F463016

General Info

Members Datasets Scaffolds Average Seq Length
554 346 465 670

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0219547|Ga0436363_0219547_947_3115
Length 722
Sequence MTSAELIPAVILKRKAVVYVRQSTQSQVMTNLESKRRQYDLVDVARQRGFVDVEIIDDDLGRSASGTVARPGFDRLVAWLCAGQVGAVLCFDASRLARNGRDWHHLLELCGLVEARVIDLDGVYNPCRPNDRLLLGMKGSISEFELGVLRARMLDAARSKASRGELRISVPFGYIWHREIGLGLDPDLRLQEMIRIVFTRFRELGSARQVLLSMKADQIHFPRPSDEGRMTSFEWLPIRYRNVIAVLKNPFYAGVYVYGKSEKRTSIIEGRARRSYGHGKPIGTWEVMIKDHHEGYIGWTEYEHNQKQLALNNYGRAGGVKSGRGGRALLSGMMTCGRCGRRLSVAYTGNPQSRPVYRCDKPNLMMGLPRCMTFGGPRVDAAIGRELLLAVEPMAIDAAFEAERMHRQQQEDQQRIRDLEMXXXXYDASLAERRYAACDPDNRLIAAQLEKNWEAALRRVRDLETRRPAEKRSDITVDPNAFTNLADNLSAAWNAPGVTTRARQQLLRTLITDIIVDVDDNAREVILTIHWRGGQHSELRVRKPRAGEHGCATTEDALAVMRSMAGRWSDQHIAASLNRMGMPTGQGKSWTAHRVASVRRVRGIHAYRSAEKDGRWLTMTEAAKALGVTNHTLRRLIKTRVLPAEQVVAGAPYQIRADDLASEPVKMAVARKGRPCRAANADTLPMIPDTSRRGAQWAPRRDLVHIIIGVPNVICCSTVGNC

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
6 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
7 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
8 2516143018 Ensifer sp. BR816 Isolate Nodule
9 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
10 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
11 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
12 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
13 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
14 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
15 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
16 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
17 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
18 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
19 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
20 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
21 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
22 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
23 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
24 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
25 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
26 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
27 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
28 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
29 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
30 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
31 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
32 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
33 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
34 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
35 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
36 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
37 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
38 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
39 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
40 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
41 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
42 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
43 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
44 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
45 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
46 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
47 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
48 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
49 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
50 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
51 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
52 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
53 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
54 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
55 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
56 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
57 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
58 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
59 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
60 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
61 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
62 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
63 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
64 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
65 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
66 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
67 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
68 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
75 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
76 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
84 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
85 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
86 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
140 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
187 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
212 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
221 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
224 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
225 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
276 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
331 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
335 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
336 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
337 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
340 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
341 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
343 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
344 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
345 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
346 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.75
Metatranscriptomes 0.18
Isolates 16.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 14.8
Rhizoplane 5.23
Rhizosphere 69.31
Stem 0
Stem Tuber 0
Unclassified 7.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8089505 2162886012 Bacteria 2608
2 JGI24739J22299_10004124 3300001989 Bacteria 5557
3 JGI24739J22299_10012478 3300001989 Bacteria 3120
4 JGI25406J46586_10002009 3300003203 Bacteria 9612
5 rootL2_10026358 3300003322 Bacteria 3238
6 rootL2_10026359 3300003322 Bacteria 10578
7 rootH1_10085896 3300003323 Bacteria 7084
8 Ga0055536_1000778 3300003781 Bacteria 21262
9 Ga0055540_1000054 3300003792 Bacteria 142505
10 Ga0055531_10000037 3300003794 Bacteria 144244
11 Ga0058692_1004397 3300003856 Bacteria 4186
12 Ga0058692_1004478 3300003856 Bacteria 4134
13 Ga0070683_100064055 3300005329 Bacteria 3421
14 Ga0070683_100081922 3300005329 Bacteria 3022
15 Ga0070690_100031825 3300005330 Bacteria 3289
16 Ga0070682_100047343 3300005337 Bacteria 2673
17 Ga0068868_100094577 3300005338 Bacteria 2411
18 Ga0070668_100064328 3300005347 Bacteria 2844
19 Ga0070675_100074203 3300005354 Bacteria 2825
20 Ga0070671_100060566 3300005355 Bacteria 3151
21 Ga0070671_100088412 3300005355 Bacteria 2593
22 Ga0070671_100093021 3300005355 Bacteria 2527
23 Ga0070673_100048353 3300005364 Bacteria 3315
24 Ga0070673_100073044 3300005364 Bacteria 2760
25 Ga0070711_100043773 3300005439 Plasmid 3034
26 Ga0070708_100061651 3300005445 Bacteria 3351
27 Ga0070663_100051147 3300005455 Bacteria 2942
28 Ga0070663_100065518 3300005455 Bacteria 2630
29 Ga0070678_100049194 3300005456 Bacteria 3041
30 Ga0070681_10101315 3300005458 Bacteria 2825
31 Ga0070706_100120696 3300005467 Bacteria 2443
32 Ga0070699_100069758 3300005518 Bacteria 3054
33 Ga0070684_100069115 3300005535 Bacteria 3106
34 Ga0070684_100111395 3300005535 Bacteria 2454
35 Ga0070672_100073734 3300005543 Bacteria 2721
36 Ga0070686_100045733 3300005544 Bacteria 2758
37 Ga0070665_100048566 3300005548 Bacteria 4260
38 Ga0068855_100192848 3300005563 Bacteria 2297
39 Ga0070664_100117148 3300005564 Bacteria 2330
40 Ga0068856_100100498 3300005614 Unclassified 2884
41 Ga0068852_100089391 3300005616 Bacteria 2753
42 Ga0068866_10029028 3300005718 Bacteria 2641
43 Ga0068863_100127366 3300005841 Bacteria 2430
44 Ga0068858_100143025 3300005842 Bacteria 2246
45 Ga0068862_100042371 3300005844 Bacteria 3877
46 Ga0081538_10020306 3300005981 Bacteria 4897
47 Ga0081539_10024000 3300005985 Bacteria 3973
48 Ga0081539_10044023 3300005985 Bacteria 2580
49 Ga0075432_10003838 3300006058 Bacteria 5122
50 Ga0070712_100016212 3300006175 Plasmid 4811
51 Ga0070712_100025680 3300006175 Bacteria 3918
52 Ga0070712_100044139 3300006175 Bacteria 3072
53 Ga0097621_100081272 3300006237 Bacteria 2697
54 Ga0068871_100027066 3300006358 Bacteria 4481
55 Ga0068871_100087399 3300006358 Bacteria 2592
56 Ga0075434_100073665 3300006871 Bacteria 3408
57 Ga0068865_100058764 3300006881 Bacteria 2687
58 Ga0068865_100071340 3300006881 Bacteria 2464
59 Ga0075436_100051034 3300006914 Bacteria 2854
60 Ga0099794_10023126 3300007265 Bacteria 2839
61 Ga0099795_10005531 3300007788 Bacteria 3370
62 Ga0099795_10007874 3300007788 Bacteria 3004
63 Ga0099795_10008070 3300007788 Bacteria 2980
64 Ga0105240_10165357 3300009093 Bacteria 2625
65 Ga0111539_10075904 3300009094 Bacteria 3959
66 Ga0111539_10137931 3300009094 Bacteria 2856
67 Ga0111539_10151088 3300009094 Bacteria 2718
68 Ga0111539_10161892 3300009094 Bacteria 2617
69 Ga0105247_10023987 3300009101 Bacteria 3675
70 Ga0105247_10049875 3300009101 Bacteria 2575
71 Ga0114129_10181457 3300009147 Bacteria 2863
72 Ga0105248_10115317 3300009177 Bacteria 3030
73 Ga0105248_10206190 3300009177 Bacteria 2215
74 Ga0105237_10116313 3300009545 Bacteria 2667
75 Ga0105238_10099776 3300009551 Bacteria 2886
76 Ga0105249_10049986 3300009553 Bacteria 3813
77 Ga0105249_10072624 3300009553 Bacteria 3181
78 Ga0099796_10005031 3300010159 Bacteria 3262
79 Ga0105239_10066678 3300010375 Bacteria 3954
80 Ga0105239_10087838 3300010375 Bacteria 3428
81 Ga0105239_10137068 3300010375 Bacteria 2725
82 Ga0105246_10045190 3300011119 Bacteria 2997
83 Ga0157370_10036227 3300013104 Bacteria 4789
84 Ga0157378_10065042 3300013297 Bacteria 3263
85 Ga0157378_10111726 3300013297 Bacteria 2506
86 Ga0163162_10068528 3300013306 Bacteria 3600
87 Ga0163162_10086987 3300013306 Bacteria 3203
88 Ga0163162_10111721 3300013306 Bacteria 2831
89 Ga0163162_10144009 3300013306 Bacteria 2498
90 Ga0157372_10120245 3300013307 Bacteria 3016
91 Ga0157375_10089765 3300013308 Bacteria 3130
92 Ga0157375_10112014 3300013308 Bacteria 2828
93 Ga0163163_10107189 3300014325 Bacteria 2820
94 Ga0163163_10107280 3300014325 Bacteria 2819
95 Ga0163163_10169393 3300014325 Bacteria 2230
96 Ga0157380_10055887 3300014326 Bacteria 3137
97 Ga0182008_10029223 3300014497 Bacteria 2786
98 Ga0157379_10054893 3300014968 Bacteria 3559
99 Ga0157376_10032829 3300014969 Bacteria 4172
100 Ga0157376_10079175 3300014969 Bacteria 2817
101 Ga0163161_10058079 3300017792 Bacteria 2812
102 Ga0213873_10000137 3300021358 Bacteria 13967
103 Ga0213873_10000705 3300021358 Bacteria 5440
104 Ga0213873_10001543 3300021358 Bacteria 3845
105 Ga0213872_10025927 3300021361 Bacteria 2693
106 Ga0213874_10001958 3300021377 Bacteria 4336
107 Ga0213874_10004303 3300021377 Bacteria 3233
108 Ga0213874_10009331 3300021377 Bacteria 2422
109 Ga0213876_10028840 3300021384 Bacteria 2927
110 Ga0213876_10042664 3300021384 Bacteria 2397
111 Ga0213871_10000451 3300021441 Bacteria 5543
112 Ga0213871_10004266 3300021441 Bacteria 2846
113 Ga0224571_100303 3300022734 Bacteria 2545
114 Ga0209676_1000105 3300025292 Bacteria 224151
115 Ga0209050_1000314 3300025298 Bacteria 98567
116 Ga0209051_1000064 3300025303 Bacteria 231735
117 Ga0209257_1000109 3300025304 Bacteria 239439
118 Ga0207692_10031788 3300025898 Plasmid 2530
119 Ga0207647_10018192 3300025904 Bacteria 4761
120 Ga0207647_10039723 3300025904 Bacteria 2967
121 Ga0207645_10044857 3300025907 Bacteria 2828
122 Ga0207684_10037480 3300025910 Bacteria 4114
123 Ga0207707_10034206 3300025912 Bacteria 4446
124 Ga0207695_10102319 3300025913 Bacteria 2857
125 Ga0207693_10028081 3300025915 Plasmid 4446
126 Ga0207693_10064464 3300025915 Bacteria 2870
127 Ga0207693_10073862 3300025915 Bacteria 2670
128 Ga0207663_10013191 3300025916 Bacteria 4486
129 Ga0207663_10031664 3300025916 Bacteria 3132
130 Ga0207662_10038448 3300025918 Bacteria 2804
131 Ga0207646_10097046 3300025922 Bacteria 2640
132 Ga0207659_10060250 3300025926 Bacteria 2731
133 Ga0207644_10080314 3300025931 Bacteria 2408
134 Ga0207644_10095002 3300025931 Bacteria 2229
135 Ga0207706_10032112 3300025933 Bacteria 4675
136 Ga0207686_10044816 3300025934 Bacteria 2718
137 Ga0207669_10036803 3300025937 Bacteria 2801
138 Ga0207691_10059698 3300025940 Bacteria 3467
139 Ga0207711_10113803 3300025941 Bacteria 2409
140 Ga0207661_10077335 3300025944 Bacteria 2736
141 Ga0207679_10075639 3300025945 Bacteria 2556
142 Ga0207651_10052582 3300025960 Bacteria 2778
143 Ga0207651_10077561 3300025960 Bacteria 2379
144 Ga0207668_10073963 3300025972 Bacteria 2444
145 Ga0207703_10094286 3300026035 Bacteria 2523
146 Ga0207678_10056346 3300026067 Bacteria 3383
147 Ga0207678_10061493 3300026067 Bacteria 3230
148 Ga0207678_10065521 3300026067 Bacteria 3120
149 Ga0207648_10087972 3300026089 Bacteria 2712
150 Ga0207648_10144578 3300026089 Bacteria 2097
151 Ga0207676_10035237 3300026095 Bacteria 3797
152 Ga0207675_100057259 3300026118 Bacteria 3636
153 Ga0207683_10055834 3300026121 Bacteria 3463
154 Ga0207683_10084148 3300026121 Bacteria 2827
155 Ga0209371_1003134 3300027312 Bacteria 8412
156 Ga0209179_1001989 3300027512 Bacteria 2662
157 Ga0268266_10014368 3300028379 Bacteria 6810
158 Ga0268265_10015741 3300028380 Bacteria 5181
159 Ga0307515_10034493 3300028794 Bacteria 8279
160 Ga0268256_1003114 3300030500 Bacteria 7733
161 Ga0265760_10009149 3300031090 Bacteria 2830
162 Ga0265328_10008732 3300031239 Bacteria 4160
163 Ga0265328_10016773 3300031239 Bacteria 2844
164 Ga0265331_10007370 3300031250 Bacteria 6372
165 Ga0265331_10013211 3300031250 Bacteria 4447
166 Ga0265327_10019404 3300031251 Bacteria 4180
167 Ga0265327_10045233 3300031251 Bacteria 2341
168 Ga0265316_10024709 3300031344 Bacteria 5026
169 Ga0265316_10043726 3300031344 Bacteria 3567
170 Ga0307509_10098075 3300031507 Bacteria 2977
171 Ga0307509_10153810 3300031507 Bacteria 2210
172 Ga0265313_10002415 3300031595 Bacteria 16149
173 Ga0265313_10030558 3300031595 Bacteria 2771
174 Ga0307508_10003861 3300031616 Bacteria 14916
175 Ga0307508_10041438 3300031616 Bacteria 4133
176 Ga0307514_10001713 3300031649 Bacteria 25184
177 Ga0316575_10006348 3300031665 Bacteria 4244
178 Ga0316576_10045605 3300031727 Bacteria 3170
179 Ga0307516_10039705 3300031730 Bacteria 4690
180 Ga0315911_1000050 3300033442 Bacteria 36445
181 Ga0373926_0010349 3300035083 Bacteria 3125
182 Ga0373945_0021732 3300035116 Bacteria 2207
183 Ga0373953_0042776 3300035117 Bacteria 1806
184 Ga0373954_0010487 3300035118 Bacteria 4088
185 Ga0373956_0009971 3300035119 Bacteria 3874
186 Ga0373957_0013104 3300035120 Bacteria 2806
187 Ga0373943_0025154 3300035170 Bacteria 2781
188 Ga0373943_0026308 3300035170 Bacteria 2725
189 Ga0373946_0010311 3300035171 Bacteria 3455
190 Ga0373955_0018576 3300035172 Bacteria 3461
191 Ga0373955_0025299 3300035172 Bacteria 3046
192 Ga0373924_0011139 3300035410 Bacteria 3332
193 Ga0373931_0014859 3300035691 Bacteria 3813
194 Ga0373931_0033611 3300035691 Bacteria 2659
195 Ga0373935_0011932 3300035692 Bacteria 5220
196 Ga0373935_0019298 3300035692 Bacteria 4158
197 Ga0373935_0036079 3300035692 Bacteria 3089
198 Ga0373927_0038824 3300035695 Bacteria 3091
199 Ga0373927_0046881 3300035695 Bacteria 2795
200 Ga0373927_0047009 3300035695 Bacteria 2791
201 Ga0373927_0070391 3300035695 Bacteria 2264
202 Ga0373933_0018978 3300035724 Bacteria 3875
203 Ga0373933_0026185 3300035724 Bacteria 3348
204 Ga0373947_0020330 3300035725 Bacteria 3832
205 Ga0373947_0029169 3300035725 Bacteria 3236
206 Ga0373947_0040845 3300035725 Bacteria 2764
207 Ga0373947_0049494 3300035725 Bacteria 2524
208 Ga0373937_0065421 3300036401 Bacteria 3347
209 Ga0373937_0067929 3300036401 Bacteria 3285
210 Ga0316584_0051569 3300036712 Bacteria 3077
211 Ga0373925_0064315 3300037068 Bacteria 2761
212 Ga0373925_0064855 3300037068 Bacteria 2750
213 Ga0395905_0090272 3300037471 Bacteria 2872
214 Ga0436364_0152163 3300037853 Bacteria 4100
215 Ga0400490_07481 3300038726 Bacteria 2921
216 Ga0242420_002199 3300038996 Bacteria 2753
217 Ga0436365_0925906 3300039437 Bacteria 2586
218 Ga0436365_1829850 3300039437 Bacteria 4063
219 Ga0436360_0395409 3300039438 Bacteria 2907
220 Ga0436360_0674778 3300039438 Bacteria 2751
221 Ga0436361_0058667 3300039447 Bacteria 3197
222 Ga0436361_0640048 3300039447 Bacteria 4968
223 Ga0436363_0100675 3300039450 Bacteria 2898
224 Ga0436363_0130642 3300039450 Bacteria 2226
225 Ga0436363_0219547 3300039450 Bacteria 3382
226 Ga0436363_0785919 3300039450 Bacteria 2264
227 Ga0436363_1126167 3300039450 Bacteria 5137
228 Ga0436362_0749273 3300039453 Bacteria 2586
229 Ga0436362_0973508 3300039453 Bacteria 4186
230 Ga0439453_0000254 3300041408 Bacteria 5412
231 Ga0451807_1722994 3300041486 Bacteria 2716
232 Ga0450911_000675 3300042115 Bacteria 10193
233 Ga0450898_003648 3300042134 Bacteria 2225
234 Ga0439435_0000915 3300042436 Bacteria 5100
235 Ga0439444_0005358 3300042437 Bacteria 1900
236 Ga0439464_0009376 3300042439 Bacteria 2576
237 Ga0439460_0006270 3300042461 Bacteria 2945
238 Ga0439460_0006644 3300042461 Bacteria 2875
239 Ga0439460_0010289 3300042461 Bacteria 2390
240 Ga0453683_0050268 3300044673 Bacteria 2612
241 Ga0466963_0035794 3300044694 Bacteria 3234
242 Ga0466959_0052810 3300045049 Bacteria 2975
243 Ga0451576_0089935 3300045051 Bacteria 3193
244 Ga0495592_0014784 3300046454 Bacteria 5925
245 Ga0495592_0039350 3300046454 Bacteria 3552
246 Ga0495603_0039028 3300046455 Bacteria 2846
247 Ga0495591_018870 3300046458 Bacteria 2327
248 Ga0495629_0018631 3300046459 Bacteria 4962
249 Ga0495629_0035326 3300046459 Bacteria 3532
250 Ga0495629_0053034 3300046459 Bacteria 2837
251 Ga0495651_0038007 3300046462 Bacteria 3748
252 Ga0495653_0040202 3300046463 Bacteria 3657
253 Ga0495653_0055106 3300046463 Bacteria 3035
254 Ga0495653_0058130 3300046463 Bacteria 2940
255 Ga0495653_0066191 3300046463 Bacteria 2718
256 Ga0495653_0075257 3300046463 Bacteria 2513
257 Ga0495580_0008296 3300046472 Bacteria 8267
258 Ga0495580_0012642 3300046472 Bacteria 6472
259 Ga0495580_0053053 3300046472 Bacteria 2862
260 Ga0495582_0024838 3300046473 Bacteria 3281
261 Ga0495662_0014050 3300046476 Bacteria 3897
262 Ga0495662_0023744 3300046476 Bacteria 2961
263 Ga0495662_0028289 3300046476 Bacteria 2706
264 Ga0495664_0022872 3300046477 Bacteria 3626
265 Ga0495664_0035885 3300046477 Bacteria 2921
266 Ga0495584_0029290 3300046491 Bacteria 2790
267 Ga0495594_0031689 3300046499 Bacteria 2867
268 Ga0495596_0004456 3300046500 Bacteria 6812
269 Ga0495596_0018573 3300046500 Bacteria 2864
270 Ga0495606_0052495 3300046507 Bacteria 2650
271 Ga0495608_0011704 3300046511 Bacteria 6102
272 Ga0495608_0020455 3300046511 Bacteria 4548
273 Ga0495608_0030559 3300046511 Bacteria 3646
274 Ga0495616_0031249 3300046513 Bacteria 2790
275 Ga0495618_0023479 3300046514 Bacteria 3814
276 Ga0495618_0031440 3300046514 Bacteria 3320
277 Ga0495620_0028155 3300046515 Bacteria 2616
278 Ga0495628_0020751 3300046516 Bacteria 5414
279 Ga0495628_0022980 3300046516 Bacteria 5118
280 Ga0495628_0031094 3300046516 Bacteria 4318
281 Ga0495628_0045888 3300046516 Bacteria 3473
282 Ga0495628_0049930 3300046516 Bacteria 3310
283 Ga0495628_0071577 3300046516 Bacteria 2702
284 Ga0495628_0072121 3300046516 Bacteria 2691
285 Ga0495628_0072352 3300046516 Bacteria 2686
286 Ga0495630_0055437 3300046517 Bacteria 2970
287 Ga0495630_0066046 3300046517 Bacteria 2719
288 Ga0495631_0024731 3300046518 Bacteria 2771
289 Ga0495663_0022147 3300046525 Bacteria 1834
290 Ga0495652_0041301 3300046529 Bacteria 3982
291 Ga0495652_0042237 3300046529 Bacteria 3932
292 Ga0495652_0088310 3300046529 Bacteria 2541
293 Ga0495652_0120201 3300046529 Bacteria 2097
294 Ga0495665_0003262 3300046531 Bacteria 8783
295 Ga0495665_0032282 3300046531 Bacteria 2801
296 Ga0495665_0033451 3300046531 Bacteria 2749
297 Ga0495640_0028908 3300046533 Bacteria 3985
298 Ga0495640_0030578 3300046533 Bacteria 3854
299 Ga0495640_0036733 3300046533 Bacteria 3459
300 Ga0495640_0040576 3300046533 Bacteria 3258
301 Ga0495587_0019542 3300046536 Bacteria 4191
302 Ga0495587_0034995 3300046536 Bacteria 3026
303 Ga0495598_0004604 3300046537 Bacteria 3000
304 Ga0495645_0043772 3300046543 Bacteria 3266
305 Ga0495645_0047613 3300046543 Bacteria 3123
306 Ga0495667_0024049 3300046559 Bacteria 4103
307 Ga0495667_0024580 3300046559 Bacteria 4057
308 Ga0495667_0030427 3300046559 Bacteria 3627
309 Ga0495667_0043108 3300046559 Bacteria 2991
310 Ga0495667_0043385 3300046559 Bacteria 2980
311 Ga0495656_0017147 3300046615 Bacteria 2759
312 Ga0495656_0017350 3300046615 Bacteria 2746
313 Ga0495668_0037656 3300046616 Bacteria 2706
314 Ga0495668_0038432 3300046616 Bacteria 2674
315 Ga0495668_0039846 3300046616 Bacteria 2622
316 Ga0495634_0013919 3300046642 Bacteria 5813
317 Ga0495634_0040552 3300046642 Bacteria 3165
318 Ga0495634_0044285 3300046642 Bacteria 3013
319 Ga0495634_0052354 3300046642 Bacteria 2736
320 Ga0495634_0052868 3300046642 Bacteria 2722
321 Ga0495611_0015845 3300046648 Bacteria 3221
322 Ga0495635_0050664 3300046663 Bacteria 2862
323 Ga0495661_0019314 3300046665 Bacteria 4468
324 Ga0495661_0041109 3300046665 Bacteria 2863
325 Ga0495657_0042035 3300046675 Bacteria 3123
326 Ga0495657_0054170 3300046675 Bacteria 2681
327 Ga0495599_0017333 3300046678 Bacteria 4477
328 Ga0495599_0027741 3300046678 Bacteria 3547
329 Ga0495623_0018890 3300046679 Bacteria 4450
330 Ga0495623_0030400 3300046679 Bacteria 3474
331 Ga0495623_0039058 3300046679 Bacteria 3034
332 Ga0495646_0014089 3300046680 Bacteria 5085
333 Ga0495646_0025859 3300046680 Bacteria 3688
334 Ga0495646_0051792 3300046680 Bacteria 2483
335 Ga0495647_0025433 3300046681 Bacteria 2163
336 Ga0495658_0007072 3300046683 Bacteria 5540
337 Ga0495658_0020527 3300046683 Bacteria 3467
338 Ga0495669_0020058 3300046684 Bacteria 2889
339 Ga0495613_0007940 3300046689 Bacteria 7898
340 Ga0495613_0055225 3300046689 Bacteria 2918
341 Ga0495624_0040331 3300046690 Bacteria 2990
342 Ga0495624_0044181 3300046690 Bacteria 2841
343 Ga0495671_0010320 3300046692 Bacteria 5181
344 Ga0495649_0034852 3300046694 Bacteria 2769
345 Ga0495589_0030380 3300046794 Bacteria 2720
346 Ga0495600_0007167 3300046809 Bacteria 6810
347 Ga0495600_0016239 3300046809 Bacteria 4721
348 Ga0495600_0022839 3300046809 Bacteria 4021
349 Ga0495600_0026976 3300046809 Bacteria 3711
350 Ga0495600_0032654 3300046809 Bacteria 3378
351 Ga0495600_0049275 3300046809 Bacteria 2748
352 Ga0495600_0050046 3300046809 Bacteria 2726
353 Ga0495581_0031088 3300047315 Bacteria 3093
354 Ga0495581_0034565 3300047315 Bacteria 2924
355 Ga0495604_0027474 3300047317 Bacteria 4525
356 Ga0495604_0059949 3300047317 Bacteria 2915
357 Ga0495674_0032282 3300047319 Bacteria 4750
358 Ga0495674_0037946 3300047319 Bacteria 4328
359 Ga0495674_0047862 3300047319 Bacteria 3788
360 Ga0495674_0063661 3300047319 Bacteria 3207
361 Ga0495674_0078642 3300047319 Bacteria 2833
362 Ga0495674_0110947 3300047319 Bacteria 2325
363 Ga0495680_0027598 3300047322 Bacteria 4662
364 Ga0495680_0028515 3300047322 Bacteria 4576
365 Ga0495680_0053788 3300047322 Bacteria 3130
366 Ga0495680_0103319 3300047322 Bacteria 2121
367 Ga0495683_0008753 3300047323 Bacteria 5401
368 Ga0495687_011749 3300047443 Bacteria 4682
369 Ga0495675_0009189 3300047444 Bacteria 6146
370 Ga0495675_0029558 3300047444 Bacteria 3496
371 Ga0495675_0032482 3300047444 Bacteria 3331
372 Ga0495675_0055048 3300047444 Bacteria 2523
373 Ga0495684_0029749 3300047471 Bacteria 4192
374 Ga0495686_0000603 3300047472 Bacteria 49764
375 Ga0495686_0097168 3300047472 Bacteria 1781
376 Ga0495593_0032221 3300047673 Bacteria 2858
377 Ga0495593_0033271 3300047673 Bacteria 2807
378 Ga0495593_0033896 3300047673 Bacteria 2779
379 Ga0495602_0036042 3300048088 Bacteria 4607
380 Ga0495602_0049832 3300048088 Bacteria 3747
381 Ga0495602_0072943 3300048088 Bacteria 2924
382 Ga0495602_0076380 3300048088 Bacteria 2838
383 Ga0495614_0020680 3300048089 Bacteria 2844
384 Ga0495614_0028180 3300048089 Bacteria 2420
385 Ga0496100_0048164 3300048903 Bacteria 2750
386 Ga0496100_0051935 3300048903 Bacteria 2663
387 Ga0496101_0019359 3300048904 Bacteria 4646
388 Ga0496101_0077598 3300048904 Bacteria 2448
389 Ga0496102_0093498 3300048905 Bacteria 2785
390 Ga0496104_0082058 3300048907 Bacteria 3075
391 Ga0496104_0102483 3300048907 Plasmid 2741
392 Ga0496105_0026747 3300048908 Bacteria 4709
393 Ga0496105_0055206 3300048908 Plasmid 3280
394 Ga0496105_0082905 3300048908 Bacteria 2648
395 Ga0496106_0033226 3300048909 Bacteria 3849
396 Ga0496107_0057983 3300048910 Bacteria 2799
397 Ga0496108_0055297 3300048911 Bacteria 3332
398 Ga0496108_0086066 3300048911 Bacteria 2668
399 Ga0496109_0079024 3300048912 Bacteria 3030
400 Ga0496109_0082039 3300048912 Bacteria 2971
401 Ga0496109_0171460 3300048912 Bacteria 2036
402 Ga0496110_0027064 3300048913 Bacteria 4912
403 Ga0496110_0067507 3300048913 Bacteria 3164
404 Ga0496110_0072128 3300048913 Plasmid 3063
405 Ga0496110_0087226 3300048913 Bacteria 2787
406 Ga0496112_0093073 3300048915 Bacteria 2984
407 Ga0496112_0102417 3300048915 Bacteria 2833
408 Ga0496112_0158422 3300048915 Bacteria 2230
409 Ga0496113_0072919 3300048916 Bacteria 2614
410 Ga0496114_0010962 3300048917 Bacteria 7228
411 Ga0496114_0060905 3300048917 Bacteria 3155
412 Ga0496115_0074720 3300048918 Bacteria 2752
413 Ga0496116_0038454 3300048919 Bacteria 3322
414 Ga0496116_0047212 3300048919 Bacteria 2900
415 Ga0496121_0028256 3300048924 Bacteria 5226
416 Ga0496121_0068884 3300048924 Bacteria 2859
417 Ga0496122_0059543 3300048925 Bacteria 2818
418 Ga0496123_0017354 3300048926 Bacteria 5795
419 Ga0496124_0065863 3300048927 Bacteria 3019
420 Ga0496125_0064622 3300048928 Bacteria 2906
421 Ga0496125_0067463 3300048928 Bacteria 2818
422 Ga0496126_0008635 3300048929 Bacteria 10953
423 Ga0495682_0009108 3300049460 Bacteria 3890
424 Ga0501031_0066715 3300049568 Bacteria 2345
425 Ga0501032_0041476 3300049569 Bacteria 3125
426 Ga0501037_0046907 3300049573 Bacteria 3167
427 Ga0501038_0039138 3300049574 Bacteria 4149
428 Ga0501043_0053086 3300049579 Bacteria 3183
429 Ga0501046_0060879 3300049580 Bacteria 2953
430 Ga0501047_0042312 3300049581 Bacteria 4402
431 Ga0501073_0035529 3300049589 Bacteria 3542
432 Ga0501074_0053263 3300049590 Bacteria 2919
433 Ga0501080_0093052 3300049742 Bacteria 2799
434 Ga0501035_0040140 3300049822 Bacteria 4231
435 Ga0501035_0102216 3300049822 Bacteria 2514
436 Ga0501044_0014546 3300049823 Bacteria 8489
437 Ga0501044_0105560 3300049823 Bacteria 2830
438 nmdc:mga0k408_19739_c1 3300050493 Bacteria 3770
439 nmdc:mga05p37_166815_c1 3300050507 Bacteria 2687
440 nmdc:mga05p37_308796_c1 3300050507 Bacteria 1876
441 nmdc:mga08y16_39141_c1 3300050511 Bacteria 4975
442 nmdc:mga08x19_50554_c1 3300050514 Bacteria 2668
443 Ga0495601_0038459 3300053077 Bacteria 2993
444 Ga0495601_0040349 3300053077 Bacteria 2923
445 Ga0495612_0007597 3300053078 Bacteria 4430
446 Ga0495612_0017739 3300053078 Bacteria 2850
447 Ga0495612_0018275 3300053078 Bacteria 2808
448 Ga0495612_0019198 3300053078 Bacteria 2738
449 Ga0495612_0019722 3300053078 Bacteria 2701
450 Ga0500635_0017039 3300053080 Bacteria 2170
451 Ga0495655_0002696 3300053083 Bacteria 2850
452 Ga0495595_0008182 3300053084 Bacteria 4291
453 Ga0495595_0012140 3300053084 Bacteria 3615
454 Ga0495619_0021010 3300053085 Bacteria 4164
455 Ga0495619_0046447 3300053085 Bacteria 2855
456 Ga0500647_0018039 3300053091 Bacteria 3265
457 Ga0500583_0012713 3300053092 Bacteria 3223
458 Ga0500583_0025278 3300053092 Bacteria 2534
459 Ga0500608_003277 3300053122 Bacteria 6034
460 Ga0500559_0007683 3300053136 Bacteria 4760
461 Ga0500616_0038394 3300053153 Bacteria 2586
462 Ga0500638_023683 3300053162 Bacteria 2920
463 Ga0500639_032135 3300053163 Bacteria 2776
464 Ga0500637_0007572 3300053178 Bacteria 5437
465 Ga0530510_0063618 3300061734 Bacteria 2671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0008635 Ga0496126_0008635_8891_10591 480
2 3300047472 Ga0495686_0097168 Ga0495686_0097168_13_1683 520
3 3300048928 Ga0496125_0064622 Ga0496125_0064622_1126_2880 520
4 3300049823 Ga0501044_0014546 Ga0501044_0014546_6769_8433 524
5 3300049822 Ga0501035_0102216 Ga0501035_0102216_206_1885 528
6 3300025933 Ga0207706_10032112 Ga0207706_100321124 529
7 3300005455 Ga0070663_100065518 Ga0070663_1000655182 544
8 3300026067 Ga0207678_10061493 Ga0207678_100614934 544
9 iso_pu_bacteria 2508501128 2509150604 545
10 3300038996 Ga0242420_002199 Ga0242420_002199_105_1838 547
11 3300050507 nmdc:mga05p37_308796_c1 nmdc:mga05p37_308796_c1_127_1860 547
12 3300046525 Ga0495663_0022147 Ga0495663_0022147_29_1801 550
13 3300035117 Ga0373953_0042776 Ga0373953_0042776_20_1777 554
14 3300042437 Ga0439444_0005358 Ga0439444_0005358_13_1821 555
15 3300039438 Ga0436360_0395409 Ga0436360_0395409_106_1917 559
16 3300048924 Ga0496121_0028256 Ga0496121_0028256_2332_4119 564
17 3300026089 Ga0207648_10144578 Ga0207648_101445782 577
18 3300031250 Ga0265331_10007370 Ga0265331_100073702 587
19 3300031595 Ga0265313_10002415 Ga0265313_1000241510 587
20 3300048912 Ga0496109_0171460 Ga0496109_0171460_103_1971 593
21 3300003203 JGI25406J46586_10002009 JGI25406J46586_100020093 599
22 3300005985 Ga0081539_10044023 Ga0081539_100440233 599
23 3300046665 Ga0495661_0041109 Ga0495661_0041109_413_2317 602
24 3300009094 Ga0111539_10075904 Ga0111539_100759042 604
25 3300050511 nmdc:mga08y16_39141_c1 nmdc:mga08y16_39141_c1_1315_3402 605
26 3300005458 Ga0070681_10101315 Ga0070681_101013154 606
27 3300009101 Ga0105247_10049875 Ga0105247_100498752 606
28 3300025912 Ga0207707_10034206 Ga0207707_100342063 606
29 3300046559 Ga0495667_0043385 Ga0495667_0043385_973_2901 610
30 3300046809 Ga0495600_0007167 Ga0495600_0007167_2414_4399 614
31 3300046472 Ga0495580_0008296 Ga0495580_0008296_5665_7656 616
32 3300007265 Ga0099794_10023126 Ga0099794_100231262 621
33 3300007788 Ga0099795_10007874 Ga0099795_100078742 621
34 3300010159 Ga0099796_10005031 Ga0099796_100050312 621
35 iso_pu_bacteria 2916000859 2916002766 621
36 iso_pu_bacteria 2924179722 2924181411 621
37 iso_pu_bacteria 2970095765 2970097580 621
38 3300006358 Ga0068871_100027066 Ga0068871_1000270664 622
39 3300021441 Ga0213871_10000451 Ga0213871_100004514 623
40 3300025904 Ga0207647_10039723 Ga0207647_100397232 624
41 3300025907 Ga0207645_10044857 Ga0207645_100448572 625
42 3300025931 Ga0207644_10095002 Ga0207644_100950022 625
43 3300026089 Ga0207648_10087972 Ga0207648_100879723 625
44 3300042115 Ga0450911_000675 Ga0450911_000675_8091_10163 625
45 3300031595 Ga0265313_10030558 Ga0265313_100305582 626
46 3300046690 Ga0495624_0040331 Ga0495624_0040331_602_2623 627
47 3300047317 Ga0495604_0059949 Ga0495604_0059949_712_2733 627
48 3300047444 Ga0495675_0055048 Ga0495675_0055048_362_2383 627
49 iso_pu_bacteria 2957430029 2957430387 627
50 3300010375 Ga0105239_10066678 Ga0105239_100666784 628
51 3300005844 Ga0068862_100042371 Ga0068862_1000423712 629
52 3300009553 Ga0105249_10049986 Ga0105249_100499863 629
53 3300028380 Ga0268265_10015741 Ga0268265_100157413 629
54 3300021361 Ga0213872_10025927 Ga0213872_100259272 630
55 3300021441 Ga0213871_10004266 Ga0213871_100042664 630
56 3300039438 Ga0436360_0674778 Ga0436360_0674778_490_2559 630
57 3300039447 Ga0436361_0640048 Ga0436361_0640048_490_2559 630
58 3300048925 Ga0496122_0059543 Ga0496122_0059543_693_2678 630
59 3300048926 Ga0496123_0017354 Ga0496123_0017354_693_2678 630
60 3300048928 Ga0496125_0067463 Ga0496125_0067463_693_2678 630
61 3300031239 Ga0265328_10008732 Ga0265328_100087324 631
62 3300031250 Ga0265331_10013211 Ga0265331_100132113 631
63 3300031251 Ga0265327_10019404 Ga0265327_100194044 631
64 3300031344 Ga0265316_10043726 Ga0265316_100437263 631
65 3300031507 Ga0307509_10153810 Ga0307509_101538101 631
66 3300046491 Ga0495584_0029290 Ga0495584_0029290_154_2142 631
67 3300046513 Ga0495616_0031249 Ga0495616_0031249_176_2164 631
68 3300046537 Ga0495598_0004604 Ga0495598_0004604_116_2104 631
69 3300046615 Ga0495656_0017147 Ga0495656_0017147_105_2093 631
70 3300046616 Ga0495668_0039846 Ga0495668_0039846_65_2053 631
71 3300046684 Ga0495669_0020058 Ga0495669_0020058_257_2245 631
72 3300005985 Ga0081539_10024000 Ga0081539_100240005 632
73 3300042461 Ga0439460_0010289 Ga0439460_0010289_180_2252 632
74 3300031649 Ga0307514_10001713 Ga0307514_1000171322 633
75 3300039450 Ga0436363_0785919 Ga0436363_0785919_266_2254 633
76 3300047322 Ga0495680_0103319 Ga0495680_0103319_69_2090 633
77 3300046616 Ga0495668_0037656 Ga0495668_0037656_99_2171 634
78 3300042439 Ga0439464_0009376 Ga0439464_0009376_433_2505 636
79 3300042461 Ga0439460_0006644 Ga0439460_0006644_704_2776 636
80 3300046516 Ga0495628_0022980 Ga0495628_0022980_2557_4629 637
81 3300046531 Ga0495665_0032282 Ga0495665_0032282_130_2208 639
82 iso_pu_bacteria 2854916844 2854921913 639
83 3300005981 Ga0081538_10020306 Ga0081538_100203064 640
84 3300046455 Ga0495603_0039028 Ga0495603_0039028_138_2219 640
85 3300046458 Ga0495591_018870 Ga0495591_018870_210_2291 640
86 3300046459 Ga0495629_0053034 Ga0495629_0053034_138_2219 640
87 3300046472 Ga0495580_0053053 Ga0495580_0053053_165_2246 640
88 3300046500 Ga0495596_0018573 Ga0495596_0018573_157_2238 640
89 3300046665 Ga0495661_0019314 Ga0495661_0019314_2257_4338 640
90 3300046689 Ga0495613_0007940 Ga0495613_0007940_165_2246 640
91 3300046692 Ga0495671_0010320 Ga0495671_0010320_2450_4531 640
92 3300046794 Ga0495589_0030380 Ga0495589_0030380_530_2611 640
93 3300047315 Ga0495581_0034565 Ga0495581_0034565_651_2732 640
94 3300048089 Ga0495614_0028180 Ga0495614_0028180_147_2228 640
95 3300048903 Ga0496100_0048164 Ga0496100_0048164_477_2558 640
96 3300048908 Ga0496105_0082905 Ga0496105_0082905_524_2605 640
97 3300022734 Ga0224571_100303 Ga0224571_1003032 643
98 3300031090 Ga0265760_10009149 Ga0265760_100091492 643
99 3300041408 Ga0439453_0000254 Ga0439453_0000254_3293_5365 643
100 3300042436 Ga0439435_0000915 Ga0439435_0000915_2393_4465 643
101 3300046529 Ga0495652_0120201 Ga0495652_0120201_19_2085 643
102 3300053136 Ga0500559_0007683 Ga0500559_0007683_563_2635 643
103 3300005329 Ga0070683_100064055 Ga0070683_1000640552 644
104 3300039450 Ga0436363_0100675 Ga0436363_0100675_624_2699 644
105 3300005614 Ga0068856_100100498 Ga0068856_1001004982 645
106 3300028379 Ga0268266_10014368 Ga0268266_100143684 645
107 3300035118 Ga0373954_0010487 Ga0373954_0010487_1054_3126 645
108 3300035119 Ga0373956_0009971 Ga0373956_0009971_917_2989 645
109 3300035120 Ga0373957_0013104 Ga0373957_0013104_191_2263 645
110 3300035172 Ga0373955_0025299 Ga0373955_0025299_192_2264 645
111 3300035410 Ga0373924_0011139 Ga0373924_0011139_870_2942 645
112 3300035724 Ga0373933_0018978 Ga0373933_0018978_809_2881 645
113 3300036401 Ga0373937_0067929 Ga0373937_0067929_137_2209 645
114 3300046454 Ga0495592_0014784 Ga0495592_0014784_2471_4543 645
115 3300046463 Ga0495653_0040202 Ga0495653_0040202_951_3023 645
116 3300046477 Ga0495664_0035885 Ga0495664_0035885_236_2308 645
117 3300046511 Ga0495608_0011704 Ga0495608_0011704_1096_3168 645
118 3300046516 Ga0495628_0020751 Ga0495628_0020751_2338_4410 645
119 3300046533 Ga0495640_0036733 Ga0495640_0036733_1060_3132 645
120 3300046543 Ga0495645_0047613 Ga0495645_0047613_915_2987 645
121 3300046559 Ga0495667_0024580 Ga0495667_0024580_956_3028 645
122 3300046642 Ga0495634_0044285 Ga0495634_0044285_686_2758 645
123 3300046678 Ga0495599_0017333 Ga0495599_0017333_1020_3092 645
124 3300046679 Ga0495623_0039058 Ga0495623_0039058_367_2439 645
125 3300046680 Ga0495646_0014089 Ga0495646_0014089_958_3030 645
126 3300046809 Ga0495600_0049275 Ga0495600_0049275_206_2278 645
127 3300047317 Ga0495604_0027474 Ga0495604_0027474_1221_3293 645
128 3300047319 Ga0495674_0047862 Ga0495674_0047862_1146_3218 645
129 3300047322 Ga0495680_0027598 Ga0495680_0027598_1708_3780 645
130 3300047444 Ga0495675_0032482 Ga0495675_0032482_951_3023 645
131 3300048088 Ga0495602_0049832 Ga0495602_0049832_774_2846 645
132 3300053077 Ga0495601_0040349 Ga0495601_0040349_64_2136 645
133 3300053078 Ga0495612_0007597 Ga0495612_0007597_519_2591 645
134 3300053084 Ga0495595_0008182 Ga0495595_0008182_1167_3239 645
135 3300053085 Ga0495619_0021010 Ga0495619_0021010_2029_4101 645
136 3300005439 Ga0070711_100043773 Ga0070711_1000437732 646
137 3300006175 Ga0070712_100016212 Ga0070712_1000162122 646
138 3300025898 Ga0207692_10031788 Ga0207692_100317881 646
139 3300025913 Ga0207695_10102319 Ga0207695_101023192 646
140 3300025915 Ga0207693_10028081 Ga0207693_100280814 646
141 3300025916 Ga0207663_10013191 Ga0207663_100131913 646
142 3300046463 Ga0495653_0066191 Ga0495653_0066191_20_2098 646
143 3300046516 Ga0495628_0072121 Ga0495628_0072121_509_2587 646
144 3300046529 Ga0495652_0041301 Ga0495652_0041301_998_3076 646
145 3300046531 Ga0495665_0003262 Ga0495665_0003262_346_2424 646
146 3300046543 Ga0495645_0043772 Ga0495645_0043772_532_2610 646
147 3300046663 Ga0495635_0050664 Ga0495635_0050664_615_2693 646
148 3300046679 Ga0495623_0030400 Ga0495623_0030400_979_3057 646
149 3300046680 Ga0495646_0025859 Ga0495646_0025859_1521_3599 646
150 3300047319 Ga0495674_0063661 Ga0495674_0063661_596_2674 646
151 3300047673 Ga0495593_0032221 Ga0495593_0032221_644_2722 646
152 3300048088 Ga0495602_0036042 Ga0495602_0036042_10_2088 646
153 3300048907 Ga0496104_0102483 Ga0496104_0102483_422_2512 646
154 3300048908 Ga0496105_0055206 Ga0496105_0055206_476_2566 646
155 3300048913 Ga0496110_0072128 Ga0496110_0072128_819_2909 646
156 3300028794 Ga0307515_10034493 Ga0307515_100344935 647
157 3300046507 Ga0495606_0052495 Ga0495606_0052495_36_2117 647
158 3300046694 Ga0495649_0034852 Ga0495649_0034852_593_2674 647
159 3300047443 Ga0495687_011749 Ga0495687_011749_1592_3658 647
160 3300048913 Ga0496110_0087226 Ga0496110_0087226_454_2535 647
161 3300005535 Ga0070684_100111395 Ga0070684_1001113952 648
162 3300037471 Ga0395905_0090272 Ga0395905_0090272_146_2227 648
163 3300046454 Ga0495592_0039350 Ga0495592_0039350_563_2644 648
164 3300046459 Ga0495629_0035326 Ga0495629_0035326_539_2620 648
165 3300046462 Ga0495651_0038007 Ga0495651_0038007_902_2983 648
166 3300046463 Ga0495653_0055106 Ga0495653_0055106_137_2218 648
167 3300046476 Ga0495662_0023744 Ga0495662_0023744_302_2383 648
168 3300046516 Ga0495628_0071577 Ga0495628_0071577_582_2663 648
169 3300046517 Ga0495630_0066046 Ga0495630_0066046_155_2227 648
170 3300046529 Ga0495652_0042237 Ga0495652_0042237_1012_3093 648
171 3300046531 Ga0495665_0033451 Ga0495665_0033451_50_2131 648
172 3300046533 Ga0495640_0030578 Ga0495640_0030578_722_2803 648
173 3300046536 Ga0495587_0034995 Ga0495587_0034995_659_2740 648
174 3300046559 Ga0495667_0043108 Ga0495667_0043108_382_2463 648
175 3300046642 Ga0495634_0052354 Ga0495634_0052354_626_2707 648
176 3300046678 Ga0495599_0027741 Ga0495599_0027741_543_2624 648
177 3300046679 Ga0495623_0018890 Ga0495623_0018890_731_2812 648
178 3300046680 Ga0495646_0051792 Ga0495646_0051792_370_2451 648
179 3300046809 Ga0495600_0022839 Ga0495600_0022839_1891_3972 648
180 3300047315 Ga0495581_0031088 Ga0495581_0031088_137_2218 648
181 3300047319 Ga0495674_0078642 Ga0495674_0078642_625_2706 648
182 3300047444 Ga0495675_0009189 Ga0495675_0009189_1445_3526 648
183 3300047673 Ga0495593_0033896 Ga0495593_0033896_79_2160 648
184 3300048088 Ga0495602_0076380 Ga0495602_0076380_100_2181 648
185 3300053078 Ga0495612_0018275 Ga0495612_0018275_555_2636 648
186 3300005467 Ga0070706_100120696 Ga0070706_1001206962 649
187 3300013297 Ga0157378_10111726 Ga0157378_101117262 649
188 3300014325 Ga0163163_10107189 Ga0163163_101071892 649
189 3300046642 Ga0495634_0052868 Ga0495634_0052868_563_2632 649
190 3300053077 Ga0495601_0038459 Ga0495601_0038459_821_2890 649
191 3300006175 Ga0070712_100044139 Ga0070712_1000441392 650
192 3300009094 Ga0111539_10151088 Ga0111539_101510881 650
193 3300025915 Ga0207693_10064464 Ga0207693_100644641 650
194 3300025916 Ga0207663_10031664 Ga0207663_100316644 650
195 3300025918 Ga0207662_10038448 Ga0207662_100384482 650
196 3300026067 Ga0207678_10065521 Ga0207678_100655213 650
197 3300039450 Ga0436363_0130642 Ga0436363_0130642_25_2103 650
198 3300048907 Ga0496104_0082058 Ga0496104_0082058_364_2457 650
199 3300005355 Ga0070671_100093021 Ga0070671_1000930212 651
200 3300009093 Ga0105240_10165357 Ga0105240_101653573 651
201 3300009101 Ga0105247_10023987 Ga0105247_100239872 651
202 3300009177 Ga0105248_10115317 Ga0105248_101153172 651
203 3300009545 Ga0105237_10116313 Ga0105237_101163131 651
204 3300010375 Ga0105239_10137068 Ga0105239_101370681 651
205 3300013306 Ga0163162_10068528 Ga0163162_100685282 651
206 3300025904 Ga0207647_10018192 Ga0207647_100181925 651
207 3300025934 Ga0207686_10044816 Ga0207686_100448163 651
208 3300025941 Ga0207711_10113803 Ga0207711_101138031 651
209 3300035691 Ga0373931_0033611 Ga0373931_0033611_46_2118 651
210 3300035695 Ga0373927_0070391 Ga0373927_0070391_160_2232 651
211 3300035725 Ga0373947_0049494 Ga0373947_0049494_271_2343 651
212 3300037068 Ga0373925_0064855 Ga0373925_0064855_127_2199 651
213 3300047319 Ga0495674_0032282 Ga0495674_0032282_2047_4125 651
214 3300047323 Ga0495683_0008753 Ga0495683_0008753_943_3021 651
215 3300048903 Ga0496100_0051935 Ga0496100_0051935_581_2653 651
216 3300048904 Ga0496101_0019359 Ga0496101_0019359_1816_3888 651
217 3300048905 Ga0496102_0093498 Ga0496102_0093498_135_2207 651
218 3300048908 Ga0496105_0026747 Ga0496105_0026747_2374_4446 651
219 3300048910 Ga0496107_0057983 Ga0496107_0057983_147_2219 651
220 3300048913 Ga0496110_0027064 Ga0496110_0027064_2340_4412 651
221 3300048918 Ga0496115_0074720 Ga0496115_0074720_604_2676 651
222 3300049460 Ga0495682_0009108 Ga0495682_0009108_1774_3852 651
223 3300031239 Ga0265328_10016773 Ga0265328_100167734 652
224 3300035170 Ga0373943_0026308 Ga0373943_0026308_546_2627 652
225 3300037068 Ga0373925_0064315 Ga0373925_0064315_108_2189 652
226 3300039447 Ga0436361_0058667 Ga0436361_0058667_178_2259 652
227 3300046615 Ga0495656_0017350 Ga0495656_0017350_44_2122 652
228 3300053078 Ga0495612_0019198 Ga0495612_0019198_140_2221 652
229 iso_pu_bacteria 2513237082 2513559194 652
230 iso_pu_bacteria 2751185846 2753571606 652
231 iso_pu_bacteria 2751185846 2753571869 652
232 iso_pu_bacteria 8018845410 8018852312 652
233 3300009177 Ga0105248_10206190 Ga0105248_102061902 653
234 3300035724 Ga0373933_0026185 Ga0373933_0026185_554_2614 653
235 3300036401 Ga0373937_0065421 Ga0373937_0065421_169_2229 653
236 3300048915 Ga0496112_0093073 Ga0496112_0093073_494_2563 653
237 3300001989 JGI24739J22299_10012478 JGI24739J22299_100124782 654
238 3300003322 rootL2_10026359 rootL2_1002635911 654
239 3300003323 rootH1_10085896 rootH1_100858966 654
240 3300007788 Ga0099795_10005531 Ga0099795_100055312 654
241 3300009551 Ga0105238_10099776 Ga0105238_100997761 654
242 3300013104 Ga0157370_10036227 Ga0157370_100362275 654
243 3300013307 Ga0157372_10120245 Ga0157372_101202451 654
244 3300035116 Ga0373945_0021732 Ga0373945_0021732_55_2112 654
245 3300035170 Ga0373943_0025154 Ga0373943_0025154_591_2648 654
246 3300035695 Ga0373927_0046881 Ga0373927_0046881_598_2655 654
247 3300035725 Ga0373947_0040845 Ga0373947_0040845_575_2632 654
248 iso_pu_bacteria 2516143018 2516210616 654
249 iso_pu_bacteria 2842462802 2842466651 654
250 iso_pu_bacteria 2920822456 2920828847 654
251 iso_pu_bacteria 2935648319 2935656548 654
252 iso_pu_bacteria 2935656913 2935665377 654
253 iso_pu_bacteria 2936011229 2936019436 654
254 iso_pu_bacteria 2936019824 2936028052 654
255 iso_pu_bacteria 2936028420 2936036862 654
256 iso_pu_bacteria 2936046547 2936054909 654
257 iso_pu_bacteria 8006973647 8006984208 654
258 iso_pu_bacteria 2510065059 2510320025 655
259 iso_pu_bacteria 2511231052 2511503346 655
260 iso_pu_bacteria 2513237086 2513588836 655
261 iso_pu_bacteria 2513237162 2514024258 655
262 iso_pu_bacteria 2551306084 2551675015 655
263 iso_pu_bacteria 2551306084 2551679454 655
264 iso_pu_bacteria 2551306084 2551679457 655
265 iso_pu_bacteria 2551306084 2551679476 655
266 iso_pu_bacteria 2551306084 2551679481 655
267 iso_pu_bacteria 2551306084 2551682565 655
268 iso_pu_bacteria 2551306085 2551685378 655
269 iso_pu_bacteria 2551306085 2551685889 655
270 iso_pu_bacteria 2551306085 2551687975 655
271 iso_pu_bacteria 2551306085 2551688145 655
272 iso_pu_bacteria 2551306085 2551689921 655
273 iso_pu_bacteria 2551306085 2551689967 655
274 iso_pu_bacteria 2551306087 2551700734 655
275 iso_pu_bacteria 2551306087 2551703325 655
276 iso_pu_bacteria 2551306090 2551719368 655
277 iso_pu_bacteria 2551306090 2551720191 655
278 iso_pu_bacteria 2551306093 2551744984 655
279 iso_pu_bacteria 2721755686 2723572357 655
280 iso_pu_bacteria 2775506901 2776264623 655
281 iso_pu_bacteria 2775506901 2776265543 655
282 iso_pu_bacteria 2775506901 2776265593 655
283 iso_pu_bacteria 2855825444 2855829152 655
284 iso_pu_bacteria 2916068649 2916074321 655
285 iso_pu_bacteria 2921208531 2921212877 655
286 iso_pu_bacteria 2921289301 2921292920 655
287 iso_pu_bacteria 2924144063 2924144466 655
288 iso_pu_bacteria 2924158325 2924159518 655
289 iso_pu_bacteria 2924165586 2924168937 655
290 iso_pu_bacteria 2924186466 2924188585 655
291 iso_pu_bacteria 2924200457 2924205541 655
292 iso_pu_bacteria 2924214083 2924219604 655
293 iso_pu_bacteria 2924221636 2924223964 655
294 iso_pu_bacteria 2937016420 2937020714 655
295 iso_pu_bacteria 2937078374 2937084077 655
296 iso_pu_bacteria 2937098957 2937102025 655
297 iso_pu_bacteria 2957388812 2957395357 655
298 iso_pu_bacteria 2957408893 2957415303 655
299 iso_pu_bacteria 2957422303 2957428390 655
300 iso_pu_bacteria 2957457609 2957460050 655
301 iso_pu_bacteria 2957505466 2957508568 655
302 iso_pu_bacteria 2960637947 2960641680 655
303 iso_pu_bacteria 2960637947 2960642727 655
304 iso_pu_bacteria 2960645483 2960648492 655
305 iso_pu_bacteria 2964649959 2964650857 655
306 iso_pu_bacteria 2964656573 2964657579 655
307 iso_pu_bacteria 2964698721 2964704194 655
308 iso_pu_bacteria 2964719344 2964723319 655
309 iso_pu_bacteria 2964719344 2964724060 655
310 iso_pu_bacteria 2967678726 2967681540 655
311 iso_pu_bacteria 2967706974 2967709346 655
312 iso_pu_bacteria 2967742019 2967746551 655
313 iso_pu_bacteria 2967769361 2967770024 655
314 iso_pu_bacteria 2970019648 2970021806 655
315 iso_pu_bacteria 2970047711 2970050205 655
316 iso_pu_bacteria 2970054988 2970055521 655
317 iso_pu_bacteria 2970054988 2970060619 655
318 iso_pu_bacteria 2970136068 2970138578 655
319 iso_pu_bacteria 2970191845 2970193841 655
320 iso_pu_bacteria 2977551784 2977552988 655
321 iso_pu_bacteria 2977558990 2977560379 655
322 iso_pu_bacteria 2977565890 2977567323 655
323 iso_pu_bacteria 8019648815 8019649749 655
324 iso_pu_bacteria 8019648815 8019654113 655
325 iso_pu_bacteria 8019648815 8019654970 655
326 3300001989 JGI24739J22299_10004124 JGI24739J22299_100041242 656
327 3300014969 Ga0157376_10032829 Ga0157376_100328295 656
328 3300031727 Ga0316576_10045605 Ga0316576_100456051 656
329 3300036712 Ga0316584_0051569 Ga0316584_0051569_633_2711 656
330 3300046516 Ga0495628_0031094 Ga0495628_0031094_458_2536 656
331 3300046516 Ga0495628_0049930 Ga0495628_0049930_710_2788 656
332 3300046529 Ga0495652_0088310 Ga0495652_0088310_18_2096 656
333 3300046809 Ga0495600_0016239 Ga0495600_0016239_837_2915 656
334 3300046809 Ga0495600_0026976 Ga0495600_0026976_18_2096 656
335 3300047472 Ga0495686_0000603 Ga0495686_0000603_662_2740 656
336 3300048919 Ga0496116_0047212 Ga0496116_0047212_326_2404 656
337 iso_pu_bacteria 8016613128 8016617195 656
338 3300021358 Ga0213873_10000705 Ga0213873_100007053 657
339 3300031616 Ga0307508_10003861 Ga0307508_1000386110 657
340 3300039453 Ga0436362_0973508 Ga0436362_0973508_1249_3318 657
341 3300046472 Ga0495580_0012642 Ga0495580_0012642_3008_5086 657
342 3300046515 Ga0495620_0028155 Ga0495620_0028155_31_2100 657
343 3300046648 Ga0495611_0015845 Ga0495611_0015845_730_2799 657
344 3300048919 Ga0496116_0038454 Ga0496116_0038454_44_2125 657
345 3300053092 Ga0500583_0012713 Ga0500583_0012713_581_2650 657
346 3300053122 Ga0500608_003277 Ga0500608_003277_574_2643 657
347 3300053162 Ga0500638_023683 Ga0500638_023683_319_2388 657
348 3300003856 Ga0058692_1004397 Ga0058692_10043972 658
349 3300003856 Ga0058692_1004478 Ga0058692_10044782 658
350 3300027312 Ga0209371_1003134 Ga0209371_10031344 658
351 3300030500 Ga0268256_1003114 Ga0268256_10031148 658
352 3300031665 Ga0316575_10006348 Ga0316575_100063484 658
353 3300038726 Ga0400490_07481 Ga0400490_07481_84_2153 658
354 3300046463 Ga0495653_0075257 Ga0495653_0075257_244_2316 658
355 3300046500 Ga0495596_0004456 Ga0495596_0004456_4174_6240 658
356 3300046514 Ga0495618_0023479 Ga0495618_0023479_1227_3299 658
357 3300046616 Ga0495668_0038432 Ga0495668_0038432_568_2637 658
358 3300046690 Ga0495624_0044181 Ga0495624_0044181_180_2252 658
359 3300048927 Ga0496124_0065863 Ga0496124_0065863_638_2704 658
360 3300053092 Ga0500583_0025278 Ga0500583_0025278_65_2134 658
361 3300005456 Ga0070678_100049194 Ga0070678_1000491942 659
362 3300005548 Ga0070665_100048566 Ga0070665_1000485662 659
363 3300005563 Ga0068855_100192848 Ga0068855_1001928481 659
364 3300006058 Ga0075432_10003838 Ga0075432_100038385 659
365 3300006358 Ga0068871_100087399 Ga0068871_1000873992 659
366 3300006914 Ga0075436_100051034 Ga0075436_1000510343 659
367 3300007788 Ga0099795_10008070 Ga0099795_100080702 659
368 3300009147 Ga0114129_10181457 Ga0114129_101814572 659
369 3300010375 Ga0105239_10087838 Ga0105239_100878381 659
370 3300013297 Ga0157378_10065042 Ga0157378_100650423 659
371 3300013306 Ga0163162_10086987 Ga0163162_100869872 659
372 3300014497 Ga0182008_10029223 Ga0182008_100292232 659
373 3300021358 Ga0213873_10001543 Ga0213873_100015435 659
374 3300021377 Ga0213874_10001958 Ga0213874_100019584 659
375 3300021377 Ga0213874_10004303 Ga0213874_100043032 659
376 3300021384 Ga0213876_10028840 Ga0213876_100288401 659
377 3300025910 Ga0207684_10037480 Ga0207684_100374805 659
378 3300025915 Ga0207693_10073862 Ga0207693_100738622 659
379 3300025922 Ga0207646_10097046 Ga0207646_100970461 659
380 3300026118 Ga0207675_100057259 Ga0207675_1000572595 659
381 3300026121 Ga0207683_10055834 Ga0207683_100558342 659
382 3300027512 Ga0209179_1001989 Ga0209179_10019891 659
383 3300031344 Ga0265316_10024709 Ga0265316_100247097 659
384 3300031616 Ga0307508_10041438 Ga0307508_100414383 659
385 3300031730 Ga0307516_10039705 Ga0307516_100397054 659
386 3300035172 Ga0373955_0018576 Ga0373955_0018576_187_2259 659
387 3300035692 Ga0373935_0011932 Ga0373935_0011932_2414_4486 659
388 3300035692 Ga0373935_0036079 Ga0373935_0036079_376_2448 659
389 3300035695 Ga0373927_0038824 Ga0373927_0038824_515_2587 659
390 3300035725 Ga0373947_0029169 Ga0373947_0029169_357_2429 659
391 3300037853 Ga0436364_0152163 Ga0436364_0152163_1188_3266 659
392 3300039437 Ga0436365_0925906 Ga0436365_0925906_31_2103 659
393 3300039450 Ga0436363_0219547 Ga0436363_0219547_947_3115 659
394 3300039450 Ga0436363_1126167 Ga0436363_1126167_1718_3790 659
395 3300039453 Ga0436362_0749273 Ga0436362_0749273_31_2103 659
396 3300041486 Ga0451807_1722994 Ga0451807_1722994_143_2212 659
397 3300042461 Ga0439460_0006270 Ga0439460_0006270_354_2426 659
398 3300045051 Ga0451576_0089935 Ga0451576_0089935_505_2574 659
399 3300046459 Ga0495629_0018631 Ga0495629_0018631_2445_4517 659
400 3300046463 Ga0495653_0058130 Ga0495653_0058130_795_2867 659
401 3300046473 Ga0495582_0024838 Ga0495582_0024838_340_2412 659
402 3300046476 Ga0495662_0014050 Ga0495662_0014050_645_2717 659
403 3300046476 Ga0495662_0028289 Ga0495662_0028289_517_2589 659
404 3300046477 Ga0495664_0022872 Ga0495664_0022872_793_2865 659
405 3300046499 Ga0495594_0031689 Ga0495594_0031689_63_2135 659
406 3300046511 Ga0495608_0020455 Ga0495608_0020455_727_2799 659
407 3300046511 Ga0495608_0030559 Ga0495608_0030559_534_2606 659
408 3300046514 Ga0495618_0031440 Ga0495618_0031440_1008_3080 659
409 3300046516 Ga0495628_0045888 Ga0495628_0045888_584_2656 659
410 3300046516 Ga0495628_0072352 Ga0495628_0072352_531_2603 659
411 3300046517 Ga0495630_0055437 Ga0495630_0055437_590_2662 659
412 3300046518 Ga0495631_0024731 Ga0495631_0024731_560_2632 659
413 3300046533 Ga0495640_0028908 Ga0495640_0028908_783_2855 659
414 3300046533 Ga0495640_0040576 Ga0495640_0040576_100_2172 659
415 3300046536 Ga0495587_0019542 Ga0495587_0019542_95_2167 659
416 3300046559 Ga0495667_0024049 Ga0495667_0024049_1217_3289 659
417 3300046559 Ga0495667_0030427 Ga0495667_0030427_883_2955 659
418 3300046642 Ga0495634_0013919 Ga0495634_0013919_1018_3090 659
419 3300046642 Ga0495634_0040552 Ga0495634_0040552_821_2893 659
420 3300046675 Ga0495657_0042035 Ga0495657_0042035_730_2802 659
421 3300046675 Ga0495657_0054170 Ga0495657_0054170_105_2177 659
422 3300046681 Ga0495647_0025433 Ga0495647_0025433_35_2107 659
423 3300046683 Ga0495658_0007072 Ga0495658_0007072_1237_3327 659
424 3300046683 Ga0495658_0020527 Ga0495658_0020527_340_2412 659
425 3300046689 Ga0495613_0055225 Ga0495613_0055225_54_2126 659
426 3300046809 Ga0495600_0032654 Ga0495600_0032654_1116_3188 659
427 3300046809 Ga0495600_0050046 Ga0495600_0050046_63_2135 659
428 3300047319 Ga0495674_0037946 Ga0495674_0037946_1549_3621 659
429 3300047319 Ga0495674_0110947 Ga0495674_0110947_163_2235 659
430 3300047322 Ga0495680_0028515 Ga0495680_0028515_1688_3760 659
431 3300047322 Ga0495680_0053788 Ga0495680_0053788_536_2608 659
432 3300047444 Ga0495675_0029558 Ga0495675_0029558_976_3048 659
433 3300047471 Ga0495684_0029749 Ga0495684_0029749_923_2995 659
434 3300047673 Ga0495593_0033271 Ga0495593_0033271_155_2227 659
435 3300048088 Ga0495602_0072943 Ga0495602_0072943_51_2123 659
436 3300048089 Ga0495614_0020680 Ga0495614_0020680_267_2339 659
437 3300048904 Ga0496101_0077598 Ga0496101_0077598_69_2141 659
438 3300048911 Ga0496108_0055297 Ga0496108_0055297_653_2725 659
439 3300048912 Ga0496109_0082039 Ga0496109_0082039_468_2540 659
440 3300048913 Ga0496110_0067507 Ga0496110_0067507_569_2641 659
441 3300048915 Ga0496112_0158422 Ga0496112_0158422_135_2207 659
442 3300048916 Ga0496113_0072919 Ga0496113_0072919_48_2120 659
443 3300048917 Ga0496114_0010962 Ga0496114_0010962_1128_3200 659
444 3300048924 Ga0496121_0068884 Ga0496121_0068884_140_2212 659
445 3300049568 Ga0501031_0066715 Ga0501031_0066715_88_2157 659
446 3300049569 Ga0501032_0041476 Ga0501032_0041476_449_2518 659
447 3300049573 Ga0501037_0046907 Ga0501037_0046907_264_2333 659
448 3300049574 Ga0501038_0039138 Ga0501038_0039138_799_2868 659
449 3300049579 Ga0501043_0053086 Ga0501043_0053086_575_2644 659
450 3300049580 Ga0501046_0060879 Ga0501046_0060879_371_2440 659
451 3300049581 Ga0501047_0042312 Ga0501047_0042312_2042_4111 659
452 3300049589 Ga0501073_0035529 Ga0501073_0035529_692_2761 659
453 3300049590 Ga0501074_0053263 Ga0501074_0053263_538_2607 659
454 3300049742 Ga0501080_0093052 Ga0501080_0093052_225_2294 659
455 3300049822 Ga0501035_0040140 Ga0501035_0040140_1655_3724 659
456 3300050493 nmdc:mga0k408_19739_c1 nmdc:mga0k408_19739_c1_543_2612 659
457 3300050514 nmdc:mga08x19_50554_c1 nmdc:mga08x19_50554_c1_187_2259 659
458 3300053078 Ga0495612_0017739 Ga0495612_0017739_743_2818 659
459 3300053078 Ga0495612_0019722 Ga0495612_0019722_119_2191 659
460 3300053080 Ga0500635_0017039 Ga0500635_0017039_68_2140 659
461 3300053083 Ga0495655_0002696 Ga0495655_0002696_580_2652 659
462 3300053084 Ga0495595_0012140 Ga0495595_0012140_798_2870 659
463 3300053085 Ga0495619_0046447 Ga0495619_0046447_680_2752 659
464 3300053091 Ga0500647_0018039 Ga0500647_0018039_131_2203 659
465 3300053153 Ga0500616_0038394 Ga0500616_0038394_484_2556 659
466 3300053163 Ga0500639_032135 Ga0500639_032135_463_2535 659
467 3300053178 Ga0500637_0007572 Ga0500637_0007572_1934_4006 659
468 3300061734 Ga0530510_0063618 Ga0530510_0063618_572_2644 659
469 2162886012 MBSR1b_contig_8089505 MBSR1b_0648.00004150 660
470 3300003322 rootL2_10026358 rootL2_100263582 660
471 3300003781 Ga0055536_1000778 Ga0055536_100077821 660
472 3300003792 Ga0055540_1000054 Ga0055540_100005411 660
473 3300003794 Ga0055531_10000037 Ga0055531_10000037130 660
474 3300005329 Ga0070683_100081922 Ga0070683_1000819221 660
475 3300005330 Ga0070690_100031825 Ga0070690_1000318253 660
476 3300005337 Ga0070682_100047343 Ga0070682_1000473431 660
477 3300005338 Ga0068868_100094577 Ga0068868_1000945772 660
478 3300005347 Ga0070668_100064328 Ga0070668_1000643282 660
479 3300005354 Ga0070675_100074203 Ga0070675_1000742031 660
480 3300005355 Ga0070671_100060566 Ga0070671_1000605662 660
481 3300005355 Ga0070671_100088412 Ga0070671_1000884121 660
482 3300005364 Ga0070673_100048353 Ga0070673_1000483532 660
483 3300005364 Ga0070673_100073044 Ga0070673_1000730441 660
484 3300005445 Ga0070708_100061651 Ga0070708_1000616513 660
485 3300005455 Ga0070663_100051147 Ga0070663_1000511474 660
486 3300005518 Ga0070699_100069758 Ga0070699_1000697581 660
487 3300005535 Ga0070684_100069115 Ga0070684_1000691152 660
488 3300005543 Ga0070672_100073734 Ga0070672_1000737341 660
489 3300005544 Ga0070686_100045733 Ga0070686_1000457333 660
490 3300005564 Ga0070664_100117148 Ga0070664_1001171481 660
491 3300005616 Ga0068852_100089391 Ga0068852_1000893911 660
492 3300005718 Ga0068866_10029028 Ga0068866_100290283 660
493 3300005841 Ga0068863_100127366 Ga0068863_1001273662 660
494 3300005842 Ga0068858_100143025 Ga0068858_1001430251 660
495 3300006175 Ga0070712_100025680 Ga0070712_1000256802 660
496 3300006237 Ga0097621_100081272 Ga0097621_1000812723 660
497 3300006871 Ga0075434_100073665 Ga0075434_1000736652 660
498 3300006881 Ga0068865_100058764 Ga0068865_1000587643 660
499 3300006881 Ga0068865_100071340 Ga0068865_1000713402 660
500 3300009094 Ga0111539_10137931 Ga0111539_101379313 660
501 3300009094 Ga0111539_10161892 Ga0111539_101618921 660
502 3300009553 Ga0105249_10072624 Ga0105249_100726245 660
503 3300011119 Ga0105246_10045190 Ga0105246_100451902 660
504 3300013306 Ga0163162_10111721 Ga0163162_101117213 660
505 3300013306 Ga0163162_10144009 Ga0163162_101440092 660
506 3300013308 Ga0157375_10089765 Ga0157375_100897652 660
507 3300013308 Ga0157375_10112014 Ga0157375_101120143 660
508 3300014325 Ga0163163_10107280 Ga0163163_101072801 660
509 3300014325 Ga0163163_10169393 Ga0163163_101693931 660
510 3300014326 Ga0157380_10055887 Ga0157380_100558871 660
511 3300014968 Ga0157379_10054893 Ga0157379_100548934 660
512 3300014969 Ga0157376_10079175 Ga0157376_100791752 660
513 3300017792 Ga0163161_10058079 Ga0163161_100580791 660
514 3300021358 Ga0213873_10000137 Ga0213873_1000013710 660
515 3300021377 Ga0213874_10009331 Ga0213874_100093311 660
516 3300021384 Ga0213876_10042664 Ga0213876_100426641 660
517 3300025292 Ga0209676_1000105 Ga0209676_1000105209 660
518 3300025298 Ga0209050_1000314 Ga0209050_100031485 660
519 3300025303 Ga0209051_1000064 Ga0209051_100006412 660
520 3300025304 Ga0209257_1000109 Ga0209257_100010912 660
521 3300025926 Ga0207659_10060250 Ga0207659_100602502 660
522 3300025931 Ga0207644_10080314 Ga0207644_100803141 660
523 3300025937 Ga0207669_10036803 Ga0207669_100368031 660
524 3300025940 Ga0207691_10059698 Ga0207691_100596983 660
525 3300025944 Ga0207661_10077335 Ga0207661_100773351 660
526 3300025945 Ga0207679_10075639 Ga0207679_100756391 660
527 3300025960 Ga0207651_10052582 Ga0207651_100525821 660
528 3300025960 Ga0207651_10077561 Ga0207651_100775611 660
529 3300025972 Ga0207668_10073963 Ga0207668_100739632 660
530 3300026035 Ga0207703_10094286 Ga0207703_100942862 660
531 3300026067 Ga0207678_10056346 Ga0207678_100563464 660
532 3300026095 Ga0207676_10035237 Ga0207676_100352372 660
533 3300026121 Ga0207683_10084148 Ga0207683_100841481 660
534 3300031251 Ga0265327_10045233 Ga0265327_100452331 660
535 3300031507 Ga0307509_10098075 Ga0307509_100980751 660
536 3300033442 Ga0315911_1000050 Ga0315911_100005032 660
537 3300035083 Ga0373926_0010349 Ga0373926_0010349_520_2589 660
538 3300035171 Ga0373946_0010311 Ga0373946_0010311_842_2914 660
539 3300035691 Ga0373931_0014859 Ga0373931_0014859_1026_3107 660
540 3300035692 Ga0373935_0019298 Ga0373935_0019298_520_2592 660
541 3300035695 Ga0373927_0047009 Ga0373927_0047009_519_2591 660
542 3300035725 Ga0373947_0020330 Ga0373947_0020330_1604_3676 660
543 3300039437 Ga0436365_1829850 Ga0436365_1829850_911_2983 660
544 3300042134 Ga0450898_003648 Ga0450898_003648_106_2178 660
545 3300044673 Ga0453683_0050268 Ga0453683_0050268_33_2105 660
546 3300044694 Ga0466963_0035794 Ga0466963_0035794_142_2214 660
547 3300045049 Ga0466959_0052810 Ga0466959_0052810_112_2184 660
548 3300048909 Ga0496106_0033226 Ga0496106_0033226_294_2363 660
549 3300048911 Ga0496108_0086066 Ga0496108_0086066_448_2520 660
550 3300048912 Ga0496109_0079024 Ga0496109_0079024_149_2230 660
551 3300048915 Ga0496112_0102417 Ga0496112_0102417_605_2686 660
552 3300048917 Ga0496114_0060905 Ga0496114_0060905_204_2276 660
553 3300049823 Ga0501044_0105560 Ga0501044_0105560_713_2788 660
554 3300050507 nmdc:mga05p37_166815_c1 nmdc:mga05p37_166815_c1_538_2634 660

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00239

Resolvase

Resolvase, N terminal domain

16

166

0.91

PF07508

Recombinase

Recombinase

189

312

0.89

PF13408

Zn_ribbon_recom

Recombinase zinc beta ribbon domain

329

388

0.77

Feature Viewer

pLDDT pTM Quality
76.9 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map