300025944 Bacteria 2216
316 Ga0207661_10549919 3300025944 Bacteria 1057
317 Ga0207661_10756500 3300025944 Unclassified 894
318 Ga0207661_10759818 3300025944 Bacteria 892
319 Ga0207679_10023725 3300025945 Bacteria 4199
320 Ga0207679_10173593 3300025945 Bacteria 1777
321 Ga0207679_10182015 3300025945 Bacteria 1739
322 Ga0207667_10040033 3300025949 Bacteria 4990
323 Ga0207667_10223162 3300025949 Bacteria 1931
324 Ga0207651_10199430 3300025960 Viruses 1603
325 Ga0207651_10221471 3300025960 Bacteria 1530
326 Ga0207712_10258549 3300025961 Bacteria 1411
327 Ga0207668_11436723 3300025972 Bacteria 622
328 Ga0207640_10127922 3300025981 Bacteria 1831
329 Ga0207640_10153065 3300025981 Bacteria 1697
330 Ga0207658_10075765 3300025986 Bacteria 2561
331 Ga0207658_11250359 3300025986 Bacteria 679
332 Ga0207677_10025147 3300026023 Bacteria 3710
333 Ga0207677_10424769 3300026023 Bacteria 1133
334 Ga0207677_10701145 3300026023 Bacteria 898
335 Ga0207677_11463859 3300026023 Bacteria 630
336 Ga0207703_10061715 3300026035 Bacteria 3069
337 Ga0207703_10126689 3300026035 Unclassified 2199
338 Ga0207639_10496314 3300026041 Unclassified 1114
339 Ga0207639_11837811 3300026041 Bacteria 566
340 Ga0207678_11816064 3300026067 Bacteria 533
341 Ga0207708_10069856 3300026075 Bacteria 2689
342 Ga0207708_11623297 3300026075 Bacteria 568
343 Ga0207702_10037690 3300026078 Bacteria 4048
344 Ga0207702_10256277 3300026078 Bacteria 1645
345 Ga0207648_10260125 3300026089 Bacteria 1548
346 Ga0207648_11840068 3300026089 Bacteria 567
347 Ga0207676_10172107 3300026095 Bacteria 1888
348 Ga0207676_11869057 3300026095 Bacteria 599
349 Ga0207674_10001139 3300026116 Bacteria 34497
350 Ga0207674_10178959 3300026116 Bacteria 2072
351 Ga0207674_10811890 3300026116 Bacteria 902
352 Ga0207674_10815467 3300026116 Bacteria 900
353 Ga0207675_100002126 3300026118 Bacteria 19645
354 Ga0207675_100644557 3300026118 Bacteria 1065
355 Ga0207683_10315769 3300026121 Bacteria 1431
356 Ga0207698_10446599 3300026142 Unclassified 1247
357 Ga0268266_10197103 3300028379 Bacteria 1842
358 Ga0268266_10211548 3300028379 Bacteria 1779
359 Ga0268265_11216364 3300028380 Bacteria 751
360 Ga0268264_11287648 3300028381 Bacteria 741
361 Ga0268264_11933129 3300028381 Bacteria 599
362 Ga0265325_10005643 3300031241 Bacteria 7697
363 Ga0307408_100162543 3300031548 Bacteria 1775
364 Ga0307408_101412494 3300031548 Bacteria 656
365 Ga0307405_10259145 3300031731 Unclassified 1298
366 Ga0307407_10402017 3300031903 Unclassified 983
367 Ga0307409_101217701 3300031995 Unclassified 776
368 Ga0307416_100605879 3300032002 Bacteria 1176
369 Ga0307415_100302041 3300032126 Unclassified 1326
370 Ga0373959_0125192 3300034820 Bacteria 632
371 Ga0373926_0008576 3300035083 Bacteria 3403
372 Ga0373936_0082094 3300035113 Bacteria 1343
373 Ga0373936_0083802 3300035113 Bacteria 1330
374 Ga0373941_0445566 3300035115 Bacteria 543
375 Ga0373943_0173129 3300035170 Bacteria 1182
376 Ga0373946_0353962 3300035171 Bacteria 735
377 Ga0316574_0061079 3300035398 Bacteria 2366
378 Ga0316574_0277287 3300035398 Bacteria 1068
379 Ga0373924_0419393 3300035410 Bacteria 599
380 Ga0373935_0025066 3300035692 Bacteria 3674
381 Ga0373927_0019625 3300035695 Bacteria 4431
382 Ga0373947_0051471 3300035725 Bacteria 2478
383 Ga0373947_0406739 3300035725 Bacteria 918
384 Ga0373937_0382765 3300036401 Bacteria 1334
385 Ga0373937_0680920 3300036401 Unclassified 974
386 Ga0373925_0024047 3300037068 Bacteria 4446
387 Ga0373925_0110481 3300037068 Bacteria 2123
388 Ga0395899_0018229 3300037312 Bacteria 5340
389 Ga0395900_0049213 3300037418 Bacteria 4342
390 Ga0395900_0176265 3300037418 Bacteria 2174
391 Ga0395900_0600567 3300037418 Bacteria 1041
392 Ga0395898_0100911 3300037466 Bacteria 2772
393 Ga0395905_0012677 3300037471 Bacteria 8110
394 Ga0395905_0717800 3300037471 Bacteria 902
395 Ga0436364_0691084 3300037853 Bacteria 1335
396 Ga0395901_0342805 3300038443 Bacteria 1543
397 Ga0395901_1373636 3300038443 Bacteria 666
398 Ga0436365_0507088 3300039437 Bacteria 957
399 Ga0436361_0216662 3300039447 Bacteria 949
400 Ga0436362_0661713 3300039453 Unclassified 1852
401 Ga0439453_0029909 3300041408 Bacteria 1027
402 Ga0439444_0133511 3300042437 Unclassified 589
403 Ga0466969_0190842 3300044656 Unclassified 936
404 Ga0466966_0184330 3300044684 Bacteria 1266
405 Ga0466963_1305436 3300044694 Bacteria 509
406 Ga0466968_0120353 3300044735 Bacteria 1187
407 Ga0466968_0576310 3300044735 Unclassified 566
408 Ga0466970_0249557 3300044765 Bacteria 994
409 Ga0466960_0462343 3300044901 Bacteria 739
410 Ga0451576_1629541 3300045051 Unclassified 669
411 Ga0451576_1768334 3300045051 Bacteria 639
412 Ga0466958_0091227 3300045836 Bacteria 1886
413 Ga0466958_0119511 3300045836 Bacteria 1649
414 Ga0466967_0852358 3300045976 Bacteria 906
415 Ga0466967_1703062 3300045976 Bacteria 628
416 Ga0495603_0022084 3300046455 Bacteria 3853
417 Ga0495603_0068680 3300046455 Bacteria 2085
418 Ga0495629_0130583 3300046459 Bacteria 1750
419 Ga0495638_0000259 3300046460 Bacteria 71397
420 Ga0495641_0138956 3300046461 Bacteria 1085
421 Ga0495641_0270221 3300046461 Bacteria 765
422 Ga0495651_0909657 3300046462 Bacteria 538
423 Ga0495653_0540109 3300046463 Bacteria 722
424 Ga0495580_0186719 3300046472 Bacteria 1431
425 Ga0495639_0672236 3300046475 Bacteria 534
426 Ga0495662_0321758 3300046476 Bacteria 761
427 Ga0495662_0349123 3300046476 Bacteria 727
428 Ga0495664_0013983 3300046477 Bacteria 4547
429 Ga0495594_0428494 3300046499 Bacteria 752
430 Ga0495606_0000173 3300046507 Bacteria 114285
431 Ga0495618_0379057 3300046514 Bacteria 868
432 Ga0495628_0249971 3300046516 Bacteria 1324
433 Ga0495630_0043337 3300046517 Bacteria 3361
434 Ga0495643_0267082 3300046522 Bacteria 792
435 Ga0495666_0318258 3300046526 Bacteria 702
436 Ga0495640_0805941 3300046533 Bacteria 559
437 Ga0495586_0128648 3300046535 Bacteria 1417
438 Ga0495609_0147994 3300046538 Bacteria 1000
439 Ga0495645_0622166 3300046543 Unclassified 662
440 Ga0495667_0553745 3300046559 Bacteria 718
441 Ga0495668_0183968 3300046616 Unclassified 1145
442 Ga0495588_0033869 3300046674 Bacteria 2583
443 Ga0495588_0241369 3300046674 Bacteria 953
444 Ga0495657_0456465 3300046675 Bacteria 748
445 Ga0495657_0824713 3300046675 Bacteria 529
446 Ga0495646_0170153 3300046680 Bacteria 1201
447 Ga0495647_0147775 3300046681 Bacteria 1006
448 Ga0495658_0124779 3300046683 Bacteria 1561
449 Ga0495658_0394726 3300046683 Bacteria 882
450 Ga0495613_0240463 3300046689 Bacteria 1266
451 Ga0495624_0149435 3300046690 Bacteria 1429
452 Ga0495671_0469932 3300046692 Bacteria 601
453 Ga0495649_0007293 3300046694 Bacteria 6763
454 Ga0495589_0234027 3300046794 Bacteria 861
455 Ga0495581_0020115 3300047315 Bacteria 3875
456 Ga0495674_0011410 3300047319 Bacteria 8385
457 Ga0495674_1001070 3300047319 Bacteria 640
458 Ga0495676_0013909 3300047321 Bacteria 7214
459 Ga0495676_0123906 3300047321 Bacteria 1876
460 Ga0495680_0152767 3300047322 Bacteria 1682
461 Ga0495681_0017388 3300047470 Bacteria 3993
462 Ga0495684_0034498 3300047471 Bacteria 3882
463 Ga0495684_0857118 3300047471 Unclassified 589
464 Ga0495686_0164155 3300047472 Bacteria 1296
465 Ga0496100_0083925 3300048903 Bacteria 2158
466 Ga0496100_0438811 3300048903 Bacteria 999
467 Ga0496100_0557940 3300048903 Bacteria 886
468 Ga0496101_0131255 3300048904 Bacteria 1902
469 Ga0496101_0146209 3300048904 Bacteria 1805
470 Ga0496101_0279807 3300048904 Bacteria 1304
471 Ga0496101_0405369 3300048904 Bacteria 1074
472 Ga0496102_0014140 3300048905 Bacteria 6933
473 Ga0496102_0023595 3300048905 Bacteria 5465
474 Ga0496102_0184102 3300048905 Bacteria 1968
475 Ga0496102_0336448 3300048905 Unclassified 1422
476 Ga0496102_0960740 3300048905 Bacteria 775
477 Ga0496102_1891434 3300048905 Unclassified 513
478 Ga0496103_0545290 3300048906 Bacteria 741
479 Ga0496104_0112259 3300048907 Bacteria 2613
480 Ga0496104_0211814 3300048907 Bacteria 1849
481 Ga0496104_1112918 3300048907 Bacteria 693
482 Ga0496104_1141337 3300048907 Bacteria 683
483 Ga0496105_0550988 3300048908 Bacteria 900
484 Ga0496106_0015414 3300048909 Bacteria 5656
485 Ga0496106_0224044 3300048909 Bacteria 1500
486 Ga0496106_0391368 3300048909 Bacteria 1117
487 Ga0496107_0028650 3300048910 Bacteria 3959
488 Ga0496107_0033220 3300048910 Bacteria 3691
489 Ga0496107_0043866 3300048910 Bacteria 3213
490 Ga0496107_0112017 3300048910 Bacteria 2006
491 Ga0496107_0191489 3300048910 Bacteria 1520
492 Ga0496108_0055375 3300048911 Bacteria 3330
493 Ga0496108_0121628 3300048911 Bacteria 2239
494 Ga0496108_0377318 3300048911 Bacteria 1238
495 Ga0496108_0646786 3300048911 Bacteria 919
496 Ga0496109_0048627 3300048912 Bacteria 3858
497 Ga0496109_0126509 3300048912 Bacteria 2383
498 Ga0496109_0150785 3300048912 Bacteria 2177
499 Ga0496109_0173778 3300048912 Bacteria 2022
500 Ga0496109_0480929 3300048912 Bacteria 1172
501 Ga0496110_0010822 3300048913 Bacteria 7439
502 Ga0496110_0014322 3300048913 Bacteria 6580
503 Ga0496110_0216914 3300048913 Bacteria 1740
504 Ga0496110_1212466 3300048913 Unclassified 663
505 Ga0496111_0019301 3300048914 Bacteria 4733
506 Ga0496111_0068402 3300048914 Bacteria 2581
507 Ga0496111_0135833 3300048914 Bacteria 1821
508 Ga0496111_1150683 3300048914 Bacteria 551
509 Ga0496112_0017257 3300048915 Bacteria 6777
510 Ga0496112_1455539 3300048915 Unclassified 599
511 Ga0496113_0118979 3300048916 Bacteria 2063
512 Ga0496114_0148907 3300048917 Bacteria 2030
513 Ga0496114_0167524 3300048917 Bacteria 1913
514 Ga0496115_0001715 3300048918 Bacteria 15721
515 Ga0496115_0053115 3300048918 Bacteria 3252
516 Ga0496115_0967422 3300048918 Bacteria 653
517 Ga0496126_0025340 3300048929 Bacteria 5707
518 Ga0495678_037060 3300049459 Bacteria 1985
519 Ga0495682_0035482 3300049460 Bacteria 1837
520 Ga0501067_0052738 3300049583 Unclassified 2253
521 Ga0501081_1290636 3300049743 Bacteria 554
522 nmdc:mga03683_48576_c1 3300050489 Bacteria 1764
523 nmdc:mga03683_6749_c1 3300050489 Bacteria 3949
524 nmdc:mga03n38_428573_c1 3300050490 Bacteria 732
525 nmdc:mga0yw44_127078_c1 3300050492 Bacteria 1647
526 nmdc:mga0yw44_138816_c1 3300050492 Bacteria 1578
527 nmdc:mga0k408_525857_c1 3300050493 Bacteria 700
528 nmdc:mga06z11_266936_c1 3300050494 Bacteria 1011
529 nmdc:mga07m45_101209_c2 3300050496 Bacteria 1246
530 nmdc:mga0n895_2018867_c1 3300050512 Unclassified 534
531 nmdc:mga0n895_2376_c1 3300050512 Bacteria 14673
532 nmdc:mga0n895_325728_c1 3300050512 Bacteria 1557
533 nmdc:mga0n895_588255_c1 3300050512 Unclassified 1116
534 nmdc:mga0n895_640975_c1 3300050512 Bacteria 1062
535 nmdc:mga0rr50_253567_c1 3300050513 Unclassified 1462
536 nmdc:mga0rr50_363006_c1 3300050513 Bacteria 1219
537 nmdc:mga0rr50_555343_c1 3300050513 Bacteria 978
538 nmdc:mga0rr50_62782_c1 3300050513 Bacteria 2804
539 nmdc:mga08x19_155390_c1 3300050514 Bacteria 1551
540 nmdc:mga08x19_700861_c1 3300050514 Bacteria 718
541 nmdc:mga0a205_10277_c2 3300050515 Bacteria 7348
542 nmdc:mga0a205_1216972_c1 3300050515 Bacteria 601
543 nmdc:mga0a205_288672_c1 3300050515 Bacteria 1515
544 nmdc:mga0a205_38245_c1 3300050515 Bacteria 4615
545 Ga0495601_0004783 3300053077 Bacteria 7852
546 Ga0495612_0004211 3300053078 Bacteria 5966
547 Ga0495619_0038894 3300053085 Bacteria 3104
548 Ga0495619_0370906 3300053085 Unclassified 989
549 Ga0500651_0050348 3300053093 Bacteria 2615
550 Ga0500618_001235 3300053125 Bacteria 11961
551 Ga0530510_0139540 3300061734 Unclassified 1785
552 2739731487 2739367700 Bacteria 4747630
553 2819682602 2818991461 Bacteria 7026071
554 2854899856 2854896431 Bacteria 5869725
555 2928963491 2928963466 Bacteria 5165703
556 Ga0105249_13104116
557 JGI24745J21846_1023844
558 JGI25162J39368_1001372
559 rootH1_10099588
560 Ga0055542_1000098
561 Ga0065715_10970841
562 Ga0070676_11252677
563 Ga0070683_100005861
564 Ga0070683_100051897
565 Ga0070683_100076814
566 Ga0070683_100181126
567 Ga0070683_100830557
568 Ga0068869_100068199
569 Ga0068869_100119905
570 Ga0068869_100989006
571 Ga0070666_10296539
572 Ga0070682_100006996
573 Ga0070682_100018769
574 Ga0068868_100009919
575 Ga0068868_100518866
576 Ga0068868_100542364
577 Ga0068868_100803367
578 Ga0070660_100035660
579 Ga0070660_100042408
580 Ga0070689_100667273
581 Ga0070689_101636149
582 Ga0070691_10089692
583 Ga0070687_100425400
584 Ga0070661_100302253
585 Ga0070668_100397849
586 Ga0070668_100953572
587 Ga0070668_101132416
588 Ga0070668_101180594
589 Ga0070669_100050717
590 Ga0070675_100134451
591 Ga0070675_100203636
592 Ga0070671_100274666
593 Ga0070671_100377826
594 Ga0070674_100033154
595 Ga0070674_100175799
596 Ga0070674_100855447
597 Ga0070673_100140426
598 Ga0070688_100047976
599 Ga0070709_10070067
600 Ga0070709_10380816
601 Ga0070709_10391082
602 Ga0070709_10742231
603 Ga0070714_100009206
604 Ga0070714_100019007
605 Ga0070714_100082044
606 Ga0070714_101575307
607 Ga0070713_100171758
608 Ga0070713_100775026
609 Ga0070710_10688079
610 Ga0070701_10532750
611 Ga0070701_10534934
612 Ga0070711_100005082
613 Ga0070711_100330805
614 Ga0070711_100687200
615 Ga0070705_100608845
616 Ga0070705_101124176
617 Ga0070700_100110955
618 Ga0070700_100304482
619 Ga0070700_101088534
620 Ga0070694_100426200
621 Ga0070708_100098453
622 Ga0070708_101469299
623 Ga0070663_100295347
624 Ga0070678_100122651
625 Ga0070678_100402952
626 Ga0070662_100084835
627 Ga0070662_100678281
628 Ga0070662_101066153
629 Ga0070681_10831344
630 Ga0068867_100284902
631 Ga0068867_100626840
632 Ga0070685_10001199
633 Ga0070685_10262657
634 Ga0070685_10853729
635 Ga0070706_100066850
636 Ga0070707_100045842
637 Ga0070707_101542674
638 Ga0070698_100030092
639 Ga0070698_100089162
640 Ga0070698_100222996
641 Ga0070698_101334104
642 Ga0070698_101704010
643 Ga0070699_100028774
644 Ga0070679_100941930
645 Ga0070684_100000816
646 Ga0070684_100014440
647 Ga0070697_100255062
648 Ga0070697_100408047
649 Ga0068853_100183921
650 Ga0068853_100200937
651 Ga0070672_100129618
652 Ga0070672_100415541
653 Ga0070686_100426234
654 Ga0070686_100463382
655 Ga0070695_100821544
656 Ga0070696_100263781
657 Ga0070693_100062364
658 Ga0070693_100069381
659 Ga0070704_101511669
660 Ga0068855_100190108
661 Ga0068855_100525171
662 Ga0068855_100626408
663 Ga0068855_100964841
664 Ga0070664_100037589
665 Ga0070664_100052709
666 Ga0070664_100203897
667 Ga0068857_100021154
668 Ga0068857_100131911
669 Ga0068854_100309394
670 Ga0068854_100806108
671 Ga0068856_100354216
672 Ga0068856_101187466
673 Ga0070702_100032679
674 Ga0070702_100079788
675 Ga0068852_100034171
676 Ga0068859_100532592
677 Ga0068859_100898253
678 Ga0068864_100274495
679 Ga0068864_100714390
680 Ga0068866_10263610
681 Ga0068861_100098032
682 Ga0068861_100470608
683 Ga0068861_100669294
684 Ga0068851_10758548
685 Ga0068870_10157158
686 Ga0068863_101295934
687 Ga0068858_100156610
688 Ga0068858_100310410
689 Ga0068860_100242659
690 Ga0068860_100596021
691 Ga0068860_100754319
692 Ga0081455_10003888
693 Ga0081455_10133626
694 Ga0070717_10183151
695 Ga0070717_10313424
696 Ga0070717_10738914
697 Ga0070717_10954475
698 Ga0075365_10018959
699 Ga0075432_10119833
700 Ga0075432_10273224
701 Ga0070716_100210579
702 Ga0070716_101671010
703 Ga0070712_100085360
704 Ga0070712_100126735
705 Ga0070712_100282786
706 Ga0070712_100377162
707 Ga0070712_100439420
708 Ga0075362_10006716
709 Ga0097621_100093764
710 Ga0097621_100896750
711 Ga0097621_101296393
712 Ga0068871_101267301
713 Ga0075428_101710821
714 Ga0075431_100332879
715 Ga0075433_10033054
716 Ga0075433_10077160
717 Ga0075433_10138619
718 Ga0075434_100004292
719 Ga0075434_100014875
720 Ga0075434_100254882
721 Ga0075434_100629283
722 Ga0075434_101921116
723 Ga0075434_102263903
724 Ga0068865_100364182
725 Ga0068865_100518296
726 Ga0075436_100170180
727 Ga0075436_100418431
728 Ga0097620_100532641
729 Ga0097620_100898283
730 Ga0075435_100033163
731 Ga0075435_100095653
732 Ga0075435_100206437
733 Ga0075435_100249193
734 Ga0099794_10599303
735 Ga0099795_10115431
736 Ga0105240_10495762
737 Ga0105240_11381759
738 Ga0111539_10257024
739 Ga0105245_10009770
740 Ga0105245_10058395
741 Ga0105245_10084512
742 Ga0105245_10455464
743 Ga0105247_10253329
744 Ga0114129_10482972
745 Ga0114129_11175781
746 Ga0114129_11598245
747 Ga0114129_11842199
748 Ga0114129_12051702
749 Ga0105243_10097293
750 Ga0105243_10160114
751 Ga0105243_10376404
752 Ga0105241_10207580
753 Ga0105241_10721368
754 Ga0105242_10035333
755 Ga0105242_10104602
756 Ga0105242_10711742
757 Ga0105242_10714306
758 Ga0105248_10160378
759 Ga0105237_10114356
760 Ga0105238_10019520
761 Ga0105238_10881987
762 Ga0105249_10498699
763 Ga0105249_10823431
764 Ga0105249_12317971
765 Ga0105239_10054049
766 Ga0105239_10170786
767 Ga0105239_10350668
768 Ga0105239_10766833
769 Ga0105239_11126954
770 Ga0105246_10022018
771 Ga0105246_11099006
772 Ga0157336_1024308
773 Ga0157347_1023295
774 Ga0157327_1056391
775 Ga0157371_11107994
776 Ga0157369_12089370
777 Ga0157374_10043384
778 Ga0157378_11121471
779 Ga0163162_10038264
780 Ga0163162_10132110
781 Ga0163162_10632706
782 Ga0157372_10415699
783 Ga0157372_10478754
784 Ga0157375_10198258
785 Ga0163163_10017274
786 Ga0163163_10444573
787 Ga0163163_11871499
788 Ga0157380_11295191
789 Ga0157377_10030596
790 Ga0157377_10068056
791 Ga0157379_10097057
792 Ga0157376_10033534
793 Ga0157376_11751765
794 Ga0163161_10058571
795 Ga0163161_10884589
796 Ga0197907_11015145
797 Ga0213873_10030602
798 Ga0213876_10670357
799 Ga0213875_10366306
800 Ga0224712_10285935
801 Ga0209672_100523
802 Ga0207427_102837
803 Ga0209437_100151
804 Ga0209437_104021
805 Ga0209026_1004977
806 Ga0209148_1000005
807 Ga0209233_1024989
808 Ga0209455_1002274
809 Ga0209675_1051717
810 Ga0207692_10023996
811 Ga0207692_10187021
812 Ga0207710_10169548
813 Ga0207688_10077114
814 Ga0207688_10097015
815 Ga0207685_10194436
816 Ga0207699_10088086
817 Ga0207643_10286177
818 Ga0207684_11739960
819 Ga0207654_10278685
820 Ga0207695_10410660
821 Ga0207671_10131700
822 Ga0207693_10018753
823 Ga0207693_10081030
824 Ga0207693_10340112
825 Ga0207693_10889427
826 Ga0207663_10005397
827 Ga0207663_10036621
828 Ga0207663_10251709
829 Ga0207663_10384728
830 Ga0207662_10488911
831 Ga0207657_10017661
832 Ga0207657_10078525
833 Ga0207649_10369981
834 Ga0207652_10118303
835 Ga0207646_10203151
836 Ga0207646_11164489
837 Ga0207681_10114544
838 Ga0207650_10023700
839 Ga0207659_10171235
840 Ga0207687_10006136
841 Ga0207687_10036753
842 Ga0207687_10355296
843 Ga0207687_11592387
844 Ga0207700_10000001
845 Ga0207700_10817916
846 Ga0207664_10240255
847 Ga0207664_10884210
848 Ga0207664_11976760
849 Ga0207644_10512160
850 Ga0207690_10047373
851 Ga0207706_10013156
852 Ga0207706_10248978
853 Ga0207706_10588216
854 Ga0207706_10871565
855 Ga0207706_10988898
856 Ga0207686_10068020
857 Ga0207686_10687491
858 Ga0207709_10061296
859 Ga0207709_10076561
860 Ga0207709_10162684
861 Ga0207709_10247365
862 Ga0207670_11361633
863 Ga0207704_10027115
864 Ga0207665_10001078
865 Ga0207665_10024992
866 Ga0207691_10143726
867 Ga0207691_10310654
868 Ga0207689_10095046
869 Ga0207689_10363478
870 Ga0207661_10122502
871 Ga0207661_10549919
872 Ga0207661_10756500
873 Ga0207661_10759818
874 Ga0207679_10023725
875 Ga0207679_10173593
876 Ga0207679_10182015
877 Ga0207667_10040033
878 Ga0207667_10223162
879 Ga0207651_10199430
880 Ga0207651_10221471
881 Ga0207712_10258549
882 Ga0207668_11436723
883 Ga0207640_10127922
884 Ga0207640_10153065
885 Ga0207658_10075765
886 Ga0207658_11250359
887 Ga0207677_10025147
888 Ga0207677_10424769
889 Ga0207677_10701145
890 Ga0207677_11463859
891 Ga0207703_10061715
892 Ga0207703_10126689
893 Ga0207639_10496314
894 Ga0207639_11837811
895 Ga0207678_11816064
896 Ga0207708_10069856
897 Ga0207708_11623297
898 Ga0207702_10037690
899 Ga0207702_10256277
900 Ga0207648_10260125
901 Ga0207648_11840068
902 Ga0207676_10172107
903 Ga0207676_11869057
904 Ga0207674_10001139
905 Ga0207674_10178959
906 Ga0207674_10811890
907 Ga0207674_10815467
908 Ga0207675_100002126
909 Ga0207675_100644557
910 Ga0207683_10315769
911 Ga0207698_10446599
912 Ga0268266_10197103
913 Ga0268266_10211548
914 Ga0268265_11216364
915 Ga0268264_11287648
916 Ga0268264_11933129
917 Ga0265325_10005643
918 Ga0307408_100162543
919 Ga0307408_101412494
920 Ga0307405_10259145
921 Ga0307407_10402017
922 Ga0307409_101217701
923 Ga0307416_100605879
924 Ga0307415_100302041
925 Ga0373959_0125192
926 Ga0373926_0008576
927 Ga0373936_0082094
928 Ga0373936_0083802
929 Ga0373941_0445566
930 Ga0373943_0173129
931 Ga0373946_0353962
932 Ga0316574_0061079
933 Ga0316574_0277287
934 Ga0373924_0419393
935 Ga0373935_0025066
936 Ga0373927_0019625
937 Ga0373947_0051471
938 Ga0373947_0406739
939 Ga0373937_0382765
940 Ga0373937_0680920
941 Ga0373925_0024047
942 Ga0373925_0110481
943 Ga0395899_0018229
944 Ga0395900_0049213
945 Ga0395900_0176265
946 Ga0395900_0600567
947 Ga0395898_0100911
948 Ga0395905_0012677
949 Ga0395905_0717800
950 Ga0436364_0691084
951 Ga0395901_0342805
952 Ga0395901_1373636
953 Ga0436365_0507088
954 Ga0436361_0216662
955 Ga0436362_0661713
956 Ga0439453_0029909
957 Ga0439444_0133511
958 Ga0466969_0190842
959 Ga0466966_0184330
960 Ga0466963_1305436
961 Ga0466968_0120353
962 Ga0466968_0576310
963 Ga0466970_0249557
964 Ga0466960_0462343
965 Ga0451576_1629541
966 Ga0451576_1768334
967 Ga0466958_0091227
968 Ga0466958_0119511
969 Ga0466967_0852358
970 Ga0466967_1703062
971 Ga0495603_0022084
972 Ga0495603_0068680
973 Ga0495629_0130583
974 Ga0495638_0000259
975 Ga0495641_0138956
976 Ga0495641_0270221
977 Ga0495651_0909657
978 Ga0495653_0540109
979 Ga0495580_0186719
980 Ga0495639_0672236
981 Ga0495662_0321758
982 Ga0495662_0349123
983 Ga0495664_0013983
984 Ga0495594_0428494
985 Ga0495606_0000173
986 Ga0495618_0379057
987 Ga0495628_0249971
988 Ga0495630_0043337
989 Ga0495643_0267082
990 Ga0495666_0318258
991 Ga0495640_0805941
992 Ga0495586_0128648
993 Ga0495609_0147994
994 Ga0495645_0622166
995 Ga0495667_0553745
996 Ga0495668_0183968
997 Ga0495588_0033869
998 Ga0495588_0241369
999 Ga0495657_0456465
1000 Ga0495657_0824713
1001 Ga0495646_0170153
1002 Ga0495647_0147775
1003 Ga0495658_0124779
1004 Ga0495658_0394726
1005 Ga0495613_0240463
1006 Ga0495624_0149435
1007 Ga0495671_0469932
1008 Ga0495649_0007293
1009 Ga0495589_0234027
1010 Ga0495581_0020115
1011 Ga0495674_0011410
1012 Ga0495674_1001070
1013 Ga0495676_0013909
1014 Ga0495676_0123906
1015 Ga0495680_0152767
1016 Ga0495681_0017388
1017 Ga0495684_0034498
1018 Ga0495684_0857118
1019 Ga0495686_0164155
1020 Ga0496100_0083925
1021 Ga0496100_0438811
1022 Ga0496100_0557940
1023 Ga0496101_0131255
1024 Ga0496101_0146209
1025 Ga0496101_0279807
1026 Ga0496101_0405369
1027 Ga0496102_0014140
1028 Ga0496102_0023595
1029 Ga0496102_0184102
1030 Ga0496102_0336448
1031 Ga0496102_0960740
1032 Ga0496102_1891434
1033 Ga0496103_0545290
1034 Ga0496104_0112259
1035 Ga0496104_0211814
1036 Ga0496104_1112918
1037 Ga0496104_1141337
1038 Ga0496105_0550988
1039 Ga0496106_0015414
1040 Ga0496106_0224044
1041 Ga0496106_0391368
1042 Ga0496107_0028650
1043 Ga0496107_0033220
1044 Ga0496107_0043866
1045 Ga0496107_0112017
1046 Ga0496107_0191489
1047 Ga0496108_0055375
1048 Ga0496108_0121628
1049 Ga0496108_0377318
1050 Ga0496108_0646786
1051 Ga0496109_0048627
1052 Ga0496109_0126509
1053 Ga0496109_0150785
1054 Ga0496109_0173778
1055 Ga0496109_0480929
1056 Ga0496110_0010822
1057 Ga0496110_0014322
1058 Ga0496110_0216914
1059 Ga0496110_1212466
1060 Ga0496111_0019301
1061 Ga0496111_0068402
1062 Ga0496111_0135833
1063 Ga0496111_1150683
1064 Ga0496112_0017257
1065 Ga0496112_1455539
1066 Ga0496113_0118979
1067 Ga0496114_0148907
1068 Ga0496114_0167524
1069 Ga0496115_0001715
1070 Ga0496115_0053115
1071 Ga0496115_0967422
1072 Ga0496126_0025340
1073 Ga0495678_037060
1074 Ga0495682_0035482
1075 Ga0501067_0052738
1076 Ga0501081_1290636
1077 nmdc:mga03683_48576_c1
1078 nmdc:mga03683_6749_c1
1079 nmdc:mga03n38_428573_c1
1080 nmdc:mga0yw44_127078_c1
1081 nmdc:mga0yw44_138816_c1
1082 nmdc:mga0k408_525857_c1
1083 nmdc:mga06z11_266936_c1
1084 nmdc:mga07m45_101209_c2
1085 nmdc:mga0n895_2018867_c1
1086 nmdc:mga0n895_2376_c1
1087 nmdc:mga0n895_325728_c1
1088 nmdc:mga0n895_588255_c1
1089 nmdc:mga0n895_640975_c1
1090 nmdc:mga0rr50_253567_c1
1091 nmdc:mga0rr50_363006_c1
1092 nmdc:mga0rr50_555343_c1
1093 nmdc:mga0rr50_62782_c1
1094 nmdc:mga08x19_155390_c1
1095 nmdc:mga08x19_700861_c1
1096 nmdc:mga0a205_10277_c2
1097 nmdc:mga0a205_1216972_c1
1098 nmdc:mga0a205_288672_c1
1099 nmdc:mga0a205_38245_c1
1100 Ga0495601_0004783
1101 Ga0495612_0004211
1102 Ga0495619_0038894
1103 Ga0495619_0370906
1104 Ga0500651_0050348
1105 Ga0500618_001235
1106 Ga0530510_0139540
1107 2739731487
1108 2819682602
1109 2854899856
1110 2928963491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

35

135

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8438 2 126
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.828 2 98
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.8209 2 111
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7548 2 126
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7435 2 98
ID Description Score Start End Superfamily
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8506 2 111 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8479 2 125 3.90.1590.10
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.827 2 98 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8032 4 100 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8006 2 125 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A147G8T4-F1-model_v4 deleted 0.9938 2 111
AF-A0A3S1FVG7-F1-model_v4 GFA family protein 0.9929 1 81 GO:0016846
GO:0046872
AF-A0A7W9BG56-F1-model_v4 CENP-V/GFA domain-containing protein 0.9919 2 125 GO:0016846
GO:0046872
AF-A0A447TEJ9-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme 0.991 1 103 GO:0016846
GO:0046872
AF-A0A1G8LP53-F1-model_v4 Uncharacterized conserved protein 0.9904 1 127 GO:0016846
GO:0046872

Map