F463089

General Info

Members Datasets Scaffolds Average Seq Length
555 270 1110 152

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10039630|Ga0081455_100396303
Length 186
Sequence MAGLRSGCATHRIDPKLLSELAPELNVVHVGNVAGMRVAVAFDHRGVKLRERVLEELTALGHEAVDLGTDDPSVRIDYPDKAREVGEAIRAGEAERGVLVCGSGVGASVAASKLDGIRAAVCHDAYSAHQGVEHDDMNVLCLGSEVVGAELAADLVRTFLSAGFDGGERYVKRLRMIEDLERKSYA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
84 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 17.12
Rhizosphere 81.8
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10039630 3300005937 Bacteria 4161
2 JGI25406J46586_10177387 3300003203 Bacteria 621
3 Ga0070676_10112693 3300005328 Bacteria 1696
4 Ga0070683_100013513 3300005329 Bacteria 7122
5 Ga0070683_100027501 3300005329 Bacteria 5129
6 Ga0070683_100083916 3300005329 Bacteria 2984
7 Ga0070683_100392791 3300005329 Bacteria 1323
8 Ga0070683_101118026 3300005329 Bacteria 757
9 Ga0070683_101690559 3300005329 Bacteria 609
10 Ga0070683_101908580 3300005329 Bacteria 571
11 Ga0070690_100013603 3300005330 Bacteria 4813
12 Ga0068869_101218331 3300005334 Bacteria 662
13 Ga0068869_101478648 3300005334 Bacteria 603
14 Ga0070680_100061151 3300005336 Bacteria 3083
15 Ga0070680_100235135 3300005336 Bacteria 1548
16 Ga0070682_100054968 3300005337 Bacteria 2500
17 Ga0070682_100177829 3300005337 Bacteria 1484
18 Ga0068868_100114504 3300005338 Bacteria 2194
19 Ga0068868_100940129 3300005338 Bacteria 788
20 Ga0070660_100272129 3300005339 Bacteria 1384
21 Ga0070691_10016143 3300005341 Bacteria 3431
22 Ga0070691_10252450 3300005341 Bacteria 946
23 Ga0070691_10534197 3300005341 Bacteria 683
24 Ga0070687_100122461 3300005343 Bacteria 1489
25 Ga0070692_10055300 3300005345 Bacteria 2075
26 Ga0070668_100021452 3300005347 Bacteria 4880
27 Ga0070668_100042886 3300005347 Bacteria 3467
28 Ga0070671_100182956 3300005355 Bacteria 1775
29 Ga0070674_100059538 3300005356 Bacteria 2659
30 Ga0070674_100141841 3300005356 Bacteria 1804
31 Ga0070673_100754033 3300005364 Bacteria 896
32 Ga0070673_100827914 3300005364 Bacteria 856
33 Ga0070659_100049858 3300005366 Bacteria 3292
34 Ga0070667_100923481 3300005367 Bacteria 813
35 Ga0070713_100468036 3300005436 Bacteria 1186
36 Ga0070701_10018539 3300005438 Bacteria 3273
37 Ga0070705_100011889 3300005440 Bacteria 4407
38 Ga0070700_100044560 3300005441 Bacteria 2733
39 Ga0070694_100130174 3300005444 Bacteria 1817
40 Ga0070708_100157721 3300005445 Bacteria 2113
41 Ga0070708_100513066 3300005445 Bacteria 1131
42 Ga0070663_100245926 3300005455 Bacteria 1414
43 Ga0070663_101173616 3300005455 Bacteria 674
44 Ga0070678_100039470 3300005456 Bacteria 3331
45 Ga0070662_100095710 3300005457 Bacteria 2239
46 Ga0070662_100194577 3300005457 Bacteria 1606
47 Ga0070681_10001644 3300005458 Bacteria 19947
48 Ga0070681_10130288 3300005458 Bacteria 2447
49 Ga0068867_100188010 3300005459 Bacteria 1646
50 Ga0068867_100205686 3300005459 Bacteria 1578
51 Ga0068867_100486861 3300005459 Bacteria 1058
52 Ga0068867_100933894 3300005459 Bacteria 783
53 Ga0070707_100031110 3300005468 Bacteria 5082
54 Ga0070707_100752372 3300005468 Bacteria 938
55 Ga0070698_101034859 3300005471 Bacteria 769
56 Ga0070679_100556756 3300005530 Bacteria 1090
57 Ga0070679_100827968 3300005530 Bacteria 869
58 Ga0070684_100000327 3300005535 Bacteria 32866
59 Ga0070684_100012423 3300005535 Bacteria 6825
60 Ga0070684_100418582 3300005535 Bacteria 1236
61 Ga0070672_100842516 3300005543 Bacteria 808
62 Ga0070686_100022587 3300005544 Bacteria 3748
63 Ga0070686_100082236 3300005544 Bacteria 2135
64 Ga0070695_100046991 3300005545 Bacteria 2755
65 Ga0070695_100292221 3300005545 Bacteria 1202
66 Ga0070695_100461261 3300005545 Bacteria 975
67 Ga0070695_101046496 3300005545 Bacteria 666
68 Ga0070696_100016897 3300005546 Bacteria 4922
69 Ga0070696_100053482 3300005546 Bacteria 2811
70 Ga0070696_100450182 3300005546 Bacteria 1016
71 Ga0070693_100017922 3300005547 Bacteria 3691
72 Ga0070693_100018460 3300005547 Bacteria 3644
73 Ga0070665_100875402 3300005548 Bacteria 911
74 Ga0070704_100333749 3300005549 Bacteria 1274
75 Ga0070704_100886140 3300005549 Bacteria 802
76 Ga0070704_101107176 3300005549 Bacteria 719
77 Ga0068855_100025493 3300005563 Bacteria 7074
78 Ga0068855_100358658 3300005563 Bacteria 1604
79 Ga0070664_100066119 3300005564 Bacteria 3087
80 Ga0068854_100077758 3300005578 Bacteria 2443
81 Ga0068854_100600269 3300005578 Bacteria 940
82 Ga0068856_100051894 3300005614 Bacteria 4043
83 Ga0068856_100068487 3300005614 Bacteria 3508
84 Ga0068856_100096855 3300005614 Bacteria 2939
85 Ga0068856_100147270 3300005614 Bacteria 2362
86 Ga0068856_100509494 3300005614 Bacteria 1224
87 Ga0068856_100550583 3300005614 Bacteria 1175
88 Ga0068856_100676248 3300005614 Bacteria 1053
89 Ga0070702_100012846 3300005615 Bacteria 4214
90 Ga0068852_100131209 3300005616 Bacteria 2307
91 Ga0068859_100867171 3300005617 Bacteria 988
92 Ga0068866_10152454 3300005718 Bacteria 1340
93 Ga0068866_10399663 3300005718 Bacteria 886
94 Ga0068861_100018933 3300005719 Bacteria 4910
95 Ga0068861_100670625 3300005719 Bacteria 960
96 Ga0068870_10117916 3300005840 Bacteria 1525
97 Ga0068863_102026573 3300005841 Bacteria 586
98 Ga0068860_100167436 3300005843 Bacteria 2122
99 Ga0068860_101390500 3300005843 Bacteria 723
100 Ga0081455_10001226 3300005937 Bacteria 32083
101 Ga0081455_10010590 3300005937 Bacteria 9332
102 Ga0081455_10369621 3300005937 Bacteria 1005
103 Ga0081455_10462279 3300005937 Bacteria 864
104 Ga0081540_1015979 3300005983 Bacteria 4727
105 Ga0081539_10000095 3300005985 Bacteria 204474
106 Ga0081539_10000473 3300005985 Bacteria 85174
107 Ga0075364_10026456 3300006051 Bacteria 3701
108 Ga0075432_10047107 3300006058 Bacteria 1515
109 Ga0075366_10368046 3300006195 Bacteria 883
110 Ga0097621_100143838 3300006237 Bacteria 2040
111 Ga0068871_100184033 3300006358 Bacteria 1797
112 Ga0075428_101927427 3300006844 Bacteria 613
113 Ga0075428_102001285 3300006844 Bacteria 600
114 Ga0075430_100044070 3300006846 Bacteria 3773
115 Ga0075431_100699431 3300006847 Bacteria 991
116 Ga0075431_100769950 3300006847 Bacteria 937
117 Ga0075431_101392625 3300006847 Bacteria 661
118 Ga0075433_10061450 3300006852 Bacteria 3291
119 Ga0075433_11721211 3300006852 Bacteria 540
120 Ga0075434_100635532 3300006871 Bacteria 1086
121 Ga0068865_100156772 3300006881 Bacteria 1732
122 Ga0097620_100867217 3300006931 Bacteria 988
123 Ga0075435_100028319 3300007076 Bacteria 4393
124 Ga0075435_100941008 3300007076 Bacteria 754
125 Ga0105240_10320110 3300009093 Bacteria 1768
126 Ga0111539_10006251 3300009094 Bacteria 15372
127 Ga0111539_10100841 3300009094 Bacteria 3390
128 Ga0111539_11284983 3300009094 Bacteria 849
129 Ga0105245_10010000 3300009098 Bacteria 8260
130 Ga0105245_10012706 3300009098 Bacteria 7332
131 Ga0105245_10158417 3300009098 Bacteria 2146
132 Ga0105245_10785258 3300009098 Bacteria 990
133 Ga0105247_10321167 3300009101 Bacteria 1080
134 Ga0114129_10040999 3300009147 Bacteria 6525
135 Ga0114129_10315838 3300009147 Bacteria 2078
136 Ga0114129_11167148 3300009147 Bacteria 961
137 Ga0114129_11536774 3300009147 Bacteria 817
138 Ga0105243_10047718 3300009148 Bacteria 3373
139 Ga0105243_10073711 3300009148 Bacteria 2767
140 Ga0105243_10144535 3300009148 Bacteria 2033
141 Ga0105243_10454643 3300009148 Bacteria 1202
142 Ga0105243_12803690 3300009148 Bacteria 528
143 Ga0105241_10174717 3300009174 Bacteria 1777
144 Ga0105241_10195614 3300009174 Bacteria 1686
145 Ga0105241_10544311 3300009174 Bacteria 1041
146 Ga0105242_10179289 3300009176 Bacteria 1868
147 Ga0105242_10187064 3300009176 Bacteria 1831
148 Ga0105242_10842982 3300009176 Bacteria 911
149 Ga0105248_10651663 3300009177 Bacteria 1188
150 Ga0105237_10588989 3300009545 Bacteria 1119
151 Ga0105238_10142608 3300009551 Bacteria 2372
152 Ga0105238_10174823 3300009551 Bacteria 2124
153 Ga0105249_10026080 3300009553 Bacteria 5264
154 Ga0105249_10232142 3300009553 Bacteria 1820
155 Ga0105249_12618412 3300009553 Bacteria 577
156 Ga0105239_10147328 3300010375 Bacteria 2626
157 Ga0105239_10258134 3300010375 Bacteria 1958
158 Ga0105239_10565266 3300010375 Bacteria 1296
159 Ga0105239_10785103 3300010375 Bacteria 1091
160 Ga0105246_10237879 3300011119 Bacteria 1438
161 Ga0105246_11913728 3300011119 Bacteria 570
162 Ga0157344_1001470 3300012476 Bacteria 1127
163 Ga0157324_1006971 3300012506 Bacteria 868
164 Ga0157373_10247502 3300013100 Bacteria 1260
165 Ga0157371_10239615 3300013102 Bacteria 1304
166 Ga0157374_10761925 3300013296 Bacteria 983
167 Ga0157374_10967017 3300013296 Bacteria 870
168 Ga0157378_10791739 3300013297 Bacteria 973
169 Ga0157378_10821565 3300013297 Bacteria 956
170 Ga0157378_12897674 3300013297 Bacteria 532
171 Ga0163162_10114864 3300013306 Bacteria 2792
172 Ga0163162_10363879 3300013306 Bacteria 1579
173 Ga0157372_10355268 3300013307 Bacteria 1707
174 Ga0157372_11740368 3300013307 Bacteria 717
175 Ga0157375_10371276 3300013308 Bacteria 1597
176 Ga0157375_10421029 3300013308 Bacteria 1502
177 Ga0157375_10656297 3300013308 Bacteria 1205
178 Ga0157375_11769855 3300013308 Bacteria 732
179 Ga0163163_10048342 3300014325 Bacteria 4183
180 Ga0163163_11684881 3300014325 Bacteria 695
181 Ga0157380_10324799 3300014326 Bacteria 1428
182 Ga0182008_10278229 3300014497 Bacteria 870
183 Ga0182008_10849632 3300014497 Bacteria 533
184 Ga0157377_10496953 3300014745 Bacteria 852
185 Ga0157376_10080857 3300014969 Bacteria 2789
186 Ga0157376_10930608 3300014969 Bacteria 889
187 Ga0182005_1144220 3300015265 Bacteria 690
188 Ga0163161_10234677 3300017792 Bacteria 1424
189 Ga0206350_11374566 3300020080 Bacteria 662
190 Ga0224712_10043552 3300022467 Bacteria 1707
191 Ga0207642_10011752 3300025899 Bacteria 3136
192 Ga0207642_10281508 3300025899 Bacteria 957
193 Ga0207642_10335093 3300025899 Bacteria 888
194 Ga0207710_10190191 3300025900 Bacteria 1010
195 Ga0207688_10137173 3300025901 Bacteria 1437
196 Ga0207688_10374923 3300025901 Bacteria 880
197 Ga0207699_11272856 3300025906 Bacteria 544
198 Ga0207645_10200041 3300025907 Bacteria 1314
199 Ga0207645_10373524 3300025907 Bacteria 956
200 Ga0207654_10031207 3300025911 Bacteria 2933
201 Ga0207654_10044139 3300025911 Bacteria 2530
202 Ga0207654_10248698 3300025911 Bacteria 1191
203 Ga0207707_10006032 3300025912 Bacteria 10601
204 Ga0207707_10049406 3300025912 Bacteria 3664
205 Ga0207671_10537720 3300025914 Bacteria 932
206 Ga0207660_10041602 3300025917 Bacteria 3221
207 Ga0207662_10089822 3300025918 Bacteria 1888
208 Ga0207662_10388180 3300025918 Bacteria 944
209 Ga0207657_10252679 3300025919 Bacteria 1405
210 Ga0207657_11005494 3300025919 Bacteria 640
211 Ga0207652_10010391 3300025921 Bacteria 7495
212 Ga0207652_10272221 3300025921 Bacteria 1527
213 Ga0207646_10194400 3300025922 Bacteria 1832
214 Ga0207646_11087095 3300025922 Bacteria 704
215 Ga0207687_10036440 3300025927 Bacteria 3351
216 Ga0207687_10064482 3300025927 Bacteria 2598
217 Ga0207687_10101736 3300025927 Bacteria 2116
218 Ga0207687_10252031 3300025927 Bacteria 1404
219 Ga0207700_10638741 3300025928 Bacteria 949
220 Ga0207644_10149477 3300025931 Bacteria 1806
221 Ga0207644_10408633 3300025931 Bacteria 1111
222 Ga0207706_10004664 3300025933 Bacteria 12847
223 Ga0207686_10038832 3300025934 Bacteria 2884
224 Ga0207686_10201942 3300025934 Bacteria 1424
225 Ga0207686_10313763 3300025934 Bacteria 1169
226 Ga0207686_10550299 3300025934 Bacteria 902
227 Ga0207709_10085594 3300025935 Bacteria 2044
228 Ga0207709_10144098 3300025935 Bacteria 1641
229 Ga0207669_10123473 3300025937 Bacteria 1763
230 Ga0207669_10123858 3300025937 Bacteria 1761
231 Ga0207704_10025092 3300025938 Bacteria 3247
232 Ga0207704_10804184 3300025938 Bacteria 785
233 Ga0207665_10023111 3300025939 Bacteria 4096
234 Ga0207691_10153161 3300025940 Bacteria 2026
235 Ga0207711_11504205 3300025941 Bacteria 616
236 Ga0207689_10760264 3300025942 Bacteria 818
237 Ga0207661_10004867 3300025944 Bacteria 9413
238 Ga0207661_10067179 3300025944 Bacteria 2915
239 Ga0207661_10402093 3300025944 Bacteria 1242
240 Ga0207661_10422209 3300025944 Bacteria 1211
241 Ga0207661_10569724 3300025944 Bacteria 1038
242 Ga0207679_10259489 3300025945 Bacteria 1481
243 Ga0207667_10085059 3300025949 Bacteria 3274
244 Ga0207667_10694541 3300025949 Bacteria 1020
245 Ga0207651_10201942 3300025960 Bacteria 1594
246 Ga0207651_10314962 3300025960 Bacteria 1306
247 Ga0207712_10119819 3300025961 Bacteria 1989
248 Ga0207712_10808084 3300025961 Bacteria 825
249 Ga0207668_10499058 3300025972 Bacteria 1047
250 Ga0207668_11026994 3300025972 Bacteria 737
251 Ga0207640_10158045 3300025981 Bacteria 1673
252 Ga0207640_10309384 3300025981 Bacteria 1253
253 Ga0207640_10457543 3300025981 Bacteria 1053
254 Ga0207677_10213904 3300026023 Bacteria 1541
255 Ga0207677_10280082 3300026023 Bacteria 1368
256 Ga0207639_10181761 3300026041 Bacteria 1789
257 Ga0207678_10377648 3300026067 Bacteria 1225
258 Ga0207708_10019928 3300026075 Bacteria 5057
259 Ga0207708_10246191 3300026075 Bacteria 1439
260 Ga0207708_10636828 3300026075 Bacteria 906
261 Ga0207702_10031390 3300026078 Bacteria 4427
262 Ga0207702_10153747 3300026078 Bacteria 2095
263 Ga0207702_10423603 3300026078 Bacteria 1288
264 Ga0207702_10505010 3300026078 Bacteria 1179
265 Ga0207641_10834429 3300026088 Bacteria 913
266 Ga0207648_10013371 3300026089 Bacteria 7639
267 Ga0207648_10141835 3300026089 Bacteria 2118
268 Ga0207648_10248531 3300026089 Bacteria 1585
269 Ga0207648_10553213 3300026089 Bacteria 1057
270 Ga0207674_10080111 3300026116 Bacteria 3269
271 Ga0207674_10569983 3300026116 Bacteria 1094
272 Ga0207675_100004693 3300026118 Bacteria 13155
273 Ga0207675_100009539 3300026118 Bacteria 9078
274 Ga0207683_10002733 3300026121 Bacteria 15408
275 Ga0207683_10077965 3300026121 Bacteria 2935
276 Ga0207428_10124673 3300027907 Bacteria 1973
277 Ga0207428_10547879 3300027907 Bacteria 837
278 Ga0268265_10888111 3300028380 Bacteria 874
279 Ga0265319_1074037 3300028563 Bacteria 1088
280 Ga0265334_10104361 3300028573 Bacteria 1023
281 Ga0265318_10045378 3300028577 Bacteria 1661
282 Ga0307408_101035612 3300031548 Bacteria 758
283 Ga0307405_11295390 3300031731 Bacteria 634
284 Ga0307413_10556015 3300031824 Bacteria 932
285 Ga0307407_10249778 3300031903 Bacteria 1215
286 Ga0307409_100119404 3300031995 Bacteria 2229
287 Ga0307416_100002864 3300032002 Bacteria 10045
288 Ga0307416_100115895 3300032002 Bacteria 2374
289 Ga0307416_100203820 3300032002 Bacteria 1880
290 Ga0307416_100313787 3300032002 Bacteria 1566
291 Ga0307416_101664003 3300032002 Bacteria 743
292 Ga0307415_100010469 3300032126 Bacteria 5256
293 Ga0307415_100076573 3300032126 Bacteria 2372
294 Ga0307415_101675130 3300032126 Bacteria 613
295 Ga0373945_0005897 3300035116 Bacteria 3933
296 Ga0373943_0011494 3300035170 Bacteria 3984
297 Ga0373943_0949171 3300035170 Bacteria 515
298 Ga0373931_0295623 3300035691 Bacteria 999
299 Ga0373935_0054003 3300035692 Bacteria 2557
300 Ga0373927_0094943 3300035695 Bacteria 1938
301 Ga0373947_0006595 3300035725 Bacteria 6737
302 Ga0373947_0045008 3300035725 Bacteria 2641
303 Ga0373925_0051910 3300037068 Bacteria 3062
304 Ga0395900_0026550 3300037418 Bacteria 5929
305 Ga0395900_0051925 3300037418 Bacteria 4222
306 Ga0395900_0219518 3300037418 Bacteria 1917
307 Ga0395900_0680878 3300037418 Bacteria 963
308 Ga0395900_0807626 3300037418 Bacteria 866
309 Ga0395900_0999928 3300037418 Bacteria 756
310 Ga0395900_1848760 3300037418 Bacteria 514
311 Ga0395898_0020654 3300037466 Bacteria 6688
312 Ga0395898_0332377 3300037466 Bacteria 1449
313 Ga0395898_0392617 3300037466 Bacteria 1323
314 Ga0395898_0686378 3300037466 Bacteria 966
315 Ga0395905_0008546 3300037471 Bacteria 10098
316 Ga0395905_0090111 3300037471 Bacteria 2875
317 Ga0395905_0117318 3300037471 Bacteria 2501
318 Ga0395905_0332418 3300037471 Bacteria 1410
319 Ga0395905_0385952 3300037471 Bacteria 1295
320 Ga0395901_0024175 3300038443 Bacteria 6234
321 Ga0395901_0042848 3300038443 Bacteria 4694
322 Ga0395901_0081413 3300038443 Bacteria 3382
323 Ga0395901_0120523 3300038443 Bacteria 2757
324 Ga0395901_0242637 3300038443 Bacteria 1879
325 Ga0395901_0744113 3300038443 Bacteria 974
326 Ga0395901_1021757 3300038443 Bacteria 801
327 Ga0395901_1138241 3300038443 Bacteria 749
328 Ga0395901_1183113 3300038443 Unclassified 731
329 Ga0436363_0795271 3300039450 Bacteria 604
330 Ga0439448_0108919 3300042005 Bacteria 945
331 Ga0450915_001475 3300042119 Bacteria 1106
332 Ga0439435_0308329 3300042436 Bacteria 543
333 Ga0439460_0340483 3300042461 Bacteria 528
334 Ga0466963_0009362 3300044694 Bacteria 5897
335 Ga0466957_0011295 3300044842 Bacteria 5148
336 Ga0466960_0617819 3300044901 Bacteria 644
337 Ga0466967_0043463 3300045976 Bacteria 3890
338 Ga0466967_0541892 3300045976 Bacteria 1145
339 Ga0466967_2240935 3300045976 Bacteria 542
340 Ga0495603_0000295 3300046455 Bacteria 26481
341 Ga0495629_0021848 3300046459 Bacteria 4566
342 Ga0495641_0002110 3300046461 Bacteria 16054
343 Ga0495641_0060495 3300046461 Bacteria 1711
344 Ga0495653_0229710 3300046463 Bacteria 1242
345 Ga0495582_0052326 3300046473 Bacteria 2252
346 Ga0495662_0143432 3300046476 Bacteria 1176
347 Ga0495664_0192661 3300046477 Bacteria 1236
348 Ga0495585_0359096 3300046492 Bacteria 707
349 Ga0495594_0009429 3300046499 Bacteria 5041
350 Ga0495594_0193674 3300046499 Bacteria 1158
351 Ga0495596_0215213 3300046500 Bacteria 746
352 Ga0495618_0034530 3300046514 Bacteria 3171
353 Ga0495630_0160688 3300046517 Bacteria 1711
354 Ga0495630_0419295 3300046517 Bacteria 1025
355 Ga0495644_0026183 3300046523 Bacteria 2214
356 Ga0495663_0200697 3300046525 Bacteria 696
357 Ga0495666_0007094 3300046526 Bacteria 5631
358 Ga0495652_0306851 3300046529 Bacteria 1151
359 Ga0495586_0152629 3300046535 Bacteria 1300
360 Ga0495645_0253373 3300046543 Bacteria 1169
361 Ga0495622_0120164 3300046557 Bacteria 1200
362 Ga0495667_0060643 3300046559 Bacteria 2481
363 Ga0495656_0007442 3300046615 Bacteria 3867
364 Ga0495656_0321414 3300046615 Bacteria 797
365 Ga0495634_0117490 3300046642 Bacteria 1705
366 Ga0495635_0084437 3300046663 Bacteria 2172
367 Ga0495588_0043378 3300046674 Bacteria 2301
368 Ga0495647_0052759 3300046681 Bacteria 1584
369 Ga0495658_0013951 3300046683 Bacteria 4097
370 Ga0495658_0051051 3300046683 Bacteria 2342
371 Ga0495613_0011202 3300046689 Bacteria 6662
372 Ga0495613_0280856 3300046689 Bacteria 1156
373 Ga0495613_0794227 3300046689 Bacteria 618
374 Ga0495581_0040669 3300047315 Bacteria 2690
375 Ga0495674_0660547 3300047319 Bacteria 823
376 Ga0495676_0038539 3300047321 Bacteria 3968
377 Ga0495676_0070500 3300047321 Bacteria 2691
378 Ga0495684_0215595 3300047471 Bacteria 1409
379 Ga0495593_0075768 3300047673 Bacteria 1744
380 Ga0496100_0032325 3300048903 Bacteria 3262
381 Ga0496100_0035370 3300048903 Bacteria 3141
382 Ga0496100_0085124 3300048903 Bacteria 2145
383 Ga0496100_0175253 3300048903 Bacteria 1548
384 Ga0496100_0202218 3300048903 Bacteria 1448
385 Ga0496100_0215354 3300048903 Bacteria 1407
386 Ga0496101_0003723 3300048904 Bacteria 9511
387 Ga0496101_0015282 3300048904 Bacteria 5169
388 Ga0496101_0015907 3300048904 Bacteria 5076
389 Ga0496101_0117932 3300048904 Bacteria 2004
390 Ga0496101_0134024 3300048904 Bacteria 1883
391 Ga0496101_0947265 3300048904 Bacteria 677
392 Ga0496102_0038952 3300048905 Bacteria 4293
393 Ga0496102_0077194 3300048905 Bacteria 3065
394 Ga0496102_0079738 3300048905 Bacteria 3015
395 Ga0496102_0134382 3300048905 Bacteria 2317
396 Ga0496102_0135508 3300048905 Bacteria 2307
397 Ga0496102_0152281 3300048905 Bacteria 2174
398 Ga0496102_0239164 3300048905 Bacteria 1712
399 Ga0496102_0314874 3300048905 Bacteria 1474
400 Ga0496103_0326677 3300048906 Bacteria 987
401 Ga0496103_0331626 3300048906 Bacteria 979
402 Ga0496103_0560175 3300048906 Bacteria 729
403 Ga0496104_0003518 3300048907 Bacteria 13506
404 Ga0496104_0017689 3300048907 Bacteria 6497
405 Ga0496104_0024222 3300048907 Bacteria 5582
406 Ga0496104_0042947 3300048907 Bacteria 4245
407 Ga0496104_0080177 3300048907 Bacteria 3112
408 Ga0496104_0094055 3300048907 Bacteria 2867
409 Ga0496104_0114927 3300048907 Bacteria 2582
410 Ga0496104_0537406 3300048907 Bacteria 1080
411 Ga0496104_0589802 3300048907 Bacteria 1022
412 Ga0496104_0784190 3300048907 Bacteria 859
413 Ga0496105_0000090 3300048908 Bacteria 63276
414 Ga0496105_0001813 3300048908 Bacteria 15288
415 Ga0496105_0026452 3300048908 Bacteria 4732
416 Ga0496105_0041389 3300048908 Bacteria 3797
417 Ga0496105_0177945 3300048908 Bacteria 1742
418 Ga0496105_0202562 3300048908 Bacteria 1619
419 Ga0496105_0769066 3300048908 Bacteria 734
420 Ga0496106_0016832 3300048909 Bacteria 5409
421 Ga0496106_0251754 3300048909 Bacteria 1412
422 Ga0496106_0314109 3300048909 Bacteria 1257
423 Ga0496106_0866572 3300048909 Bacteria 714
424 Ga0496106_1274727 3300048909 Bacteria 571
425 Ga0496107_0056426 3300048910 Bacteria 2838
426 Ga0496107_0570387 3300048910 Bacteria 837
427 Ga0496108_0001465 3300048911 Bacteria 18642
428 Ga0496108_0008675 3300048911 Bacteria 8243
429 Ga0496108_0013211 3300048911 Bacteria 6729
430 Ga0496108_0019932 3300048911 Bacteria 5508
431 Ga0496108_0065174 3300048911 Bacteria 3070
432 Ga0496109_0000787 3300048912 Bacteria 26394
433 Ga0496109_0001506 3300048912 Bacteria 19379
434 Ga0496109_0016923 3300048912 Bacteria 6381
435 Ga0496109_0027663 3300048912 Bacteria 5066
436 Ga0496109_0104337 3300048912 Bacteria 2632
437 Ga0496109_0139320 3300048912 Bacteria 2268
438 Ga0496109_0239386 3300048912 Bacteria 1708
439 Ga0496110_0002074 3300048913 Bacteria 14941
440 Ga0496110_0004223 3300048913 Bacteria 11117
441 Ga0496110_0010607 3300048913 Bacteria 7501
442 Ga0496110_0018757 3300048913 Bacteria 5805
443 Ga0496110_0032590 3300048913 Bacteria 4501
444 Ga0496110_0036669 3300048913 Bacteria 4259
445 Ga0496110_0040131 3300048913 Bacteria 4079
446 Ga0496111_0000578 3300048914 Bacteria 19157
447 Ga0496111_0002063 3300048914 Bacteria 11971
448 Ga0496111_0002544 3300048914 Bacteria 11017
449 Ga0496111_0003155 3300048914 Bacteria 10146
450 Ga0496111_0005442 3300048914 Bacteria 8158
451 Ga0496111_0086207 3300048914 Bacteria 2297
452 Ga0496111_0116741 3300048914 Bacteria 1968
453 Ga0496111_0128255 3300048914 Bacteria 1876
454 Ga0496112_0000829 3300048915 Bacteria 21968
455 Ga0496112_0012970 3300048915 Bacteria 7680
456 Ga0496112_0040467 3300048915 Bacteria 4557
457 Ga0496113_0013398 3300048916 Bacteria 5553
458 Ga0496113_0046368 3300048916 Bacteria 3226
459 Ga0496113_0227025 3300048916 Bacteria 1489
460 Ga0496113_0310338 3300048916 Bacteria 1263
461 Ga0496113_0521057 3300048916 Bacteria 954
462 Ga0496113_0974060 3300048916 Bacteria 669
463 Ga0496114_0008396 3300048917 Bacteria 8182
464 Ga0496114_0014802 3300048917 Bacteria 6269
465 Ga0496114_0027558 3300048917 Bacteria 4655
466 Ga0496114_0039252 3300048917 Bacteria 3917
467 Ga0496114_0102651 3300048917 Bacteria 2443
468 Ga0496114_0290005 3300048917 Bacteria 1444
469 Ga0496114_0584798 3300048917 Bacteria 985
470 Ga0496115_0018111 3300048918 Bacteria 5399
471 Ga0496115_0053781 3300048918 Bacteria 3232
472 Ga0496115_0199272 3300048918 Bacteria 1654
473 Ga0496115_0272299 3300048918 Bacteria 1391
474 Ga0496115_1052897 3300048918 Bacteria 619
475 Ga0501031_0011664 3300049568 Bacteria 5733
476 Ga0501031_0557006 3300049568 Bacteria 738
477 Ga0501032_0004426 3300049569 Bacteria 10590
478 Ga0501033_0007557 3300049570 Bacteria 8456
479 Ga0501034_0544065 3300049571 Bacteria 1071
480 Ga0501036_0037366 3300049572 Bacteria 4108
481 Ga0501036_0460711 3300049572 Bacteria 1059
482 Ga0501036_0929916 3300049572 Bacteria 713
483 Ga0501037_0011830 3300049573 Bacteria 6427
484 Ga0501038_0005105 3300049574 Bacteria 12201
485 Ga0501039_0339506 3300049575 Bacteria 1180
486 Ga0501040_0008045 3300049576 Bacteria 6847
487 Ga0501041_0026710 3300049577 Bacteria 3474
488 Ga0501041_0173569 3300049577 Bacteria 1349
489 Ga0501042_0021511 3300049578 Bacteria 4496
490 Ga0501042_0189866 3300049578 Bacteria 1482
491 Ga0501042_0377411 3300049578 Bacteria 1026
492 Ga0501043_0002861 3300049579 Bacteria 14412
493 Ga0501046_0061567 3300049580 Bacteria 2933
494 Ga0501046_0080980 3300049580 Bacteria 2508
495 Ga0501048_0002493 3300049582 Bacteria 14054
496 Ga0501067_0002844 3300049583 Bacteria 9524
497 Ga0501068_0000514 3300049584 Bacteria 19601
498 Ga0501069_0008029 3300049585 Bacteria 5544
499 Ga0501069_0010378 3300049585 Bacteria 4928
500 Ga0501070_0014265 3300049586 Bacteria 6689
501 Ga0501070_0062106 3300049586 Bacteria 3095
502 Ga0501071_0004163 3300049587 Bacteria 9154
503 Ga0501071_0205693 3300049587 Bacteria 1479
504 Ga0501071_0746747 3300049587 Bacteria 754
505 Ga0501072_0020848 3300049588 Bacteria 5080
506 Ga0501073_0001537 3300049589 Bacteria 17091
507 Ga0501074_0048966 3300049590 Bacteria 3051
508 Ga0501074_0516675 3300049590 Bacteria 846
509 Ga0501075_0002161 3300049591 Bacteria 13025
510 Ga0501075_0215341 3300049591 Bacteria 1465
511 Ga0501076_0062968 3300049592 Bacteria 2954
512 Ga0501076_1401003 3300049592 Bacteria 574
513 Ga0501077_0006504 3300049593 Bacteria 7172
514 Ga0501079_0004932 3300049741 Bacteria 9893
515 Ga0501079_0092656 3300049741 Bacteria 2341
516 Ga0501079_0112619 3300049741 Bacteria 2115
517 Ga0501079_1270783 3300049741 Unclassified 580
518 Ga0501080_0010019 3300049742 Bacteria 8663
519 Ga0501080_1469639 3300049742 Bacteria 580
520 Ga0501081_0017707 3300049743 Bacteria 4721
521 Ga0501081_0483969 3300049743 Bacteria 921
522 Ga0501083_0001510 3300049744 Bacteria 15903
523 Ga0501035_0005138 3300049822 Bacteria 12384
524 Ga0501044_0031194 3300049823 Bacteria 5611
525 Ga0501045_0000533 3300049824 Bacteria 23778
526 nmdc:mga03683_235425_c1 3300050489 Bacteria 848
527 nmdc:mga00v17_440763_c1 3300050491 Bacteria 846
528 nmdc:mga0k408_198228_c1 3300050493 Bacteria 1198
529 nmdc:mga05p37_1656480_c1 3300050507 Bacteria 627
530 nmdc:mga05p37_211805_c1 3300050507 Bacteria 2342
531 nmdc:mga05p37_381982_c1 3300050507 Bacteria 1650
532 nmdc:mga09592_228085_c1 3300050508 Bacteria 1614
533 nmdc:mga0qj67_128678_c1 3300050509 Bacteria 2050
534 nmdc:mga06r32_1213697_c1 3300050510 Bacteria 700
535 nmdc:mga06r32_143855_c1 3300050510 Bacteria 2362
536 nmdc:mga08y16_31052_c1 3300050511 Bacteria 5619
537 nmdc:mga08y16_48035_c1 3300050511 Bacteria 3577
538 nmdc:mga0n895_1729896_c1 3300050512 Bacteria 587
539 nmdc:mga0n895_214555_c1 3300050512 Bacteria 1954
540 nmdc:mga0n895_351478_c1 3300050512 Bacteria 1493
541 nmdc:mga0n895_986759_c1 3300050512 Bacteria 824
542 nmdc:mga0a205_560278_c1 3300050515 Bacteria 997
543 nmdc:mga0a205_74484_c1 3300050515 Bacteria 3280
544 Ga0495612_0181783 3300053078 Bacteria 924
545 Ga0495655_0026866 3300053083 Bacteria 1360
546 Ga0501084_0036699 3300054114 Bacteria 4094
547 Ga0501084_0043424 3300054114 Bacteria 3761
548 Ga0501084_0484960 3300054114 Bacteria 1045
549 Ga0590075_003299 3300059424 Bacteria 3843
550 Ga0501082_0002916 3300060353 Bacteria 14922
551 Ga0501082_0541185 3300060353 Bacteria 1018
552 Ga0530510_0024093 3300061734 Bacteria 4341
553 Ga0530510_0029881 3300061734 Bacteria 3912
554 Ga0530510_0130990 3300061734 Bacteria 1845
555 Ga0530510_0430774 3300061734 Bacteria 996
556 Ga0081455_10039630
557 JGI25406J46586_10177387
558 Ga0070676_10112693
559 Ga0070683_100013513
560 Ga0070683_100027501
561 Ga0070683_100083916
562 Ga0070683_100392791
563 Ga0070683_101118026
564 Ga0070683_101690559
565 Ga0070683_101908580
566 Ga0070690_100013603
567 Ga0068869_101218331
568 Ga0068869_101478648
569 Ga0070680_100061151
570 Ga0070680_100235135
571 Ga0070682_100054968
572 Ga0070682_100177829
573 Ga0068868_100114504
574 Ga0068868_100940129
575 Ga0070660_100272129
576 Ga0070691_10016143
577 Ga0070691_10252450
578 Ga0070691_10534197
579 Ga0070687_100122461
580 Ga0070692_10055300
581 Ga0070668_100021452
582 Ga0070668_100042886
583 Ga0070671_100182956
584 Ga0070674_100059538
585 Ga0070674_100141841
586 Ga0070673_100754033
587 Ga0070673_100827914
588 Ga0070659_100049858
589 Ga0070667_100923481
590 Ga0070713_100468036
591 Ga0070701_10018539
592 Ga0070705_100011889
593 Ga0070700_100044560
594 Ga0070694_100130174
595 Ga0070708_100157721
596 Ga0070708_100513066
597 Ga0070663_100245926
598 Ga0070663_101173616
599 Ga0070678_100039470
600 Ga0070662_100095710
601 Ga0070662_100194577
602 Ga0070681_10001644
603 Ga0070681_10130288
604 Ga0068867_100188010
605 Ga0068867_100205686
606 Ga0068867_100486861
607 Ga0068867_100933894
608 Ga0070707_100031110
609 Ga0070707_100752372
610 Ga0070698_101034859
611 Ga0070679_100556756
612 Ga0070679_100827968
613 Ga0070684_100000327
614 Ga0070684_100012423
615 Ga0070684_100418582
616 Ga0070672_100842516
617 Ga0070686_100022587
618 Ga0070686_100082236
619 Ga0070695_100046991
620 Ga0070695_100292221
621 Ga0070695_100461261
622 Ga0070695_101046496
623 Ga0070696_100016897
624 Ga0070696_100053482
625 Ga0070696_100450182
626 Ga0070693_100017922
627 Ga0070693_100018460
628 Ga0070665_100875402
629 Ga0070704_100333749
630 Ga0070704_100886140
631 Ga0070704_101107176
632 Ga0068855_100025493
633 Ga0068855_100358658
634 Ga0070664_100066119
635 Ga0068854_100077758
636 Ga0068854_100600269
637 Ga0068856_100051894
638 Ga0068856_100068487
639 Ga0068856_100096855
640 Ga0068856_100147270
641 Ga0068856_100509494
642 Ga0068856_100550583
643 Ga0068856_100676248
644 Ga0070702_100012846
645 Ga0068852_100131209
646 Ga0068859_100867171
647 Ga0068866_10152454
648 Ga0068866_10399663
649 Ga0068861_100018933
650 Ga0068861_100670625
651 Ga0068870_10117916
652 Ga0068863_102026573
653 Ga0068860_100167436
654 Ga0068860_101390500
655 Ga0081455_10001226
656 Ga0081455_10010590
657 Ga0081455_10369621
658 Ga0081455_10462279
659 Ga0081540_1015979
660 Ga0081539_10000095
661 Ga0081539_10000473
662 Ga0075364_10026456
663 Ga0075432_10047107
664 Ga0075366_10368046
665 Ga0097621_100143838
666 Ga0068871_100184033
667 Ga0075428_101927427
668 Ga0075428_102001285
669 Ga0075430_100044070
670 Ga0075431_100699431
671 Ga0075431_100769950
672 Ga0075431_101392625
673 Ga0075433_10061450
674 Ga0075433_11721211
675 Ga0075434_100635532
676 Ga0068865_100156772
677 Ga0097620_100867217
678 Ga0075435_100028319
679 Ga0075435_100941008
680 Ga0105240_10320110
681 Ga0111539_10006251
682 Ga0111539_10100841
683 Ga0111539_11284983
684 Ga0105245_10010000
685 Ga0105245_10012706
686 Ga0105245_10158417
687 Ga0105245_10785258
688 Ga0105247_10321167
689 Ga0114129_10040999
690 Ga0114129_10315838
691 Ga0114129_11167148
692 Ga0114129_11536774
693 Ga0105243_10047718
694 Ga0105243_10073711
695 Ga0105243_10144535
696 Ga0105243_10454643
697 Ga0105243_12803690
698 Ga0105241_10174717
699 Ga0105241_10195614
700 Ga0105241_10544311
701 Ga0105242_10179289
702 Ga0105242_10187064
703 Ga0105242_10842982
704 Ga0105248_10651663
705 Ga0105237_10588989
706 Ga0105238_10142608
707 Ga0105238_10174823
708 Ga0105249_10026080
709 Ga0105249_10232142
710 Ga0105249_12618412
711 Ga0105239_10147328
712 Ga0105239_10258134
713 Ga0105239_10565266
714 Ga0105239_10785103
715 Ga0105246_10237879
716 Ga0105246_11913728
717 Ga0157344_1001470
718 Ga0157324_1006971
719 Ga0157373_10247502
720 Ga0157371_10239615
721 Ga0157374_10761925
722 Ga0157374_10967017
723 Ga0157378_10791739
724 Ga0157378_10821565
725 Ga0157378_12897674
726 Ga0163162_10114864
727 Ga0163162_10363879
728 Ga0157372_10355268
729 Ga0157372_11740368
730 Ga0157375_10371276
731 Ga0157375_10421029
732 Ga0157375_10656297
733 Ga0157375_11769855
734 Ga0163163_10048342
735 Ga0163163_11684881
736 Ga0157380_10324799
737 Ga0182008_10278229
738 Ga0182008_10849632
739 Ga0157377_10496953
740 Ga0157376_10080857
741 Ga0157376_10930608
742 Ga0182005_1144220
743 Ga0163161_10234677
744 Ga0206350_11374566
745 Ga0224712_10043552
746 Ga0207642_10011752
747 Ga0207642_10281508
748 Ga0207642_10335093
749 Ga0207710_10190191
750 Ga0207688_10137173
751 Ga0207688_10374923
752 Ga0207699_11272856
753 Ga0207645_10200041
754 Ga0207645_10373524
755 Ga0207654_10031207
756 Ga0207654_10044139
757 Ga0207654_10248698
758 Ga0207707_10006032
759 Ga0207707_10049406
760 Ga0207671_10537720
761 Ga0207660_10041602
762 Ga0207662_10089822
763 Ga0207662_10388180
764 Ga0207657_10252679
765 Ga0207657_11005494
766 Ga0207652_10010391
767 Ga0207652_10272221
768 Ga0207646_10194400
769 Ga0207646_11087095
770 Ga0207687_10036440
771 Ga0207687_10064482
772 Ga0207687_10101736
773 Ga0207687_10252031
774 Ga0207700_10638741
775 Ga0207644_10149477
776 Ga0207644_10408633
777 Ga0207706_10004664
778 Ga0207686_10038832
779 Ga0207686_10201942
780 Ga0207686_10313763
781 Ga0207686_10550299
782 Ga0207709_10085594
783 Ga0207709_10144098
784 Ga0207669_10123473
785 Ga0207669_10123858
786 Ga0207704_10025092
787 Ga0207704_10804184
788 Ga0207665_10023111
789 Ga0207691_10153161
790 Ga0207711_11504205
791 Ga0207689_10760264
792 Ga0207661_10004867
793 Ga0207661_10067179
794 Ga0207661_10402093
795 Ga0207661_10422209
796 Ga0207661_10569724
797 Ga0207679_10259489
798 Ga0207667_10085059
799 Ga0207667_10694541
800 Ga0207651_10201942
801 Ga0207651_10314962
802 Ga0207712_10119819
803 Ga0207712_10808084
804 Ga0207668_10499058
805 Ga0207668_11026994
806 Ga0207640_10158045
807 Ga0207640_10309384
808 Ga0207640_10457543
809 Ga0207677_10213904
810 Ga0207677_10280082
811 Ga0207639_10181761
812 Ga0207678_10377648
813 Ga0207708_10019928
814 Ga0207708_10246191
815 Ga0207708_10636828
816 Ga0207702_10031390
817 Ga0207702_10153747
818 Ga0207702_10423603
819 Ga0207702_10505010
820 Ga0207641_10834429
821 Ga0207648_10013371
822 Ga0207648_10141835
823 Ga0207648_10248531
824 Ga0207648_10553213
825 Ga0207674_10080111
826 Ga0207674_10569983
827 Ga0207675_100004693
828 Ga0207675_100009539
829 Ga0207683_10002733
830 Ga0207683_10077965
831 Ga0207428_10124673
832 Ga0207428_10547879
833 Ga0268265_10888111
834 Ga0265319_1074037
835 Ga0265334_10104361
836 Ga0265318_10045378
837 Ga0307408_101035612
838 Ga0307405_11295390
839 Ga0307413_10556015
840 Ga0307407_10249778
841 Ga0307409_100119404
842 Ga0307416_100002864
843 Ga0307416_100115895
844 Ga0307416_100203820
845 Ga0307416_100313787
846 Ga0307416_101664003
847 Ga0307415_100010469
848 Ga0307415_100076573
849 Ga0307415_101675130
850 Ga0373945_0005897
851 Ga0373943_0011494
852 Ga0373943_0949171
853 Ga0373931_0295623
854 Ga0373935_0054003
855 Ga0373927_0094943
856 Ga0373947_0006595
857 Ga0373947_0045008
858 Ga0373925_0051910
859 Ga0395900_0026550
860 Ga0395900_0051925
861 Ga0395900_0219518
862 Ga0395900_0680878
863 Ga0395900_0807626
864 Ga0395900_0999928
865 Ga0395900_1848760
866 Ga0395898_0020654
867 Ga0395898_0332377
868 Ga0395898_0392617
869 Ga0395898_0686378
870 Ga0395905_0008546
871 Ga0395905_0090111
872 Ga0395905_0117318
873 Ga0395905_0332418
874 Ga0395905_0385952
875 Ga0395901_0024175
876 Ga0395901_0042848
877 Ga0395901_0081413
878 Ga0395901_0120523
879 Ga0395901_0242637
880 Ga0395901_0744113
881 Ga0395901_1021757
882 Ga0395901_1138241
883 Ga0395901_1183113
884 Ga0436363_0795271
885 Ga0439448_0108919
886 Ga0450915_001475
887 Ga0439435_0308329
888 Ga0439460_0340483
889 Ga0466963_0009362
890 Ga0466957_0011295
891 Ga0466960_0617819
892 Ga0466967_0043463
893 Ga0466967_0541892
894 Ga0466967_2240935
895 Ga0495603_0000295
896 Ga0495629_0021848
897 Ga0495641_0002110
898 Ga0495641_0060495
899 Ga0495653_0229710
900 Ga0495582_0052326
901 Ga0495662_0143432
902 Ga0495664_0192661
903 Ga0495585_0359096
904 Ga0495594_0009429
905 Ga0495594_0193674
906 Ga0495596_0215213
907 Ga0495618_0034530
908 Ga0495630_0160688
909 Ga0495630_0419295
910 Ga0495644_0026183
911 Ga0495663_0200697
912 Ga0495666_0007094
913 Ga0495652_0306851
914 Ga0495586_0152629
915 Ga0495645_0253373
916 Ga0495622_0120164
917 Ga0495667_0060643
918 Ga0495656_0007442
919 Ga0495656_0321414
920 Ga0495634_0117490
921 Ga0495635_0084437
922 Ga0495588_0043378
923 Ga0495647_0052759
924 Ga0495658_0013951
925 Ga0495658_0051051
926 Ga0495613_0011202
927 Ga0495613_0280856
928 Ga0495613_0794227
929 Ga0495581_0040669
930 Ga0495674_0660547
931 Ga0495676_0038539
932 Ga0495676_0070500
933 Ga0495684_0215595
934 Ga0495593_0075768
935 Ga0496100_0032325
936 Ga0496100_0035370
937 Ga0496100_0085124
938 Ga0496100_0175253
939 Ga0496100_0202218
940 Ga0496100_0215354
941 Ga0496101_0003723
942 Ga0496101_0015282
943 Ga0496101_0015907
944 Ga0496101_0117932
945 Ga0496101_0134024
946 Ga0496101_0947265
947 Ga0496102_0038952
948 Ga0496102_0077194
949 Ga0496102_0079738
950 Ga0496102_0134382
951 Ga0496102_0135508
952 Ga0496102_0152281
953 Ga0496102_0239164
954 Ga0496102_0314874
955 Ga0496103_0326677
956 Ga0496103_0331626
957 Ga0496103_0560175
958 Ga0496104_0003518
959 Ga0496104_0017689
960 Ga0496104_0024222
961 Ga0496104_0042947
962 Ga0496104_0080177
963 Ga0496104_0094055
964 Ga0496104_0114927
965 Ga0496104_0537406
966 Ga0496104_0589802
967 Ga0496104_0784190
968 Ga0496105_0000090
969 Ga0496105_0001813
970 Ga0496105_0026452
971 Ga0496105_0041389
972 Ga0496105_0177945
973 Ga0496105_0202562
974 Ga0496105_0769066
975 Ga0496106_0016832
976 Ga0496106_0251754
977 Ga0496106_0314109
978 Ga0496106_0866572
979 Ga0496106_1274727
980 Ga0496107_0056426
981 Ga0496107_0570387
982 Ga0496108_0001465
983 Ga0496108_0008675
984 Ga0496108_0013211
985 Ga0496108_0019932
986 Ga0496108_0065174
987 Ga0496109_0000787
988 Ga0496109_0001506
989 Ga0496109_0016923
990 Ga0496109_0027663
991 Ga0496109_0104337
992 Ga0496109_0139320
993 Ga0496109_0239386
994 Ga0496110_0002074
995 Ga0496110_0004223
996 Ga0496110_0010607
997 Ga0496110_0018757
998 Ga0496110_0032590
999 Ga0496110_0036669
1000 Ga0496110_0040131
1001 Ga0496111_0000578
1002 Ga0496111_0002063
1003 Ga0496111_0002544
1004 Ga0496111_0003155
1005 Ga0496111_0005442
1006 Ga0496111_0086207
1007 Ga0496111_0116741
1008 Ga0496111_0128255
1009 Ga0496112_0000829
1010 Ga0496112_0012970
1011 Ga0496112_0040467
1012 Ga0496113_0013398
1013 Ga0496113_0046368
1014 Ga0496113_0227025
1015 Ga0496113_0310338
1016 Ga0496113_0521057
1017 Ga0496113_0974060
1018 Ga0496114_0008396
1019 Ga0496114_0014802
1020 Ga0496114_0027558
1021 Ga0496114_0039252
1022 Ga0496114_0102651
1023 Ga0496114_0290005
1024 Ga0496114_0584798
1025 Ga0496115_0018111
1026 Ga0496115_0053781
1027 Ga0496115_0199272
1028 Ga0496115_0272299
1029 Ga0496115_1052897
1030 Ga0501031_0011664
1031 Ga0501031_0557006
1032 Ga0501032_0004426
1033 Ga0501033_0007557
1034 Ga0501034_0544065
1035 Ga0501036_0037366
1036 Ga0501036_0460711
1037 Ga0501036_0929916
1038 Ga0501037_0011830
1039 Ga0501038_0005105
1040 Ga0501039_0339506
1041 Ga0501040_0008045
1042 Ga0501041_0026710
1043 Ga0501041_0173569
1044 Ga0501042_0021511
1045 Ga0501042_0189866
1046 Ga0501042_0377411
1047 Ga0501043_0002861
1048 Ga0501046_0061567
1049 Ga0501046_0080980
1050 Ga0501048_0002493
1051 Ga0501067_0002844
1052 Ga0501068_0000514
1053 Ga0501069_0008029
1054 Ga0501069_0010378
1055 Ga0501070_0014265
1056 Ga0501070_0062106
1057 Ga0501071_0004163
1058 Ga0501071_0205693
1059 Ga0501071_0746747
1060 Ga0501072_0020848
1061 Ga0501073_0001537
1062 Ga0501074_0048966
1063 Ga0501074_0516675
1064 Ga0501075_0002161
1065 Ga0501075_0215341
1066 Ga0501076_0062968
1067 Ga0501076_1401003
1068 Ga0501077_0006504
1069 Ga0501079_0004932
1070 Ga0501079_0092656
1071 Ga0501079_0112619
1072 Ga0501079_1270783
1073 Ga0501080_0010019
1074 Ga0501080_1469639
1075 Ga0501081_0017707
1076 Ga0501081_0483969
1077 Ga0501083_0001510
1078 Ga0501035_0005138
1079 Ga0501044_0031194
1080 Ga0501045_0000533
1081 nmdc:mga03683_235425_c1
1082 nmdc:mga00v17_440763_c1
1083 nmdc:mga0k408_198228_c1
1084 nmdc:mga05p37_1656480_c1
1085 nmdc:mga05p37_211805_c1
1086 nmdc:mga05p37_381982_c1
1087 nmdc:mga09592_228085_c1
1088 nmdc:mga0qj67_128678_c1
1089 nmdc:mga06r32_1213697_c1
1090 nmdc:mga06r32_143855_c1
1091 nmdc:mga08y16_31052_c1
1092 nmdc:mga08y16_48035_c1
1093 nmdc:mga0n895_1729896_c1
1094 nmdc:mga0n895_214555_c1
1095 nmdc:mga0n895_351478_c1
1096 nmdc:mga0n895_986759_c1
1097 nmdc:mga0a205_560278_c1
1098 nmdc:mga0a205_74484_c1
1099 Ga0495612_0181783
1100 Ga0495655_0026866
1101 Ga0501084_0036699
1102 Ga0501084_0043424
1103 Ga0501084_0484960
1104 Ga0590075_003299
1105 Ga0501082_0002916
1106 Ga0501082_0541185
1107 Ga0530510_0024093
1108 Ga0530510_0029881
1109 Ga0530510_0130990
1110 Ga0530510_0430774

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

38

177

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s5p-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase b rpib from giardia lamblia 0.9801 1 129
3s5p-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase b rpib from giardia lamblia 0.978 1 132
5ifz-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m 0.9652 1 129
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9625 2 147
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9611 2 146
ID Description Score Start End Superfamily
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9801 1 129 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9652 1 129 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9622 2 147 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9572 1 129 3.40.1400.10
6fxsA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9488 2 146 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A6J5ZW88-F1-model_v4 Unannotated protein 0.974 1 150 GO:0005975
GO:0016853
AF-A0A538DK80-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9734 1 149 GO:0004061
GO:0005975
GO:0016861
GO:0019441
AF-A0A8B5WR16-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9714 1 148 GO:0005975
GO:0016861
AF-A0A2V5NPU5-F1-model_v4 Ribose 5-phosphate isomerase B 0.9696 1 147 GO:0005975
GO:0016861
AF-A0A2R8AQV8-F1-model_v4 Ribose-5-phosphate isomerase B (EC 5.3.1.6) 0.9681 2 143 GO:0004751
GO:0009052
GO:0019316

Map