F463071

General Info

Members Datasets Scaffolds Average Seq Length
555 177 1110 448

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10082693|Ga0070666_100826932
Length 475
Sequence MRRPRQFRANGGAWRPSCASGAAMTGRPILTADAMRAAEQTAIDGGASVEQLMERAGAALAEAAHRFVGPMPTLILCGPGNNGGDGYVAARHLAERGMKVRVAAYSEPKTDAANWACAAWKGEVELLSGETSPAPLLIDALFGTGLKRGLEDSVSEQLSRLCNGAVVTIACDLPSGAQTDNGQELSALPAFDMTVTFGALKPAHLLHPAMHKCGRLVLGDICIATNGAWQEIAPPQLPALDPGGHKYNRGLVHALAGTMPGAIALAAKGAARAGAGYVRVSTSRPIDGLPTAIVQVDHAPVNDERIGCLLVGPGLGDLPQVLTLALTSKAPKVIDADGITHVGEPERLKGQDAILTPHEGEFRKLFGDLPGSKPERALEAARRSGAVVVYKGPDTLVASPDGRLGFAPRAHPWLASAGTGDVLAGITAAMRARGLPAFEAACAAVWLHGRAAEIAGPQLIADDLAEAIPAAIASL

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.18
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.5
Rhizosphere 95.5
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10082693 3300005335 Bacteria 2196
2 JGI24741J21665_1004002 3300001915 Bacteria 3366
3 JGI24740J21852_10009307 3300001979 Bacteria 3855
4 JGI24739J22299_10032090 3300001989 Bacteria 1810
5 JGI24737J22298_10000460 3300001990 Bacteria 14004
6 JGI24737J22298_10008605 3300001990 Bacteria 3412
7 JGI24735J21928_10020173 3300002067 Unclassified 2044
8 JGI24744J21845_10000171 3300002077 Bacteria 9696
9 Ga0070658_10000210 3300005327 Bacteria 51793
10 Ga0070658_10008759 3300005327 Bacteria 8129
11 Ga0070658_10031597 3300005327 Bacteria 4252
12 Ga0070658_10036741 3300005327 Bacteria 3948
13 Ga0070658_10045589 3300005327 Bacteria 3545
14 Ga0070658_10053979 3300005327 Bacteria 3263
15 Ga0070658_10057302 3300005327 Bacteria 3169
16 Ga0070658_10064062 3300005327 Bacteria 2998
17 Ga0070658_10099555 3300005327 Bacteria 2402
18 Ga0070658_10109347 3300005327 Bacteria 2289
19 Ga0070676_10018445 3300005328 Bacteria 3868
20 Ga0070676_10041081 3300005328 Bacteria 2680
21 Ga0070683_100005036 3300005329 Bacteria 10968
22 Ga0070683_100036840 3300005329 Bacteria 4476
23 Ga0070690_100030050 3300005330 Bacteria 3374
24 Ga0070690_100074168 3300005330 Bacteria 2215
25 Ga0070670_100001623 3300005331 Bacteria 18192
26 Ga0070670_100005749 3300005331 Bacteria 10473
27 Ga0070670_100031141 3300005331 Bacteria 4594
28 Ga0070670_100046020 3300005331 Bacteria 3751
29 Ga0070670_100053677 3300005331 Bacteria 3461
30 Ga0070670_100104006 3300005331 Bacteria 2446
31 Ga0070677_10007722 3300005333 Bacteria 3602
32 Ga0070666_10000173 3300005335 Bacteria 44032
33 Ga0070666_10000717 3300005335 Bacteria 20096
34 Ga0070666_10004664 3300005335 Bacteria 8366
35 Ga0070666_10020531 3300005335 Bacteria 4271
36 Ga0070680_100000952 3300005336 Bacteria 20498
37 Ga0070680_100003690 3300005336 Bacteria 11432
38 Ga0070680_100054112 3300005336 Bacteria 3276
39 Ga0068868_100014516 3300005338 Bacteria 5807
40 Ga0070660_100000033 3300005339 Bacteria 83079
41 Ga0070660_100010351 3300005339 Bacteria 6589
42 Ga0070660_100016869 3300005339 Bacteria 5312
43 Ga0070660_100040347 3300005339 Bacteria 3552
44 Ga0070660_100043479 3300005339 Bacteria 3433
45 Ga0070660_100114949 3300005339 Bacteria 2144
46 Ga0070660_100175837 3300005339 Bacteria 1731
47 Ga0070687_100042928 3300005343 Bacteria 2294
48 Ga0070661_100002672 3300005344 Bacteria 12212
49 Ga0070661_100008895 3300005344 Bacteria 6949
50 Ga0070661_100020144 3300005344 Bacteria 4755
51 Ga0070661_100034065 3300005344 Bacteria 3693
52 Ga0070661_100034942 3300005344 Bacteria 3648
53 Ga0070661_100043091 3300005344 Bacteria 3296
54 Ga0070661_100088777 3300005344 Bacteria 2289
55 Ga0070661_100096520 3300005344 Bacteria 2194
56 Ga0070668_100038231 3300005347 Bacteria 3667
57 Ga0070668_100079904 3300005347 Bacteria 2561
58 Ga0070668_100131944 3300005347 Bacteria 2006
59 Ga0070675_100012223 3300005354 Bacteria 6730
60 Ga0070675_100012614 3300005354 Bacteria 6627
61 Ga0070671_100000312 3300005355 Bacteria 33022
62 Ga0070671_100004090 3300005355 Bacteria 11516
63 Ga0070671_100005670 3300005355 Bacteria 9937
64 Ga0070671_100096662 3300005355 Bacteria 2477
65 Ga0070671_100138029 3300005355 Bacteria 2056
66 Ga0070674_100002956 3300005356 Bacteria 9426
67 Ga0070674_100003300 3300005356 Bacteria 9029
68 Ga0070674_100015464 3300005356 Bacteria 4763
69 Ga0070674_100054067 3300005356 Bacteria 2775
70 Ga0070674_100067867 3300005356 Bacteria 2510
71 Ga0070673_100003309 3300005364 Bacteria 10009
72 Ga0070673_100005053 3300005364 Bacteria 8414
73 Ga0070673_100013570 3300005364 Bacteria 5644
74 Ga0070659_100001891 3300005366 Bacteria 14981
75 Ga0070659_100002898 3300005366 Bacteria 12212
76 Ga0070659_100005748 3300005366 Bacteria 8926
77 Ga0070659_100018266 3300005366 Bacteria 5293
78 Ga0070659_100018438 3300005366 Bacteria 5267
79 Ga0070659_100036964 3300005366 Bacteria 3806
80 Ga0070659_100041491 3300005366 Bacteria 3597
81 Ga0070659_100081925 3300005366 Bacteria 2577
82 Ga0070659_100149400 3300005366 Bacteria 1905
83 Ga0070659_100176197 3300005366 Bacteria 1753
84 Ga0070667_100001262 3300005367 Bacteria 22964
85 Ga0070667_100001721 3300005367 Bacteria 19565
86 Ga0070667_100013801 3300005367 Bacteria 6678
87 Ga0070667_100015623 3300005367 Bacteria 6277
88 Ga0070667_100029674 3300005367 Bacteria 4559
89 Ga0070667_100029828 3300005367 Bacteria 4547
90 Ga0070667_100061948 3300005367 Bacteria 3168
91 Ga0070667_100067856 3300005367 Bacteria 3034
92 Ga0070667_100112170 3300005367 Bacteria 2365
93 Ga0070709_10013335 3300005434 Bacteria 4619
94 Ga0070663_100009546 3300005455 Bacteria 6011
95 Ga0070663_100108990 3300005455 Bacteria 2078
96 Ga0070678_100014114 3300005456 Bacteria 5030
97 Ga0070678_100029639 3300005456 Bacteria 3750
98 Ga0070678_100056340 3300005456 Bacteria 2874
99 Ga0070678_100094791 3300005456 Bacteria 2298
100 Ga0070662_100000022 3300005457 Bacteria 92004
101 Ga0070662_100016187 3300005457 Bacteria 5004
102 Ga0070662_100031112 3300005457 Bacteria 3742
103 Ga0070662_100031366 3300005457 Bacteria 3729
104 Ga0070662_100035733 3300005457 Bacteria 3511
105 Ga0070662_100128730 3300005457 Bacteria 1949
106 Ga0070681_10007779 3300005458 Bacteria 10478
107 Ga0070681_10014453 3300005458 Bacteria 7857
108 Ga0068867_100061318 3300005459 Bacteria 2792
109 Ga0070679_100126047 3300005530 Bacteria 2543
110 Ga0070684_100015409 3300005535 Bacteria 6226
111 Ga0068853_100001208 3300005539 Bacteria 18423
112 Ga0068853_100018121 3300005539 Bacteria 5823
113 Ga0068853_100038037 3300005539 Bacteria 4097
114 Ga0068853_100112634 3300005539 Bacteria 2418
115 Ga0070672_100000915 3300005543 Bacteria 17683
116 Ga0070672_100002521 3300005543 Bacteria 11659
117 Ga0070672_100012963 3300005543 Bacteria 5875
118 Ga0070672_100017235 3300005543 Bacteria 5194
119 Ga0070672_100017307 3300005543 Bacteria 5184
120 Ga0070672_100057539 3300005543 Bacteria 3052
121 Ga0070672_100110067 3300005543 Bacteria 2244
122 Ga0070672_100149864 3300005543 Bacteria 1929
123 Ga0070693_100000497 3300005547 Bacteria 17569
124 Ga0070693_100058332 3300005547 Bacteria 2234
125 Ga0070665_100013074 3300005548 Bacteria 8358
126 Ga0070665_100013752 3300005548 Bacteria 8144
127 Ga0070665_100020022 3300005548 Bacteria 6718
128 Ga0070665_100029481 3300005548 Bacteria 5523
129 Ga0070665_100063856 3300005548 Bacteria 3692
130 Ga0070665_100103745 3300005548 Bacteria 2846
131 Ga0068855_100002206 3300005563 Bacteria 24089
132 Ga0068855_100024175 3300005563 Bacteria 7273
133 Ga0068855_100047107 3300005563 Bacteria 5094
134 Ga0068855_100106608 3300005563 Bacteria 3220
135 Ga0068855_100306901 3300005563 Bacteria 1756
136 Ga0070664_100000138 3300005564 Bacteria 49167
137 Ga0070664_100002412 3300005564 Bacteria 15019
138 Ga0070664_100005105 3300005564 Bacteria 10536
139 Ga0070664_100006307 3300005564 Bacteria 9571
140 Ga0070664_100022109 3300005564 Bacteria 5245
141 Ga0070664_100045815 3300005564 Bacteria 3693
142 Ga0070664_100139229 3300005564 Bacteria 2136
143 Ga0068857_100030688 3300005577 Bacteria 4747
144 Ga0068857_100056889 3300005577 Bacteria 3471
145 Ga0068854_100012348 3300005578 Bacteria 5591
146 Ga0068856_100000081 3300005614 Bacteria 88388
147 Ga0068852_100009692 3300005616 Bacteria 7157
148 Ga0068852_100017152 3300005616 Bacteria 5674
149 Ga0068852_100023845 3300005616 Bacteria 4934
150 Ga0068852_100136700 3300005616 Bacteria 2263
151 Ga0068859_100000229 3300005617 Bacteria 55082
152 Ga0068859_100023440 3300005617 Bacteria 6193
153 Ga0068859_100206032 3300005617 Bacteria 2052
154 Ga0068864_100000345 3300005618 Bacteria 40863
155 Ga0068864_100022334 3300005618 Bacteria 5305
156 Ga0068864_100044588 3300005618 Bacteria 3802
157 Ga0068864_100151199 3300005618 Bacteria 2103
158 Ga0068866_10011269 3300005718 Bacteria 3862
159 Ga0068866_10026707 3300005718 Bacteria 2730
160 Ga0068851_10062646 3300005834 Bacteria 1908
161 Ga0068863_100000847 3300005841 Bacteria 30527
162 Ga0068863_100007002 3300005841 Bacteria 11053
163 Ga0068863_100012003 3300005841 Bacteria 8371
164 Ga0068863_100108329 3300005841 Bacteria 2644
165 Ga0068863_100187574 3300005841 Bacteria 1987
166 Ga0068858_100001546 3300005842 Bacteria 23625
167 Ga0068858_100006688 3300005842 Bacteria 11216
168 Ga0068858_100022341 3300005842 Bacteria 5905
169 Ga0068858_100036057 3300005842 Bacteria 4586
170 Ga0068858_100095511 3300005842 Bacteria 2770
171 Ga0068860_100018846 3300005843 Bacteria 6705
172 Ga0068860_100126561 3300005843 Bacteria 2449
173 Ga0068862_100048076 3300005844 Bacteria 3642
174 Ga0068862_100107758 3300005844 Bacteria 2443
175 Ga0070712_100012752 3300006175 Bacteria 5351
176 Ga0097621_100052088 3300006237 Bacteria 3333
177 Ga0097621_100074913 3300006237 Bacteria 2804
178 Ga0068871_100107219 3300006358 Bacteria 2346
179 Ga0075428_100160490 3300006844 Bacteria 2440
180 Ga0068865_100012328 3300006881 Bacteria 5377
181 Ga0068865_100013041 3300006881 Bacteria 5242
182 Ga0068865_100037249 3300006881 Bacteria 3283
183 Ga0097620_100000229 3300006931 Bacteria 55082
184 Ga0097620_100023440 3300006931 Bacteria 6193
185 Ga0097620_100206010 3300006931 Bacteria 2052
186 Ga0105240_10026038 3300009093 Bacteria 7681
187 Ga0105245_10003796 3300009098 Bacteria 13436
188 Ga0105245_10256246 3300009098 Bacteria 1701
189 Ga0105243_10006826 3300009148 Bacteria 8800
190 Ga0105248_10000075 3300009177 Bacteria 114243
191 Ga0105248_10000182 3300009177 Bacteria 73487
192 Ga0105248_10002024 3300009177 Bacteria 22480
193 Ga0105248_10024379 3300009177 Bacteria 6727
194 Ga0105248_10045763 3300009177 Bacteria 4906
195 Ga0105248_10063637 3300009177 Bacteria 4141
196 Ga0105248_10344260 3300009177 Bacteria 1678
197 Ga0105237_10127935 3300009545 Bacteria 2534
198 Ga0105238_10019329 3300009551 Bacteria 6938
199 Ga0105238_10035054 3300009551 Bacteria 5104
200 Ga0105238_10062592 3300009551 Bacteria 3721
201 Ga0105238_10085918 3300009551 Bacteria 3133
202 Ga0105249_10021602 3300009553 Bacteria 5763
203 Ga0105239_10151598 3300010375 Bacteria 2587
204 Ga0157373_10016531 3300013100 Bacteria 5380
205 Ga0157373_10017724 3300013100 Bacteria 5184
206 Ga0157373_10018394 3300013100 Bacteria 5088
207 Ga0157373_10066172 3300013100 Bacteria 2557
208 Ga0157373_10066306 3300013100 Bacteria 2554
209 Ga0157373_10079757 3300013100 Bacteria 2309
210 Ga0157373_10094698 3300013100 Bacteria 2102
211 Ga0157371_10000975 3300013102 Bacteria 31794
212 Ga0157371_10103497 3300013102 Bacteria 2020
213 Ga0157370_10049513 3300013104 Bacteria 4021
214 Ga0157370_10060746 3300013104 Bacteria 3587
215 Ga0157369_10002396 3300013105 Bacteria 22523
216 Ga0157369_10091676 3300013105 Bacteria 3243
217 Ga0157374_10305951 3300013296 Bacteria 1573
218 Ga0157378_10060890 3300013297 Bacteria 3368
219 Ga0163162_10010801 3300013306 Bacteria 8884
220 Ga0157372_10111834 3300013307 Bacteria 3129
221 Ga0157372_10152788 3300013307 Bacteria 2665
222 Ga0157372_10153093 3300013307 Bacteria 2662
223 Ga0157375_10064257 3300013308 Bacteria 3653
224 Ga0163163_10000058 3300014325 Bacteria 123478
225 Ga0163163_10001001 3300014325 Bacteria 23939
226 Ga0163163_10061882 3300014325 Bacteria 3709
227 Ga0163163_10065730 3300014325 Bacteria 3601
228 Ga0163163_10070995 3300014325 Bacteria 3469
229 Ga0157379_10193594 3300014968 Bacteria 1837
230 Ga0157376_10006900 3300014969 Bacteria 8044
231 Ga0163161_10052641 3300017792 Bacteria 2951
232 Ga0206356_10267915 3300020070 Bacteria 2035
233 Ga0207682_10005004 3300025893 Bacteria 5436
234 Ga0207688_10086812 3300025901 Bacteria 1793
235 Ga0207680_10000521 3300025903 Bacteria 18396
236 Ga0207680_10011218 3300025903 Bacteria 4519
237 Ga0207680_10073085 3300025903 Bacteria 2131
238 Ga0207680_10150599 3300025903 Bacteria 1551
239 Ga0207647_10004786 3300025904 Bacteria 10021
240 Ga0207647_10005361 3300025904 Bacteria 9424
241 Ga0207647_10012939 3300025904 Bacteria 5798
242 Ga0207647_10023027 3300025904 Bacteria 4127
243 Ga0207647_10050006 3300025904 Bacteria 2590
244 Ga0207645_10006439 3300025907 Bacteria 8424
245 Ga0207645_10057696 3300025907 Bacteria 2479
246 Ga0207645_10080385 3300025907 Bacteria 2090
247 Ga0207643_10036646 3300025908 Bacteria 2751
248 Ga0207643_10053821 3300025908 Bacteria 2287
249 Ga0207705_10000074 3300025909 Bacteria 123863
250 Ga0207705_10002990 3300025909 Bacteria 12903
251 Ga0207705_10006355 3300025909 Bacteria 8764
252 Ga0207705_10009654 3300025909 Bacteria 7017
253 Ga0207705_10009684 3300025909 Bacteria 7007
254 Ga0207705_10052623 3300025909 Bacteria 2932
255 Ga0207705_10071787 3300025909 Bacteria 2510
256 Ga0207705_10084603 3300025909 Bacteria 2316
257 Ga0207705_10105097 3300025909 Bacteria 2081
258 Ga0207705_10136620 3300025909 Bacteria 1828
259 Ga0207707_10006125 3300025912 Bacteria 10514
260 Ga0207707_10047426 3300025912 Bacteria 3741
261 Ga0207707_10102466 3300025912 Bacteria 2502
262 Ga0207693_10032821 3300025915 Bacteria 4097
263 Ga0207660_10002493 3300025917 Bacteria 12101
264 Ga0207660_10011303 3300025917 Bacteria 5805
265 Ga0207660_10012572 3300025917 Bacteria 5544
266 Ga0207660_10119390 3300025917 Bacteria 1995
267 Ga0207657_10000157 3300025919 Bacteria 69693
268 Ga0207657_10002013 3300025919 Bacteria 21966
269 Ga0207657_10002687 3300025919 Bacteria 19162
270 Ga0207657_10005878 3300025919 Bacteria 12782
271 Ga0207657_10007645 3300025919 Bacteria 11059
272 Ga0207657_10007779 3300025919 Bacteria 10941
273 Ga0207657_10008801 3300025919 Bacteria 10211
274 Ga0207657_10011586 3300025919 Bacteria 8747
275 Ga0207657_10012318 3300025919 Bacteria 8450
276 Ga0207657_10016273 3300025919 Bacteria 7177
277 Ga0207657_10020766 3300025919 Bacteria 6198
278 Ga0207657_10031277 3300025919 Bacteria 4824
279 Ga0207657_10033600 3300025919 Bacteria 4622
280 Ga0207657_10058665 3300025919 Bacteria 3310
281 Ga0207657_10088388 3300025919 Bacteria 2590
282 Ga0207649_10000433 3300025920 Bacteria 30337
283 Ga0207649_10012632 3300025920 Bacteria 4691
284 Ga0207649_10045333 3300025920 Bacteria 2695
285 Ga0207649_10119428 3300025920 Bacteria 1775
286 Ga0207652_10009987 3300025921 Bacteria 7642
287 Ga0207652_10097314 3300025921 Bacteria 2593
288 Ga0207652_10115769 3300025921 Bacteria 2381
289 Ga0207681_10141420 3300025923 Bacteria 1793
290 Ga0207694_10010084 3300025924 Bacteria 7120
291 Ga0207694_10105802 3300025924 Bacteria 2234
292 Ga0207650_10097799 3300025925 Bacteria 2254
293 Ga0207659_10005364 3300025926 Bacteria 7768
294 Ga0207659_10007155 3300025926 Bacteria 6848
295 Ga0207700_10084392 3300025928 Bacteria 2489
296 Ga0207644_10006041 3300025931 Bacteria 7895
297 Ga0207644_10006089 3300025931 Bacteria 7868
298 Ga0207644_10017902 3300025931 Bacteria 4791
299 Ga0207644_10019669 3300025931 Bacteria 4584
300 Ga0207644_10027913 3300025931 Bacteria 3902
301 Ga0207644_10046351 3300025931 Bacteria 3096
302 Ga0207644_10058186 3300025931 Bacteria 2793
303 Ga0207644_10067505 3300025931 Bacteria 2606
304 Ga0207644_10093438 3300025931 Bacteria 2246
305 Ga0207644_10116478 3300025931 Bacteria 2028
306 Ga0207690_10000477 3300025932 Bacteria 25777
307 Ga0207690_10004880 3300025932 Bacteria 7910
308 Ga0207690_10005751 3300025932 Bacteria 7329
309 Ga0207690_10011855 3300025932 Bacteria 5212
310 Ga0207690_10017638 3300025932 Bacteria 4364
311 Ga0207690_10064905 3300025932 Bacteria 2495
312 Ga0207690_10079914 3300025932 Bacteria 2280
313 Ga0207690_10131252 3300025932 Bacteria 1834
314 Ga0207706_10000467 3300025933 Bacteria 43202
315 Ga0207706_10002170 3300025933 Bacteria 19162
316 Ga0207706_10004027 3300025933 Bacteria 13904
317 Ga0207706_10004474 3300025933 Bacteria 13129
318 Ga0207706_10013943 3300025933 Bacteria 7288
319 Ga0207706_10027984 3300025933 Bacteria 5036
320 Ga0207706_10036807 3300025933 Bacteria 4347
321 Ga0207706_10061179 3300025933 Bacteria 3316
322 Ga0207706_10062951 3300025933 Bacteria 3267
323 Ga0207706_10097886 3300025933 Bacteria 2580
324 Ga0207706_10184023 3300025933 Bacteria 1835
325 Ga0207669_10006176 3300025937 Bacteria 5452
326 Ga0207669_10062215 3300025937 Bacteria 2298
327 Ga0207691_10006609 3300025940 Bacteria 11193
328 Ga0207691_10010630 3300025940 Bacteria 8831
329 Ga0207691_10016586 3300025940 Bacteria 6992
330 Ga0207691_10027852 3300025940 Bacteria 5295
331 Ga0207691_10030444 3300025940 Bacteria 5043
332 Ga0207691_10075204 3300025940 Bacteria 3045
333 Ga0207691_10087685 3300025940 Bacteria 2792
334 Ga0207711_10000077 3300025941 Bacteria 106500
335 Ga0207711_10001076 3300025941 Bacteria 26074
336 Ga0207711_10002103 3300025941 Bacteria 17986
337 Ga0207711_10002364 3300025941 Bacteria 16892
338 Ga0207711_10008676 3300025941 Bacteria 8505
339 Ga0207711_10023918 3300025941 Bacteria 5113
340 Ga0207711_10064138 3300025941 Bacteria 3172
341 Ga0207689_10067101 3300025942 Bacteria 2949
342 Ga0207661_10024293 3300025944 Bacteria 4591
343 Ga0207679_10001769 3300025945 Bacteria 13444
344 Ga0207679_10004537 3300025945 Bacteria 8650
345 Ga0207679_10010301 3300025945 Bacteria 6016
346 Ga0207679_10022262 3300025945 Bacteria 4313
347 Ga0207667_10016297 3300025949 Bacteria 8399
348 Ga0207667_10039245 3300025949 Bacteria 5048
349 Ga0207667_10333570 3300025949 Bacteria 1548
350 Ga0207667_10335176 3300025949 Bacteria 1544
351 Ga0207651_10003316 3300025960 Bacteria 7893
352 Ga0207651_10007619 3300025960 Bacteria 5778
353 Ga0207651_10009878 3300025960 Bacteria 5252
354 Ga0207651_10011874 3300025960 Bacteria 4896
355 Ga0207651_10073620 3300025960 Bacteria 2429
356 Ga0207712_10004701 3300025961 Bacteria 8624
357 Ga0207668_10008681 3300025972 Bacteria 6070
358 Ga0207668_10029318 3300025972 Bacteria 3607
359 Ga0207668_10120338 3300025972 Bacteria 1987
360 Ga0207658_10000909 3300025986 Bacteria 24536
361 Ga0207658_10001752 3300025986 Bacteria 16336
362 Ga0207658_10002619 3300025986 Bacteria 13065
363 Ga0207658_10006355 3300025986 Bacteria 8069
364 Ga0207658_10008002 3300025986 Bacteria 7199
365 Ga0207658_10051927 3300025986 Bacteria 3023
366 Ga0207677_10007283 3300026023 Bacteria 6105
367 Ga0207703_10001259 3300026035 Bacteria 23655
368 Ga0207703_10001679 3300026035 Bacteria 19907
369 Ga0207703_10012275 3300026035 Bacteria 6680
370 Ga0207703_10031339 3300026035 Bacteria 4203
371 Ga0207703_10085832 3300026035 Bacteria 2635
372 Ga0207639_10000988 3300026041 Bacteria 19371
373 Ga0207639_10078764 3300026041 Bacteria 2602
374 Ga0207639_10222031 3300026041 Bacteria 1632
375 Ga0207678_10002294 3300026067 Bacteria 17328
376 Ga0207678_10002627 3300026067 Bacteria 16366
377 Ga0207678_10002700 3300026067 Bacteria 16086
378 Ga0207678_10011464 3300026067 Bacteria 7784
379 Ga0207678_10025801 3300026067 Bacteria 5128
380 Ga0207678_10037331 3300026067 Bacteria 4225
381 Ga0207702_10001420 3300026078 Bacteria 23930
382 Ga0207641_10000140 3300026088 Bacteria 105699
383 Ga0207641_10007415 3300026088 Bacteria 9124
384 Ga0207641_10044460 3300026088 Bacteria 3735
385 Ga0207641_10059881 3300026088 Bacteria 3244
386 Ga0207641_10095694 3300026088 Bacteria 2607
387 Ga0207648_10003316 3300026089 Bacteria 16906
388 Ga0207648_10003663 3300026089 Bacteria 16080
389 Ga0207648_10024998 3300026089 Bacteria 5324
390 Ga0207648_10046701 3300026089 Bacteria 3797
391 Ga0207676_10000842 3300026095 Bacteria 23809
392 Ga0207674_10000501 3300026116 Bacteria 51694
393 Ga0207674_10004823 3300026116 Bacteria 16161
394 Ga0207674_10005006 3300026116 Bacteria 15830
395 Ga0207674_10005899 3300026116 Bacteria 14519
396 Ga0207674_10048245 3300026116 Bacteria 4359
397 Ga0207674_10071983 3300026116 Bacteria 3473
398 Ga0207674_10185580 3300026116 Unclassified 2030
399 Ga0207675_100081469 3300026118 Bacteria 3034
400 Ga0207683_10002725 3300026121 Bacteria 15428
401 Ga0207683_10005866 3300026121 Bacteria 10532
402 Ga0207683_10006055 3300026121 Bacteria 10355
403 Ga0207683_10007196 3300026121 Bacteria 9538
404 Ga0207683_10017399 3300026121 Bacteria 6127
405 Ga0207683_10045496 3300026121 Bacteria 3839
406 Ga0207698_10006998 3300026142 Bacteria 7060
407 Ga0207698_10029236 3300026142 Bacteria 3943
408 Ga0207698_10033728 3300026142 Bacteria 3724
409 Ga0209974_10001137 3300027876 Bacteria 9466
410 Ga0268266_10009735 3300028379 Bacteria 8451
411 Ga0268266_10020608 3300028379 Bacteria 5617
412 Ga0268265_10072791 3300028380 Bacteria 2682
413 Ga0268264_10001603 3300028381 Bacteria 20935
414 Ga0307408_100030085 3300031548 Bacteria 3768
415 Ga0307408_100094730 3300031548 Bacteria 2261
416 Ga0307405_10002870 3300031731 Bacteria 7747
417 Ga0307405_10069969 3300031731 Bacteria 2251
418 Ga0307413_10076757 3300031824 Bacteria 2125
419 Ga0307413_10091212 3300031824 Bacteria 1984
420 Ga0307410_10010906 3300031852 Bacteria 5173
421 Ga0307410_10038418 3300031852 Bacteria 3136
422 Ga0307410_10046258 3300031852 Bacteria 2902
423 Ga0307410_10050750 3300031852 Bacteria 2792
424 Ga0307410_10057504 3300031852 Bacteria 2648
425 Ga0307410_10094056 3300031852 Bacteria 2134
426 Ga0307406_10042796 3300031901 Bacteria 2829
427 Ga0307406_10095304 3300031901 Bacteria 2013
428 Ga0307407_10003693 3300031903 Bacteria 6340
429 Ga0307407_10003932 3300031903 Bacteria 6203
430 Ga0307407_10083972 3300031903 Bacteria 1933
431 Ga0307412_10009401 3300031911 Bacteria 5608
432 Ga0307412_10022224 3300031911 Bacteria 3885
433 Ga0307412_10103969 3300031911 Bacteria 2014
434 Ga0307409_100027297 3300031995 Bacteria 4044
435 Ga0307409_100054141 3300031995 Bacteria 3088
436 Ga0307409_100100673 3300031995 Bacteria 2396
437 Ga0307409_100274634 3300031995 Bacteria 1554
438 Ga0307416_100007055 3300032002 Bacteria 7094
439 Ga0307416_100043208 3300032002 Bacteria 3527
440 Ga0307416_100090541 3300032002 Bacteria 2623
441 Ga0307414_10010270 3300032004 Bacteria 5423
442 Ga0307414_10017196 3300032004 Bacteria 4418
443 Ga0307414_10048665 3300032004 Bacteria 2926
444 Ga0307414_10049847 3300032004 Bacteria 2897
445 Ga0307414_10208386 3300032004 Bacteria 1596
446 Ga0307414_10239902 3300032004 Bacteria 1500
447 Ga0307411_10014906 3300032005 Bacteria 4343
448 Ga0307411_10018070 3300032005 Bacteria 4036
449 Ga0307411_10021477 3300032005 Bacteria 3779
450 Ga0307411_10065055 3300032005 Bacteria 2444
451 Ga0307411_10123939 3300032005 Bacteria 1875
452 Ga0307415_100009218 3300032126 Bacteria 5517
453 Ga0307415_100080470 3300032126 Bacteria 2324
454 Ga0373931_0034411 3300035691 Bacteria 2630
455 Ga0373935_0003447 3300035692 Bacteria 9188
456 Ga0373927_0009054 3300035695 Bacteria 6684
457 Ga0373925_0010966 3300037068 Bacteria 6578
458 Ga0395899_0001237 3300037312 Bacteria 22285
459 Ga0395899_0001530 3300037312 Bacteria 19532
460 Ga0395899_0028372 3300037312 Bacteria 4215
461 Ga0395899_0040811 3300037312 Bacteria 3470
462 Ga0395899_0041454 3300037312 Bacteria 3440
463 Ga0395899_0071734 3300037312 Bacteria 2535
464 Ga0395900_0000471 3300037418 Bacteria 57583
465 Ga0395900_0009637 3300037418 Bacteria 9905
466 Ga0395900_0019388 3300037418 Bacteria 6937
467 Ga0395900_0053238 3300037418 Bacteria 4165
468 Ga0395900_0081743 3300037418 Bacteria 3319
469 Ga0395900_0084599 3300037418 Bacteria 3260
470 Ga0395900_0141021 3300037418 Bacteria 2468
471 Ga0395900_0152338 3300037418 Bacteria 2362
472 Ga0395900_0282602 3300037418 Bacteria 1651
473 Ga0395898_0001652 3300037466 Bacteria 30116
474 Ga0395898_0002475 3300037466 Bacteria 21781
475 Ga0395898_0011889 3300037466 Bacteria 9013
476 Ga0395898_0078919 3300037466 Bacteria 3176
477 Ga0395898_0192445 3300037466 Bacteria 1949
478 Ga0395905_0000207 3300037471 Bacteria 91620
479 Ga0395905_0001992 3300037471 Bacteria 23333
480 Ga0395905_0002771 3300037471 Bacteria 19201
481 Ga0395905_0004078 3300037471 Bacteria 15315
482 Ga0395905_0016717 3300037471 Bacteria 6972
483 Ga0395905_0016791 3300037471 Bacteria 6954
484 Ga0395905_0018665 3300037471 Bacteria 6578
485 Ga0395905_0021032 3300037471 Bacteria 6178
486 Ga0395905_0032487 3300037471 Bacteria 4908
487 Ga0395905_0057894 3300037471 Bacteria 3624
488 Ga0395905_0103947 3300037471 Bacteria 2666
489 Ga0395905_0314114 3300037471 Bacteria 1456
490 Ga0395901_0000064 3300038443 Bacteria 147477
491 Ga0395901_0000707 3300038443 Bacteria 38127
492 Ga0395901_0012364 3300038443 Bacteria 8659
493 Ga0395901_0012598 3300038443 Bacteria 8582
494 Ga0395901_0014446 3300038443 Bacteria 8035
495 Ga0395901_0018225 3300038443 Bacteria 7168
496 Ga0395901_0048648 3300038443 Bacteria 4403
497 Ga0395901_0056748 3300038443 Bacteria 4074
498 Ga0395901_0059317 3300038443 Bacteria 3981
499 Ga0395901_0116800 3300038443 Bacteria 2803
500 Ga0450905_000702 3300042142 Bacteria 4099
501 Ga0439458_0000161 3300042157 Bacteria 14947
502 Ga0439458_0004822 3300042157 Bacteria 3063
503 Ga0439464_0005802 3300042439 Bacteria 3201
504 Ga0466961_0100647 3300044693 Bacteria 1821
505 Ga0466963_0000677 3300044694 Bacteria 16540
506 Ga0466963_0005361 3300044694 Bacteria 7503
507 Ga0466964_0046892 3300044706 Bacteria 1762
508 Ga0466957_0000784 3300044842 Bacteria 16257
509 Ga0466957_0001134 3300044842 Bacteria 13809
510 Ga0466957_0004343 3300044842 Bacteria 7876
511 Ga0466958_0009218 3300045836 Bacteria 5491
512 Ga0466967_0000210 3300045976 Bacteria 24683
513 Ga0466967_0006173 3300045976 Bacteria 8441
514 Ga0466967_0006807 3300045976 Bacteria 8148
515 Ga0466967_0037039 3300045976 Bacteria 4170
516 Ga0495663_0001517 3300046525 Bacteria 7299
517 Ga0495598_0001383 3300046537 Bacteria 4781
518 Ga0495621_0000042 3300046539 Bacteria 25037
519 Ga0495621_0012032 3300046539 Bacteria 2691
520 Ga0495633_0001268 3300046558 Bacteria 20101
521 Ga0495669_0002641 3300046684 Bacteria 7336
522 Ga0495669_0004350 3300046684 Bacteria 5847
523 Ga0495669_0013334 3300046684 Bacteria 3501
524 Ga0495669_0014841 3300046684 Bacteria 3332
525 Ga0495669_0024953 3300046684 Unclassified 2605
526 Ga0495669_0026332 3300046684 Bacteria 2541
527 Ga0495670_0000672 3300046691 Bacteria 16268
528 Ga0495677_0015835 3300047445 Bacteria 2738
529 Ga0496101_0205521 3300048904 Bacteria 1524
530 Ga0496103_0071122 3300048906 Bacteria 2177
531 Ga0496105_0047438 3300048908 Bacteria 3545
532 Ga0496106_0020518 3300048909 Bacteria 4905
533 Ga0496106_0047868 3300048909 Bacteria 3219
534 Ga0496106_0065222 3300048909 Bacteria 2772
535 Ga0496108_0001136 3300048911 Bacteria 20807
536 Ga0496108_0024564 3300048911 Bacteria 4963
537 Ga0496108_0047486 3300048911 Bacteria 3588
538 Ga0496108_0064017 3300048911 Bacteria 3097
539 Ga0496108_0091182 3300048911 Bacteria 2591
540 Ga0496109_0001260 3300048912 Bacteria 21036
541 Ga0496109_0013902 3300048912 Bacteria 6998
542 Ga0496109_0013912 3300048912 Bacteria 6996
543 Ga0496109_0014854 3300048912 Bacteria 6775
544 Ga0496109_0078586 3300048912 Bacteria 3038
545 Ga0496110_0003971 3300048913 Bacteria 11387
546 Ga0496110_0008917 3300048913 Bacteria 8086
547 Ga0496110_0105444 3300048913 Bacteria 2529
548 Ga0496111_0017006 3300048914 Bacteria 5020
549 Ga0496111_0072463 3300048914 Bacteria 2507
550 Ga0496112_0003735 3300048915 Bacteria 12717
551 Ga0496112_0282563 3300048915 Bacteria 1606
552 Ga0496113_0000385 3300048916 Bacteria 21314
553 Ga0496114_0000021 3300048917 Bacteria 227038
554 Ga0501067_0024559 3300049583 Bacteria 3343
555 2896430315 2896429255 Bacteria 2557483
556 Ga0070666_10082693
557 JGI24741J21665_1004002
558 JGI24740J21852_10009307
559 JGI24739J22299_10032090
560 JGI24737J22298_10000460
561 JGI24737J22298_10008605
562 JGI24735J21928_10020173
563 JGI24744J21845_10000171
564 Ga0070658_10000210
565 Ga0070658_10008759
566 Ga0070658_10031597
567 Ga0070658_10036741
568 Ga0070658_10045589
569 Ga0070658_10053979
570 Ga0070658_10057302
571 Ga0070658_10064062
572 Ga0070658_10099555
573 Ga0070658_10109347
574 Ga0070676_10018445
575 Ga0070676_10041081
576 Ga0070683_100005036
577 Ga0070683_100036840
578 Ga0070690_100030050
579 Ga0070690_100074168
580 Ga0070670_100001623
581 Ga0070670_100005749
582 Ga0070670_100031141
583 Ga0070670_100046020
584 Ga0070670_100053677
585 Ga0070670_100104006
586 Ga0070677_10007722
587 Ga0070666_10000173
588 Ga0070666_10000717
589 Ga0070666_10004664
590 Ga0070666_10020531
591 Ga0070680_100000952
592 Ga0070680_100003690
593 Ga0070680_100054112
594 Ga0068868_100014516
595 Ga0070660_100000033
596 Ga0070660_100010351
597 Ga0070660_100016869
598 Ga0070660_100040347
599 Ga0070660_100043479
600 Ga0070660_100114949
601 Ga0070660_100175837
602 Ga0070687_100042928
603 Ga0070661_100002672
604 Ga0070661_100008895
605 Ga0070661_100020144
606 Ga0070661_100034065
607 Ga0070661_100034942
608 Ga0070661_100043091
609 Ga0070661_100088777
610 Ga0070661_100096520
611 Ga0070668_100038231
612 Ga0070668_100079904
613 Ga0070668_100131944
614 Ga0070675_100012223
615 Ga0070675_100012614
616 Ga0070671_100000312
617 Ga0070671_100004090
618 Ga0070671_100005670
619 Ga0070671_100096662
620 Ga0070671_100138029
621 Ga0070674_100002956
622 Ga0070674_100003300
623 Ga0070674_100015464
624 Ga0070674_100054067
625 Ga0070674_100067867
626 Ga0070673_100003309
627 Ga0070673_100005053
628 Ga0070673_100013570
629 Ga0070659_100001891
630 Ga0070659_100002898
631 Ga0070659_100005748
632 Ga0070659_100018266
633 Ga0070659_100018438
634 Ga0070659_100036964
635 Ga0070659_100041491
636 Ga0070659_100081925
637 Ga0070659_100149400
638 Ga0070659_100176197
639 Ga0070667_100001262
640 Ga0070667_100001721
641 Ga0070667_100013801
642 Ga0070667_100015623
643 Ga0070667_100029674
644 Ga0070667_100029828
645 Ga0070667_100061948
646 Ga0070667_100067856
647 Ga0070667_100112170
648 Ga0070709_10013335
649 Ga0070663_100009546
650 Ga0070663_100108990
651 Ga0070678_100014114
652 Ga0070678_100029639
653 Ga0070678_100056340
654 Ga0070678_100094791
655 Ga0070662_100000022
656 Ga0070662_100016187
657 Ga0070662_100031112
658 Ga0070662_100031366
659 Ga0070662_100035733
660 Ga0070662_100128730
661 Ga0070681_10007779
662 Ga0070681_10014453
663 Ga0068867_100061318
664 Ga0070679_100126047
665 Ga0070684_100015409
666 Ga0068853_100001208
667 Ga0068853_100018121
668 Ga0068853_100038037
669 Ga0068853_100112634
670 Ga0070672_100000915
671 Ga0070672_100002521
672 Ga0070672_100012963
673 Ga0070672_100017235
674 Ga0070672_100017307
675 Ga0070672_100057539
676 Ga0070672_100110067
677 Ga0070672_100149864
678 Ga0070693_100000497
679 Ga0070693_100058332
680 Ga0070665_100013074
681 Ga0070665_100013752
682 Ga0070665_100020022
683 Ga0070665_100029481
684 Ga0070665_100063856
685 Ga0070665_100103745
686 Ga0068855_100002206
687 Ga0068855_100024175
688 Ga0068855_100047107
689 Ga0068855_100106608
690 Ga0068855_100306901
691 Ga0070664_100000138
692 Ga0070664_100002412
693 Ga0070664_100005105
694 Ga0070664_100006307
695 Ga0070664_100022109
696 Ga0070664_100045815
697 Ga0070664_100139229
698 Ga0068857_100030688
699 Ga0068857_100056889
700 Ga0068854_100012348
701 Ga0068856_100000081
702 Ga0068852_100009692
703 Ga0068852_100017152
704 Ga0068852_100023845
705 Ga0068852_100136700
706 Ga0068859_100000229
707 Ga0068859_100023440
708 Ga0068859_100206032
709 Ga0068864_100000345
710 Ga0068864_100022334
711 Ga0068864_100044588
712 Ga0068864_100151199
713 Ga0068866_10011269
714 Ga0068866_10026707
715 Ga0068851_10062646
716 Ga0068863_100000847
717 Ga0068863_100007002
718 Ga0068863_100012003
719 Ga0068863_100108329
720 Ga0068863_100187574
721 Ga0068858_100001546
722 Ga0068858_100006688
723 Ga0068858_100022341
724 Ga0068858_100036057
725 Ga0068858_100095511
726 Ga0068860_100018846
727 Ga0068860_100126561
728 Ga0068862_100048076
729 Ga0068862_100107758
730 Ga0070712_100012752
731 Ga0097621_100052088
732 Ga0097621_100074913
733 Ga0068871_100107219
734 Ga0075428_100160490
735 Ga0068865_100012328
736 Ga0068865_100013041
737 Ga0068865_100037249
738 Ga0097620_100000229
739 Ga0097620_100023440
740 Ga0097620_100206010
741 Ga0105240_10026038
742 Ga0105245_10003796
743 Ga0105245_10256246
744 Ga0105243_10006826
745 Ga0105248_10000075
746 Ga0105248_10000182
747 Ga0105248_10002024
748 Ga0105248_10024379
749 Ga0105248_10045763
750 Ga0105248_10063637
751 Ga0105248_10344260
752 Ga0105237_10127935
753 Ga0105238_10019329
754 Ga0105238_10035054
755 Ga0105238_10062592
756 Ga0105238_10085918
757 Ga0105249_10021602
758 Ga0105239_10151598
759 Ga0157373_10016531
760 Ga0157373_10017724
761 Ga0157373_10018394
762 Ga0157373_10066172
763 Ga0157373_10066306
764 Ga0157373_10079757
765 Ga0157373_10094698
766 Ga0157371_10000975
767 Ga0157371_10103497
768 Ga0157370_10049513
769 Ga0157370_10060746
770 Ga0157369_10002396
771 Ga0157369_10091676
772 Ga0157374_10305951
773 Ga0157378_10060890
774 Ga0163162_10010801
775 Ga0157372_10111834
776 Ga0157372_10152788
777 Ga0157372_10153093
778 Ga0157375_10064257
779 Ga0163163_10000058
780 Ga0163163_10001001
781 Ga0163163_10061882
782 Ga0163163_10065730
783 Ga0163163_10070995
784 Ga0157379_10193594
785 Ga0157376_10006900
786 Ga0163161_10052641
787 Ga0206356_10267915
788 Ga0207682_10005004
789 Ga0207688_10086812
790 Ga0207680_10000521
791 Ga0207680_10011218
792 Ga0207680_10073085
793 Ga0207680_10150599
794 Ga0207647_10004786
795 Ga0207647_10005361
796 Ga0207647_10012939
797 Ga0207647_10023027
798 Ga0207647_10050006
799 Ga0207645_10006439
800 Ga0207645_10057696
801 Ga0207645_10080385
802 Ga0207643_10036646
803 Ga0207643_10053821
804 Ga0207705_10000074
805 Ga0207705_10002990
806 Ga0207705_10006355
807 Ga0207705_10009654
808 Ga0207705_10009684
809 Ga0207705_10052623
810 Ga0207705_10071787
811 Ga0207705_10084603
812 Ga0207705_10105097
813 Ga0207705_10136620
814 Ga0207707_10006125
815 Ga0207707_10047426
816 Ga0207707_10102466
817 Ga0207693_10032821
818 Ga0207660_10002493
819 Ga0207660_10011303
820 Ga0207660_10012572
821 Ga0207660_10119390
822 Ga0207657_10000157
823 Ga0207657_10002013
824 Ga0207657_10002687
825 Ga0207657_10005878
826 Ga0207657_10007645
827 Ga0207657_10007779
828 Ga0207657_10008801
829 Ga0207657_10011586
830 Ga0207657_10012318
831 Ga0207657_10016273
832 Ga0207657_10020766
833 Ga0207657_10031277
834 Ga0207657_10033600
835 Ga0207657_10058665
836 Ga0207657_10088388
837 Ga0207649_10000433
838 Ga0207649_10012632
839 Ga0207649_10045333
840 Ga0207649_10119428
841 Ga0207652_10009987
842 Ga0207652_10097314
843 Ga0207652_10115769
844 Ga0207681_10141420
845 Ga0207694_10010084
846 Ga0207694_10105802
847 Ga0207650_10097799
848 Ga0207659_10005364
849 Ga0207659_10007155
850 Ga0207700_10084392
851 Ga0207644_10006041
852 Ga0207644_10006089
853 Ga0207644_10017902
854 Ga0207644_10019669
855 Ga0207644_10027913
856 Ga0207644_10046351
857 Ga0207644_10058186
858 Ga0207644_10067505
859 Ga0207644_10093438
860 Ga0207644_10116478
861 Ga0207690_10000477
862 Ga0207690_10004880
863 Ga0207690_10005751
864 Ga0207690_10011855
865 Ga0207690_10017638
866 Ga0207690_10064905
867 Ga0207690_10079914
868 Ga0207690_10131252
869 Ga0207706_10000467
870 Ga0207706_10002170
871 Ga0207706_10004027
872 Ga0207706_10004474
873 Ga0207706_10013943
874 Ga0207706_10027984
875 Ga0207706_10036807
876 Ga0207706_10061179
877 Ga0207706_10062951
878 Ga0207706_10097886
879 Ga0207706_10184023
880 Ga0207669_10006176
881 Ga0207669_10062215
882 Ga0207691_10006609
883 Ga0207691_10010630
884 Ga0207691_10016586
885 Ga0207691_10027852
886 Ga0207691_10030444
887 Ga0207691_10075204
888 Ga0207691_10087685
889 Ga0207711_10000077
890 Ga0207711_10001076
891 Ga0207711_10002103
892 Ga0207711_10002364
893 Ga0207711_10008676
894 Ga0207711_10023918
895 Ga0207711_10064138
896 Ga0207689_10067101
897 Ga0207661_10024293
898 Ga0207679_10001769
899 Ga0207679_10004537
900 Ga0207679_10010301
901 Ga0207679_10022262
902 Ga0207667_10016297
903 Ga0207667_10039245
904 Ga0207667_10333570
905 Ga0207667_10335176
906 Ga0207651_10003316
907 Ga0207651_10007619
908 Ga0207651_10009878
909 Ga0207651_10011874
910 Ga0207651_10073620
911 Ga0207712_10004701
912 Ga0207668_10008681
913 Ga0207668_10029318
914 Ga0207668_10120338
915 Ga0207658_10000909
916 Ga0207658_10001752
917 Ga0207658_10002619
918 Ga0207658_10006355
919 Ga0207658_10008002
920 Ga0207658_10051927
921 Ga0207677_10007283
922 Ga0207703_10001259
923 Ga0207703_10001679
924 Ga0207703_10012275
925 Ga0207703_10031339
926 Ga0207703_10085832
927 Ga0207639_10000988
928 Ga0207639_10078764
929 Ga0207639_10222031
930 Ga0207678_10002294
931 Ga0207678_10002627
932 Ga0207678_10002700
933 Ga0207678_10011464
934 Ga0207678_10025801
935 Ga0207678_10037331
936 Ga0207702_10001420
937 Ga0207641_10000140
938 Ga0207641_10007415
939 Ga0207641_10044460
940 Ga0207641_10059881
941 Ga0207641_10095694
942 Ga0207648_10003316
943 Ga0207648_10003663
944 Ga0207648_10024998
945 Ga0207648_10046701
946 Ga0207676_10000842
947 Ga0207674_10000501
948 Ga0207674_10004823
949 Ga0207674_10005006
950 Ga0207674_10005899
951 Ga0207674_10048245
952 Ga0207674_10071983
953 Ga0207674_10185580
954 Ga0207675_100081469
955 Ga0207683_10002725
956 Ga0207683_10005866
957 Ga0207683_10006055
958 Ga0207683_10007196
959 Ga0207683_10017399
960 Ga0207683_10045496
961 Ga0207698_10006998
962 Ga0207698_10029236
963 Ga0207698_10033728
964 Ga0209974_10001137
965 Ga0268266_10009735
966 Ga0268266_10020608
967 Ga0268265_10072791
968 Ga0268264_10001603
969 Ga0307408_100030085
970 Ga0307408_100094730
971 Ga0307405_10002870
972 Ga0307405_10069969
973 Ga0307413_10076757
974 Ga0307413_10091212
975 Ga0307410_10010906
976 Ga0307410_10038418
977 Ga0307410_10046258
978 Ga0307410_10050750
979 Ga0307410_10057504
980 Ga0307410_10094056
981 Ga0307406_10042796
982 Ga0307406_10095304
983 Ga0307407_10003693
984 Ga0307407_10003932
985 Ga0307407_10083972
986 Ga0307412_10009401
987 Ga0307412_10022224
988 Ga0307412_10103969
989 Ga0307409_100027297
990 Ga0307409_100054141
991 Ga0307409_100100673
992 Ga0307409_100274634
993 Ga0307416_100007055
994 Ga0307416_100043208
995 Ga0307416_100090541
996 Ga0307414_10010270
997 Ga0307414_10017196
998 Ga0307414_10048665
999 Ga0307414_10049847
1000 Ga0307414_10208386
1001 Ga0307414_10239902
1002 Ga0307411_10014906
1003 Ga0307411_10018070
1004 Ga0307411_10021477
1005 Ga0307411_10065055
1006 Ga0307411_10123939
1007 Ga0307415_100009218
1008 Ga0307415_100080470
1009 Ga0373931_0034411
1010 Ga0373935_0003447
1011 Ga0373927_0009054
1012 Ga0373925_0010966
1013 Ga0395899_0001237
1014 Ga0395899_0001530
1015 Ga0395899_0028372
1016 Ga0395899_0040811
1017 Ga0395899_0041454
1018 Ga0395899_0071734
1019 Ga0395900_0000471
1020 Ga0395900_0009637
1021 Ga0395900_0019388
1022 Ga0395900_0053238
1023 Ga0395900_0081743
1024 Ga0395900_0084599
1025 Ga0395900_0141021
1026 Ga0395900_0152338
1027 Ga0395900_0282602
1028 Ga0395898_0001652
1029 Ga0395898_0002475
1030 Ga0395898_0011889
1031 Ga0395898_0078919
1032 Ga0395898_0192445
1033 Ga0395905_0000207
1034 Ga0395905_0001992
1035 Ga0395905_0002771
1036 Ga0395905_0004078
1037 Ga0395905_0016717
1038 Ga0395905_0016791
1039 Ga0395905_0018665
1040 Ga0395905_0021032
1041 Ga0395905_0032487
1042 Ga0395905_0057894
1043 Ga0395905_0103947
1044 Ga0395905_0314114
1045 Ga0395901_0000064
1046 Ga0395901_0000707
1047 Ga0395901_0012364
1048 Ga0395901_0012598
1049 Ga0395901_0014446
1050 Ga0395901_0018225
1051 Ga0395901_0048648
1052 Ga0395901_0056748
1053 Ga0395901_0059317
1054 Ga0395901_0116800
1055 Ga0450905_000702
1056 Ga0439458_0000161
1057 Ga0439458_0004822
1058 Ga0439464_0005802
1059 Ga0466961_0100647
1060 Ga0466963_0000677
1061 Ga0466963_0005361
1062 Ga0466964_0046892
1063 Ga0466957_0000784
1064 Ga0466957_0001134
1065 Ga0466957_0004343
1066 Ga0466958_0009218
1067 Ga0466967_0000210
1068 Ga0466967_0006173
1069 Ga0466967_0006807
1070 Ga0466967_0037039
1071 Ga0495663_0001517
1072 Ga0495598_0001383
1073 Ga0495621_0000042
1074 Ga0495621_0012032
1075 Ga0495633_0001268
1076 Ga0495669_0002641
1077 Ga0495669_0004350
1078 Ga0495669_0013334
1079 Ga0495669_0014841
1080 Ga0495669_0024953
1081 Ga0495669_0026332
1082 Ga0495670_0000672
1083 Ga0495677_0015835
1084 Ga0496101_0205521
1085 Ga0496103_0071122
1086 Ga0496105_0047438
1087 Ga0496106_0020518
1088 Ga0496106_0047868
1089 Ga0496106_0065222
1090 Ga0496108_0001136
1091 Ga0496108_0024564
1092 Ga0496108_0047486
1093 Ga0496108_0064017
1094 Ga0496108_0091182
1095 Ga0496109_0001260
1096 Ga0496109_0013902
1097 Ga0496109_0013912
1098 Ga0496109_0014854
1099 Ga0496109_0078586
1100 Ga0496110_0003971
1101 Ga0496110_0008917
1102 Ga0496110_0105444
1103 Ga0496111_0017006
1104 Ga0496111_0072463
1105 Ga0496112_0003735
1106 Ga0496112_0282563
1107 Ga0496113_0000385
1108 Ga0496114_0000021
1109 Ga0501067_0024559
1110 2896430315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03853

YjeF_N

YjeF-related protein N-terminus

49

203

0.9

PF01256

Carb_kinase

Carbohydrate kinase

252

472

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jzt-assembly1.cif.gz_A crystal structure of yeast ynu0, ynl200c 0.8939 6 180
3k5w-assembly1.cif.gz_A crystal structure of a carbohydrate kinase (yjef family)from helicobacter pylori 0.8935 4 446
3rss-assembly1.cif.gz_A crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadp 0.8835 4 452
2r3b-assembly1.cif.gz_B crystal structure of a ribokinase-like superfamily protein (ef1790) from enterococcus faecalis v583 at 1.80 a resolution 0.8725 203 452
3rss-assembly1.cif.gz_A crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadp 0.8723 4 452
ID Description Score Start End Superfamily
af_P31806_15_224_3.40.50.10260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;YjeF N-terminal domain 0.944 6 199 3.40.50.10260
3rs9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;YjeF N-terminal domain 0.9087 12 201 3.40.50.10260
af_P9WF11_209_473_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9059 215 451 3.40.1190.20
af_P31806_227_500_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9027 203 449 3.40.1190.20
af_I1JV54_91_333_3.40.50.10260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;YjeF N-terminal domain 0.9004 4 181 3.40.50.10260
ID Description Score Start End GO Terms
AF-A0A520I2Q2-F1-model_v4 Bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 0.9776 6 138
AF-A0A541BYT5-F1-model_v4 Bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 0.9642 332 451 GO:0005524
GO:0052855
GO:0052856
GO:0110051
AF-A0A1Y2QG67-F1-model_v4 Bifunctional NAD(P)H-hydrate repair enzyme (Nicotinamide nucleotide repair protein) [Includes: ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136) (ADP-dependent NAD(P)HX dehydratase); NAD(P)H-hydrate epimerase (EC 5.1.99.6)] 0.9637 1 452 GO:0005524
GO:0046496
GO:0046872
GO:0052855
GO:0052856
GO:0110051
AF-A0A3D2SRG1-F1-model_v4 Bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 0.9611 331 451 GO:0005524
GO:0052855
GO:0052856
GO:0110051
AF-A0A520H677-F1-model_v4 Bifunctional NAD(P)H-hydrate repair enzyme Nnr (EC 4.2.1.136) (Nicotinamide nucleotide repair protein) 0.9584 177 451 GO:0005524
GO:0052855
GO:0052856
GO:0110051

Map