F463012

General Info

Members Datasets Scaffolds Average Seq Length
554 281 1108 192

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0560389|Ga0395901_0560389_238_960
Length 240
Sequence MVIWSSFLVVPGGTRPFEAEIRRGRGIHRRWISDTRRIPDDANERRTEMGRIVITENVSLDGVVQDPTGEEGFRHGGWFVQVADKDRDARAKVMLDEALGAEAFLLGRRSYEFLAARWPSRNGELADRLNSLPKYVVSSTLEDPDWNNSTVLNGDVVNQVSKLREELDGDIVVPASRQLVRSLMEHDLVDELRLMVHPVSLGAGERLFEPTDDKQSMRLLETRTVGDGLAFLSYEIVRKA

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 7.04
Rhizosphere 90.43
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0560389 3300038443 Bacteria 1157
2 Ga0070683_100830738 3300005329 Bacteria 886
3 Ga0070690_100069720 3300005330 Bacteria 2282
4 Ga0070670_100116989 3300005331 Bacteria 2299
5 Ga0070682_100121726 3300005337 Bacteria 1753
6 Ga0070682_100233363 3300005337 Unclassified 1316
7 Ga0068868_100020888 3300005338 Bacteria 4927
8 Ga0068868_100145341 3300005338 Bacteria 1949
9 Ga0070689_100019986 3300005340 Bacteria 4962
10 Ga0070689_100646464 3300005340 Bacteria 920
11 Ga0070691_10082872 3300005341 Bacteria 1573
12 Ga0070691_10489920 3300005341 Bacteria 709
13 Ga0070692_10069158 3300005345 Bacteria 1878
14 Ga0070668_100001018 3300005347 Bacteria 19612
15 Ga0070675_100027454 3300005354 Bacteria 4573
16 Ga0070671_100337844 3300005355 Bacteria 1284
17 Ga0070671_100651740 3300005355 Bacteria 912
18 Ga0070674_100053401 3300005356 Bacteria 2790
19 Ga0070674_100303366 3300005356 Bacteria 1274
20 Ga0070674_100428448 3300005356 Bacteria 1087
21 Ga0070673_100398009 3300005364 Bacteria 1231
22 Ga0070703_10132807 3300005406 Bacteria 916
23 Ga0070709_10006331 3300005434 Bacteria 6444
24 Ga0070714_100427568 3300005435 Bacteria 1255
25 Ga0070713_100045968 3300005436 Bacteria 3580
26 Ga0070713_100078960 3300005436 Bacteria 2802
27 Ga0070713_100503029 3300005436 Bacteria 1144
28 Ga0070710_10009462 3300005437 Bacteria 4768
29 Ga0070701_10598509 3300005438 Bacteria 730
30 Ga0070711_100007058 3300005439 Bacteria 6814
31 Ga0070711_100375151 3300005439 Bacteria 1149
32 Ga0070705_100000420 3300005440 Bacteria 24448
33 Ga0070705_100028580 3300005440 Bacteria 3056
34 Ga0070700_100032252 3300005441 Bacteria 3147
35 Ga0070708_100001132 3300005445 Bacteria 20455
36 Ga0070708_100011585 3300005445 Bacteria 7178
37 Ga0070708_100015942 3300005445 Bacteria 6219
38 Ga0070708_100241902 3300005445 Bacteria 1694
39 Ga0070663_100058492 3300005455 Bacteria 2768
40 Ga0070663_100321885 3300005455 Bacteria 1244
41 Ga0070678_100193781 3300005456 Archaea 1673
42 Ga0070678_100757754 3300005456 Bacteria 879
43 Ga0070685_10018362 3300005466 Bacteria 3760
44 Ga0070706_100000319 3300005467 Bacteria 58620
45 Ga0070706_100000552 3300005467 Bacteria 43513
46 Ga0070706_100002250 3300005467 Bacteria 19582
47 Ga0070706_100003818 3300005467 Bacteria 14720
48 Ga0070706_100024935 3300005467 Bacteria 5504
49 Ga0070706_100025195 3300005467 Bacteria 5475
50 Ga0070707_100004077 3300005468 Bacteria 13716
51 Ga0070707_100052925 3300005468 Bacteria 3892
52 Ga0070707_100059394 3300005468 Bacteria 3668
53 Ga0070707_100145739 3300005468 Bacteria 2305
54 Ga0070707_100163024 3300005468 Bacteria 2172
55 Ga0070707_100168766 3300005468 Bacteria 2133
56 Ga0070707_100436804 3300005468 Bacteria 1269
57 Ga0070698_100002376 3300005471 Bacteria 20762
58 Ga0070698_100002690 3300005471 Bacteria 19569
59 Ga0070698_100002742 3300005471 Bacteria 19361
60 Ga0070698_100006529 3300005471 Bacteria 12649
61 Ga0070698_100289025 3300005471 Bacteria 1570
62 Ga0070699_100000370 3300005518 Bacteria 44000
63 Ga0070699_100017119 3300005518 Bacteria 6225
64 Ga0070699_100093472 3300005518 Bacteria 2631
65 Ga0070699_100106924 3300005518 Bacteria 2454
66 Ga0070699_100667808 3300005518 Bacteria 949
67 Ga0070697_100000016 3300005536 Bacteria 143107
68 Ga0070697_100014014 3300005536 Bacteria 6296
69 Ga0070697_100194880 3300005536 Bacteria 1720
70 Ga0070697_100219686 3300005536 Bacteria 1619
71 Ga0070697_100230796 3300005536 Bacteria 1579
72 Ga0070697_100278101 3300005536 Bacteria 1436
73 Ga0070686_100038958 3300005544 Bacteria 2959
74 Ga0070686_100061416 3300005544 Bacteria 2428
75 Ga0070695_100180107 3300005545 Archaea 1497
76 Ga0070695_100286932 3300005545 Bacteria 1212
77 Ga0070695_100938902 3300005545 Bacteria 701
78 Ga0070693_100159047 3300005547 Bacteria 1437
79 Ga0070693_100181395 3300005547 Bacteria 1355
80 Ga0070704_100134010 3300005549 Bacteria 1925
81 Ga0070704_100141541 3300005549 Archaea 1879
82 Ga0070704_100205667 3300005549 Bacteria 1592
83 Ga0068856_100269805 3300005614 Bacteria 1717
84 Ga0070702_100004623 3300005615 Bacteria 6309
85 Ga0068852_100026170 3300005616 Bacteria 4738
86 Ga0068859_100217696 3300005617 Bacteria 1997
87 Ga0068866_10007002 3300005718 Bacteria 4713
88 Ga0068861_100054245 3300005719 Bacteria 3053
89 Ga0068858_100142418 3300005842 Bacteria 2251
90 Ga0068860_100349362 3300005843 Bacteria 1455
91 Ga0068862_100595602 3300005844 Bacteria 1061
92 Ga0081538_10000887 3300005981 Bacteria 32365
93 Ga0081538_10020180 3300005981 Bacteria 4919
94 Ga0081540_1100643 3300005983 Bacteria 1246
95 Ga0081539_10038229 3300005985 Bacteria 2846
96 Ga0070717_10104881 3300006028 Bacteria 2405
97 Ga0070715_10471258 3300006163 Bacteria 713
98 Ga0070716_100095034 3300006173 Bacteria 1813
99 Ga0070716_100219466 3300006173 Bacteria 1276
100 Ga0070716_100391814 3300006173 Bacteria 996
101 Ga0070712_100026281 3300006175 Bacteria 3876
102 Ga0070712_100255466 3300006175 Bacteria 1402
103 Ga0070712_100281920 3300006175 Bacteria 1339
104 Ga0070712_100411608 3300006175 Bacteria 1119
105 Ga0075367_10069225 3300006178 Unclassified 2118
106 Ga0097621_100038676 3300006237 Bacteria 3828
107 Ga0068871_100024923 3300006358 Bacteria 4646
108 Ga0075428_100261663 3300006844 Bacteria 1862
109 Ga0075428_100320599 3300006844 Bacteria 1665
110 Ga0075430_100301328 3300006846 Bacteria 1326
111 Ga0075431_100678788 3300006847 Bacteria 1009
112 Ga0075433_10022481 3300006852 Bacteria 5293
113 Ga0075434_100666194 3300006871 Bacteria 1059
114 Ga0075434_100774764 3300006871 Bacteria 976
115 Ga0075434_100807200 3300006871 Bacteria 954
116 Ga0075429_100474943 3300006880 Bacteria 1095
117 Ga0075436_100063928 3300006914 Bacteria 2543
118 Ga0097620_100217688 3300006931 Bacteria 1997
119 Ga0075435_100306849 3300007076 Bacteria 1358
120 Ga0075435_100350822 3300007076 Bacteria 1265
121 Ga0075435_100502177 3300007076 Bacteria 1049
122 Ga0105251_10035458 3300009011 Bacteria 2461
123 Ga0105245_10067804 3300009098 Bacteria 3232
124 Ga0105245_10102870 3300009098 Bacteria 2645
125 Ga0105245_10171349 3300009098 Bacteria 2067
126 Ga0105247_10096398 3300009101 Archaea 1885
127 Ga0105247_10100597 3300009101 Bacteria 1848
128 Ga0114129_10003282 3300009147 Bacteria 22706
129 Ga0114129_10084845 3300009147 Bacteria 4395
130 Ga0114129_10284435 3300009147 Bacteria 2209
131 Ga0114129_10503201 3300009147 Bacteria 1582
132 Ga0114129_10834705 3300009147 Bacteria 1173
133 Ga0114129_10837878 3300009147 Bacteria 1170
134 Ga0114129_12328872 3300009147 Bacteria 642
135 Ga0105243_10006352 3300009148 Bacteria 9127
136 Ga0105243_10182765 3300009148 Archaea 1825
137 Ga0105243_10922732 3300009148 Bacteria 870
138 Ga0105241_10066965 3300009174 Bacteria 2779
139 Ga0105241_10420982 3300009174 Bacteria 1175
140 Ga0105242_10008423 3300009176 Bacteria 7926
141 Ga0105248_10157151 3300009177 Bacteria 2566
142 Ga0105237_11375011 3300009545 Bacteria 712
143 Ga0105238_10541562 3300009551 Bacteria 1168
144 Ga0105249_11166100 3300009553 Bacteria 841
145 Ga0099796_10023429 3300010159 Bacteria 1928
146 Ga0105239_10834335 3300010375 Archaea 1057
147 Ga0105246_10199664 3300011119 Archaea 1554
148 Ga0105246_10748692 3300011119 Bacteria 862
149 Ga0157374_11563812 3300013296 Unclassified 683
150 Ga0157378_10056105 3300013297 Bacteria 3509
151 Ga0163162_10197862 3300013306 Bacteria 2138
152 Ga0163162_10835631 3300013306 Unclassified 1037
153 Ga0157372_10489226 3300013307 Bacteria 1434
154 Ga0157375_10272582 3300013308 Bacteria 1854
155 Ga0157375_11849022 3300013308 Bacteria 716
156 Ga0157380_10185422 3300014326 Bacteria 1832
157 Ga0182008_10156025 3300014497 Bacteria 1146
158 Ga0157377_10195728 3300014745 Bacteria 1280
159 Ga0157379_10012887 3300014968 Bacteria 7314
160 Ga0157379_10123111 3300014968 Archaea 2334
161 Ga0157379_10153304 3300014968 Bacteria 2078
162 Ga0157379_10253715 3300014968 Bacteria 1597
163 Ga0157376_10009311 3300014969 Bacteria 7134
164 Ga0206353_11863289 3300020082 Bacteria 1183
165 Ga0213876_10116089 3300021384 Bacteria 1420
166 Ga0213876_10262091 3300021384 Bacteria 918
167 Ga0213875_10018706 3300021388 Bacteria 3338
168 Ga0213875_10148932 3300021388 Bacteria 1096
169 Ga0207656_10369242 3300025321 Bacteria 718
170 Ga0207713_1150154 3300025735 Bacteria 753
171 Ga0207653_10034684 3300025885 Bacteria 1639
172 Ga0207653_10063141 3300025885 Bacteria 1253
173 Ga0207692_10007246 3300025898 Bacteria 4534
174 Ga0207642_10074019 3300025899 Bacteria 1631
175 Ga0207642_10085697 3300025899 Bacteria 1542
176 Ga0207710_10135592 3300025900 Bacteria 1185
177 Ga0207710_10199958 3300025900 Bacteria 987
178 Ga0207688_10042031 3300025901 Bacteria 2544
179 Ga0207688_10062965 3300025901 Archaea 2092
180 Ga0207688_10222899 3300025901 Bacteria 1136
181 Ga0207685_10040075 3300025905 Bacteria 1743
182 Ga0207699_10085348 3300025906 Bacteria 1969
183 Ga0207643_10064219 3300025908 Bacteria 2101
184 Ga0207643_10065868 3300025908 Bacteria 2076
185 Ga0207684_10002278 3300025910 Bacteria 19521
186 Ga0207684_10020317 3300025910 Bacteria 5673
187 Ga0207684_10041187 3300025910 Bacteria 3917
188 Ga0207684_10154582 3300025910 Bacteria 1974
189 Ga0207654_10156706 3300025911 Bacteria 1467
190 Ga0207693_10096034 3300025915 Bacteria 2324
191 Ga0207693_10134156 3300025915 Archaea 1946
192 Ga0207663_10018636 3300025916 Bacteria 3894
193 Ga0207663_10059399 3300025916 Archaea 2419
194 Ga0207662_10064462 3300025918 Bacteria 2205
195 Ga0207646_10003448 3300025922 Bacteria 17855
196 Ga0207646_10016850 3300025922 Bacteria 6853
197 Ga0207646_10194590 3300025922 Bacteria 1831
198 Ga0207646_10337603 3300025922 Bacteria 1361
199 Ga0207650_10090824 3300025925 Bacteria 2333
200 Ga0207687_10032774 3300025927 Bacteria 3520
201 Ga0207687_10081014 3300025927 Bacteria 2345
202 Ga0207687_10142253 3300025927 Archaea 1821
203 Ga0207700_10023762 3300025928 Bacteria 4233
204 Ga0207700_10075429 3300025928 Bacteria 2613
205 Ga0207700_10376405 3300025928 Bacteria 1241
206 Ga0207700_10553384 3300025928 Bacteria 1021
207 Ga0207664_10007337 3300025929 Bacteria 7640
208 Ga0207664_10011601 3300025929 Bacteria 6273
209 Ga0207664_10066792 3300025929 Bacteria 2884
210 Ga0207664_10171667 3300025929 Bacteria 1856
211 Ga0207664_10292246 3300025929 Bacteria 1432
212 Ga0207644_10370998 3300025931 Bacteria 1166
213 Ga0207644_10645301 3300025931 Bacteria 881
214 Ga0207706_10374389 3300025933 Bacteria 1236
215 Ga0207686_10529884 3300025934 Bacteria 918
216 Ga0207709_10049020 3300025935 Bacteria 2576
217 Ga0207709_10778509 3300025935 Bacteria 771
218 Ga0207669_10075690 3300025937 Bacteria 2134
219 Ga0207669_11074041 3300025937 Bacteria 679
220 Ga0207704_10823508 3300025938 Unclassified 776
221 Ga0207665_10134045 3300025939 Unclassified 1761
222 Ga0207665_10249753 3300025939 Bacteria 1310
223 Ga0207711_11010935 3300025941 Bacteria 771
224 Ga0207711_11287267 3300025941 Bacteria 673
225 Ga0207689_10098848 3300025942 Bacteria 2397
226 Ga0207712_10298899 3300025961 Bacteria 1320
227 Ga0207712_10666910 3300025961 Bacteria 905
228 Ga0207668_10000773 3300025972 Bacteria 19587
229 Ga0207658_10101174 3300025986 Bacteria 2258
230 Ga0207677_10036388 3300026023 Archaea 3208
231 Ga0207677_10050705 3300026023 Bacteria 2809
232 Ga0207677_10409762 3300026023 Bacteria 1152
233 Ga0207703_10234164 3300026035 Bacteria 1648
234 Ga0207639_10212476 3300026041 Bacteria 1666
235 Ga0207678_10059407 3300026067 Bacteria 3290
236 Ga0207678_10093910 3300026067 Bacteria 2563
237 Ga0207708_10016938 3300026075 Bacteria 5487
238 Ga0207708_10046853 3300026075 Bacteria 3292
239 Ga0207702_10357332 3300026078 Bacteria 1399
240 Ga0207648_10115553 3300026089 Bacteria 2358
241 Ga0207676_10186018 3300026095 Bacteria 1823
242 Ga0207675_100107711 3300026118 Bacteria 2628
243 Ga0207683_10008390 3300026121 Bacteria 8839
244 Ga0207698_10688435 3300026142 Bacteria 1016
245 Ga0268265_10719778 3300028380 Bacteria 966
246 Ga0268265_11366570 3300028380 Bacteria 710
247 Ga0268264_10073250 3300028381 Bacteria 2906
248 Ga0268264_10217511 3300028381 Bacteria 1757
249 Ga0307410_10819558 3300031852 Bacteria 793
250 Ga0307414_10141220 3300032004 Bacteria 1886
251 Ga0307415_100827847 3300032126 Bacteria 847
252 Ga0307507_10000017 3300033179 Bacteria 224506
253 Ga0373926_0001597 3300035083 Bacteria 6974
254 Ga0373929_0063946 3300035085 Bacteria 867
255 Ga0373934_0008445 3300035086 Bacteria 3839
256 Ga0373934_0261834 3300035086 Bacteria 715
257 Ga0373944_0004417 3300035089 Bacteria 3661
258 Ga0373951_0049553 3300035091 Bacteria 1031
259 Ga0373951_0095749 3300035091 Bacteria 784
260 Ga0373923_0103051 3300035111 Bacteria 1260
261 Ga0373936_0019260 3300035113 Bacteria 2644
262 Ga0373945_0022830 3300035116 Bacteria 2158
263 Ga0373945_0048441 3300035116 Bacteria 1556
264 Ga0373945_0077769 3300035116 Bacteria 1266
265 Ga0373953_0006797 3300035117 Bacteria 3792
266 Ga0373953_0158265 3300035117 Bacteria 973
267 Ga0373954_0267927 3300035118 Bacteria 841
268 Ga0373956_0103322 3300035119 Bacteria 1323
269 Ga0373957_0018035 3300035120 Bacteria 2466
270 Ga0373957_0080609 3300035120 Bacteria 1284
271 Ga0373960_0016072 3300035121 Bacteria 1920
272 Ga0373960_0188291 3300035121 Bacteria 724
273 Ga0373943_0000433 3300035170 Bacteria 17675
274 Ga0373943_0008839 3300035170 Bacteria 4510
275 Ga0373946_0003551 3300035171 Bacteria 5536
276 Ga0373946_0007290 3300035171 Bacteria 4036
277 Ga0373962_0028392 3300035242 Bacteria 1518
278 Ga0373924_0041087 3300035410 Bacteria 1894
279 Ga0373924_0120829 3300035410 Bacteria 1136
280 Ga0373935_0043754 3300035692 Bacteria 2819
281 Ga0373927_0013304 3300035695 Bacteria 5470
282 Ga0373927_0051375 3300035695 Bacteria 2665
283 Ga0373947_0004052 3300035725 Bacteria 8620
284 Ga0373947_0017692 3300035725 Bacteria 4100
285 Ga0373947_0090806 3300035725 Bacteria 1904
286 Ga0373937_0112241 3300036401 Bacteria 2535
287 Ga0373925_0011456 3300037068 Bacteria 6419
288 Ga0395900_0204271 3300037418 Bacteria 1997
289 Ga0395900_0290221 3300037418 Bacteria 1625
290 Ga0395900_0400793 3300037418 Bacteria 1336
291 Ga0395900_0505455 3300037418 Bacteria 1158
292 Ga0395900_0939051 3300037418 Bacteria 787
293 Ga0395898_0093928 3300037466 Bacteria 2882
294 Ga0395898_0519841 3300037466 Bacteria 1132
295 Ga0395898_0657599 3300037466 Bacteria 990
296 Ga0395905_0622713 3300037471 Bacteria 981
297 Ga0395905_0809413 3300037471 Bacteria 840
298 Ga0436364_0381117 3300037853 Bacteria 1669
299 Ga0436364_0396546 3300037853 Bacteria 875
300 Ga0436364_0841830 3300037853 Bacteria 1131
301 Ga0436364_1231099 3300037853 Bacteria 3063
302 Ga0436364_1232393 3300037853 Bacteria 9843
303 Ga0395901_0010437 3300038443 Bacteria 9410
304 Ga0395901_0049310 3300038443 Bacteria 4374
305 Ga0395901_0063215 3300038443 Bacteria 3852
306 Ga0436365_1210781 3300039437 Bacteria 4767
307 Ga0436365_1627795 3300039437 Bacteria 13002
308 Ga0451853_2650434 3300041512 Bacteria 697
309 Ga0439463_031856 3300042016 Bacteria 1332
310 Ga0466969_0019624 3300044656 Bacteria 3511
311 Ga0466966_0007110 3300044684 Bacteria 7419
312 Ga0466961_0012478 3300044693 Bacteria 5437
313 Ga0466961_0013514 3300044693 Bacteria 5228
314 Ga0466963_0002840 3300044694 Bacteria 9768
315 Ga0466963_0020711 3300044694 Bacteria 4139
316 Ga0466971_0003304 3300044719 Bacteria 6888
317 Ga0466971_0048620 3300044719 Bacteria 1907
318 Ga0466971_0161967 3300044719 Bacteria 1047
319 Ga0466968_0057553 3300044735 Bacteria 1671
320 Ga0466968_0067137 3300044735 Bacteria 1555
321 Ga0466968_0183315 3300044735 Bacteria 974
322 Ga0466970_0052899 3300044765 Bacteria 2168
323 Ga0466970_0078823 3300044765 Bacteria 1778
324 Ga0466957_0061156 3300044842 Bacteria 2311
325 Ga0466957_0147749 3300044842 Bacteria 1518
326 Ga0466959_0005154 3300045049 Bacteria 8903
327 Ga0466959_0007236 3300045049 Bacteria 7774
328 Ga0466959_0016190 3300045049 Bacteria 5444
329 Ga0466958_0000986 3300045836 Bacteria 12860
330 Ga0466958_0009977 3300045836 Bacteria 5305
331 Ga0466958_0014241 3300045836 Bacteria 4541
332 Ga0466958_0076171 3300045836 Bacteria 2059
333 Ga0495592_0003761 3300046454 Bacteria 10953
334 Ga0495592_0049472 3300046454 Bacteria 3125
335 Ga0495603_0004840 3300046455 Bacteria 8050
336 Ga0495603_0023342 3300046455 Bacteria 3744
337 Ga0495603_0205318 3300046455 Bacteria 1138
338 Ga0495603_0363966 3300046455 Bacteria 830
339 Ga0495629_0000079 3300046459 Bacteria 85673
340 Ga0495629_0006537 3300046459 Bacteria 8633
341 Ga0495629_0016137 3300046459 Bacteria 5361
342 Ga0495641_0005325 3300046461 Bacteria 8728
343 Ga0495641_0018999 3300046461 Bacteria 3529
344 Ga0495641_0020782 3300046461 Bacteria 3318
345 Ga0495651_0017579 3300046462 Bacteria 5536
346 Ga0495651_0054901 3300046462 Bacteria 3061
347 Ga0495653_0015762 3300046463 Bacteria 6161
348 Ga0495653_0033840 3300046463 Bacteria 4046
349 Ga0495580_0002412 3300046472 Bacteria 16334
350 Ga0495580_0005682 3300046472 Bacteria 10259
351 Ga0495582_0003393 3300046473 Bacteria 8967
352 Ga0495582_0009339 3300046473 Bacteria 5402
353 Ga0495582_0009345 3300046473 Bacteria 5402
354 Ga0495639_0000500 3300046475 Bacteria 18486
355 Ga0495639_0001820 3300046475 Bacteria 9456
356 Ga0495662_0000266 3300046476 Bacteria 22167
357 Ga0495662_0000357 3300046476 Bacteria 20066
358 Ga0495662_0010702 3300046476 Bacteria 4486
359 Ga0495662_0116861 3300046476 Bacteria 1308
360 Ga0495664_0016677 3300046477 Bacteria 4188
361 Ga0495664_0040534 3300046477 Bacteria 2754
362 Ga0495594_0008847 3300046499 Bacteria 5191
363 Ga0495594_0034540 3300046499 Bacteria 2751
364 Ga0495594_0143246 3300046499 Bacteria 1356
365 Ga0495608_0005524 3300046511 Bacteria 9030
366 Ga0495618_0009989 3300046514 Bacteria 5742
367 Ga0495618_0376530 3300046514 Bacteria 871
368 Ga0495618_0595433 3300046514 Bacteria 658
369 Ga0495628_0053510 3300046516 Bacteria 3185
370 Ga0495628_0076189 3300046516 Bacteria 2610
371 Ga0495630_0001894 3300046517 Bacteria 14558
372 Ga0495630_0036434 3300046517 Bacteria 3677
373 Ga0495630_0079009 3300046517 Bacteria 2481
374 Ga0495666_0031079 3300046526 Bacteria 2618
375 Ga0495652_0072907 3300046529 Bacteria 2860
376 Ga0495652_0073877 3300046529 Bacteria 2837
377 Ga0495665_0001529 3300046531 Bacteria 12330
378 Ga0495665_0022828 3300046531 Bacteria 3360
379 Ga0495640_0011298 3300046533 Bacteria 6874
380 Ga0495640_0021179 3300046533 Bacteria 4775
381 Ga0495586_0014832 3300046535 Bacteria 4141
382 Ga0495586_0033096 3300046535 Bacteria 2773
383 Ga0495587_0016237 3300046536 Bacteria 4635
384 Ga0495587_0150653 3300046536 Bacteria 1325
385 Ga0495645_0044208 3300046543 Bacteria 3249
386 Ga0495645_0053434 3300046543 Bacteria 2936
387 Ga0495645_0064712 3300046543 Bacteria 2645
388 Ga0495667_0007074 3300046559 Bacteria 7614
389 Ga0495656_0105137 3300046615 Bacteria 1312
390 Ga0495634_0007366 3300046642 Bacteria 8282
391 Ga0495634_0031079 3300046642 Bacteria 3680
392 Ga0495634_0182820 3300046642 Bacteria 1311
393 Ga0495635_0016001 3300046663 Bacteria 5239
394 Ga0495635_0019979 3300046663 Bacteria 4668
395 Ga0495635_0145662 3300046663 Bacteria 1612
396 Ga0495588_0033763 3300046674 Bacteria 2586
397 Ga0495657_0042072 3300046675 Bacteria 3121
398 Ga0495657_0114004 3300046675 Bacteria 1709
399 Ga0495599_0014823 3300046678 Bacteria 4827
400 Ga0495599_0022987 3300046678 Bacteria 3894
401 Ga0495599_0073738 3300046678 Bacteria 2131
402 Ga0495599_0176609 3300046678 Bacteria 1317
403 Ga0495623_0015065 3300046679 Bacteria 4998
404 Ga0495623_0068367 3300046679 Bacteria 2216
405 Ga0495623_0181005 3300046679 Bacteria 1224
406 Ga0495646_0036592 3300046680 Bacteria 3040
407 Ga0495646_0040092 3300046680 Bacteria 2885
408 Ga0495646_0054743 3300046680 Bacteria 2398
409 Ga0495647_0003919 3300046681 Bacteria 4804
410 Ga0495647_0009580 3300046681 Bacteria 3284
411 Ga0495658_0002080 3300046683 Bacteria 10148
412 Ga0495658_0011380 3300046683 Bacteria 4473
413 Ga0495658_0069628 3300046683 Bacteria 2039
414 Ga0495613_0004092 3300046689 Bacteria 10899
415 Ga0495613_0005986 3300046689 Bacteria 9102
416 Ga0495613_0069122 3300046689 Bacteria 2575
417 Ga0495613_0409498 3300046689 Bacteria 924
418 Ga0495624_0007418 3300046690 Bacteria 7693
419 Ga0495624_0008116 3300046690 Bacteria 7349
420 Ga0495624_0129700 3300046690 Bacteria 1546
421 Ga0495600_0020161 3300046809 Bacteria 4265
422 Ga0495581_0002603 3300047315 Bacteria 10261
423 Ga0495581_0004661 3300047315 Bacteria 7919
424 Ga0495604_0005094 3300047317 Bacteria 10406
425 Ga0495604_0033284 3300047317 Bacteria 4081
426 Ga0495674_0015777 3300047319 Bacteria 7051
427 Ga0495674_0041849 3300047319 Bacteria 4089
428 Ga0495674_0056266 3300047319 Bacteria 3445
429 Ga0495676_0002367 3300047321 Bacteria 16730
430 Ga0495676_0009695 3300047321 Bacteria 8756
431 Ga0495676_0016386 3300047321 Bacteria 6582
432 Ga0495676_0370824 3300047321 Bacteria 954
433 Ga0495680_0002371 3300047322 Bacteria 19304
434 Ga0495680_0011414 3300047322 Bacteria 7865
435 Ga0495680_0026557 3300047322 Bacteria 4772
436 Ga0495675_0079367 3300047444 Bacteria 2067
437 Ga0495684_0000917 3300047471 Bacteria 23915
438 Ga0495684_0001955 3300047471 Bacteria 16551
439 Ga0495684_0017532 3300047471 Bacteria 5513
440 Ga0495684_0104859 3300047471 Bacteria 2136
441 Ga0495593_0000862 3300047673 Bacteria 17564
442 Ga0495593_0009147 3300047673 Bacteria 5747
443 Ga0495602_0012960 3300048088 Bacteria 8534
444 Ga0495602_0018501 3300048088 Bacteria 6955
445 Ga0495602_0225960 3300048088 Bacteria 1409
446 Ga0495614_0002807 3300048089 Bacteria 7749
447 Ga0495614_0010376 3300048089 Bacteria 4107
448 Ga0495614_0234486 3300048089 Bacteria 837
449 Ga0495626_0027668 3300048091 Bacteria 2755
450 Ga0496100_0005946 3300048903 Bacteria 6615
451 Ga0496100_0554796 3300048903 Bacteria 889
452 Ga0496100_0675015 3300048903 Bacteria 805
453 Ga0496101_0002935 3300048904 Bacteria 10483
454 Ga0496101_0052002 3300048904 Bacteria 2952
455 Ga0496101_0340549 3300048904 Bacteria 1178
456 Ga0496101_0557777 3300048904 Bacteria 906
457 Ga0496102_0008433 3300048905 Bacteria 8835
458 Ga0496102_0584572 3300048905 Bacteria 1039
459 Ga0496103_0081748 3300048906 Archaea 2032
460 Ga0496103_0299007 3300048906 Bacteria 1035
461 Ga0496103_0377061 3300048906 Bacteria 911
462 Ga0496104_0002772 3300048907 Bacteria 15092
463 Ga0496105_0049142 3300048908 Unclassified 3481
464 Ga0496105_0351121 3300048908 Unclassified 1178
465 Ga0496105_0507061 3300048908 Bacteria 946
466 Ga0496106_0005898 3300048909 Bacteria 9055
467 Ga0496106_0120487 3300048909 Archaea 2050
468 Ga0496107_0007964 3300048910 Bacteria 7313
469 Ga0496108_0072763 3300048911 Bacteria 2902
470 Ga0496108_0188834 3300048911 Bacteria 1785
471 Ga0496109_0125645 3300048912 Archaea 2391
472 Ga0496109_0136824 3300048912 Bacteria 2289
473 Ga0496109_0148150 3300048912 Bacteria 2197
474 Ga0496110_0051913 3300048913 Bacteria 3603
475 Ga0496110_0183592 3300048913 Archaea 1899
476 Ga0496110_0247697 3300048913 Bacteria 1622
477 Ga0496111_0067396 3300048914 Archaea 2600
478 Ga0496112_0137763 3300048915 Bacteria 2410
479 Ga0496112_0181050 3300048915 Bacteria 2071
480 Ga0496112_1143615 3300048915 Bacteria 696
481 Ga0496113_0150382 3300048916 Bacteria 1836
482 Ga0496113_0301697 3300048916 Bacteria 1282
483 Ga0496114_0013358 3300048917 Bacteria 6582
484 Ga0496114_0027986 3300048917 Bacteria 4622
485 Ga0496114_0124376 3300048917 Bacteria 2221
486 Ga0496114_0812244 3300048917 Bacteria 814
487 Ga0496115_0003019 3300048918 Bacteria 12078
488 Ga0496115_0033458 3300048918 Bacteria 4059
489 Ga0501031_0188568 3300049568 Bacteria 1346
490 Ga0501032_0048070 3300049569 Bacteria 2880
491 Ga0501033_0035433 3300049570 Bacteria 3741
492 Ga0501033_0413699 3300049570 Bacteria 939
493 Ga0501034_0018452 3300049571 Bacteria 7154
494 Ga0501036_0098797 3300049572 Bacteria 2468
495 Ga0501036_0232826 3300049572 Bacteria 1545
496 Ga0501036_1151866 3300049572 Unclassified 633
497 Ga0501037_0138901 3300049573 Bacteria 1739
498 Ga0501038_0117907 3300049574 Bacteria 2192
499 Ga0501038_0210083 3300049574 Bacteria 1557
500 Ga0501039_0267142 3300049575 Bacteria 1344
501 Ga0501040_0000355 3300049576 Bacteria 26942
502 Ga0501040_0691514 3300049576 Bacteria 737
503 Ga0501041_0061291 3300049577 Bacteria 2303
504 Ga0501041_0174638 3300049577 Bacteria 1344
505 Ga0501042_0061264 3300049578 Bacteria 2688
506 Ga0501042_0228054 3300049578 Bacteria 1344
507 Ga0501043_0576398 3300049579 Bacteria 833
508 Ga0501046_0020166 3300049580 Bacteria 5517
509 Ga0501046_0169041 3300049580 Bacteria 1641
510 Ga0501048_0529178 3300049582 Bacteria 845
511 Ga0501067_0023853 3300049583 Bacteria 3392
512 Ga0501068_0002915 3300049584 Bacteria 9102
513 Ga0501068_0500735 3300049584 Bacteria 788
514 Ga0501071_0307437 3300049587 Bacteria 1202
515 Ga0501071_0417313 3300049587 Bacteria 1025
516 Ga0501072_0331034 3300049588 Bacteria 1210
517 Ga0501073_0062329 3300049589 Bacteria 2601
518 Ga0501075_0002312 3300049591 Bacteria 12646
519 Ga0501075_0100931 3300049591 Bacteria 2191
520 Ga0501076_0001306 3300049592 Bacteria 16622
521 Ga0501076_0074516 3300049592 Bacteria 2719
522 Ga0501077_0179269 3300049593 Bacteria 1346
523 Ga0501077_0235213 3300049593 Bacteria 1164
524 Ga0501079_0016236 3300049741 Bacteria 5691
525 Ga0501079_0216632 3300049741 Bacteria 1495
526 Ga0501081_0231891 3300049743 Bacteria 1344
527 Ga0501083_0038603 3300049744 Bacteria 3245
528 Ga0501035_0123770 3300049822 Bacteria 2258
529 Ga0501035_0218704 3300049822 Bacteria 1627
530 Ga0501044_0417314 3300049823 Bacteria 1252
531 Ga0501044_0780399 3300049823 Bacteria 836
532 Ga0501045_0072140 3300049824 Bacteria 2542
533 Ga0501045_0106726 3300049824 Bacteria 2075
534 Ga0501045_0240862 3300049824 Bacteria 1346
535 nmdc:mga05p37_1266527_c1 3300050507 Bacteria 755
536 nmdc:mga05p37_1282663_c1 3300050507 Bacteria 748
537 nmdc:mga05p37_364780_c1 3300050507 Bacteria 1697
538 nmdc:mga05p37_703878_c1 3300050507 Bacteria 1122
539 nmdc:mga0qj67_556732_c1 3300050509 Bacteria 919
540 nmdc:mga0n895_1037139_c1 3300050512 Bacteria 800
541 Ga0495601_0007706 3300053077 Bacteria 6328
542 Ga0495601_0051359 3300053077 Bacteria 2602
543 Ga0495601_0383143 3300053077 Bacteria 912
544 Ga0495612_0013322 3300053078 Bacteria 3312
545 Ga0495612_0181165 3300053078 Bacteria 925
546 Ga0495619_0001098 3300053085 Bacteria 17804
547 Ga0495619_0001469 3300053085 Bacteria 15536
548 Ga0495619_0006173 3300053085 Bacteria 7592
549 Ga0501084_0002037 3300054114 Bacteria 16143
550 Ga0501082_0282950 3300060353 Bacteria 1443
551 Ga0466962_0001997 3300061719 Bacteria 9634
552 Ga0466962_0015757 3300061719 Bacteria 3646
553 Ga0530510_0202554 3300061734 Bacteria 1474
554 Ga0530510_0241946 3300061734 Bacteria 1344
555 Ga0395901_0560389
556 Ga0070683_100830738
557 Ga0070690_100069720
558 Ga0070670_100116989
559 Ga0070682_100121726
560 Ga0070682_100233363
561 Ga0068868_100020888
562 Ga0068868_100145341
563 Ga0070689_100019986
564 Ga0070689_100646464
565 Ga0070691_10082872
566 Ga0070691_10489920
567 Ga0070692_10069158
568 Ga0070668_100001018
569 Ga0070675_100027454
570 Ga0070671_100337844
571 Ga0070671_100651740
572 Ga0070674_100053401
573 Ga0070674_100303366
574 Ga0070674_100428448
575 Ga0070673_100398009
576 Ga0070703_10132807
577 Ga0070709_10006331
578 Ga0070714_100427568
579 Ga0070713_100045968
580 Ga0070713_100078960
581 Ga0070713_100503029
582 Ga0070710_10009462
583 Ga0070701_10598509
584 Ga0070711_100007058
585 Ga0070711_100375151
586 Ga0070705_100000420
587 Ga0070705_100028580
588 Ga0070700_100032252
589 Ga0070708_100001132
590 Ga0070708_100011585
591 Ga0070708_100015942
592 Ga0070708_100241902
593 Ga0070663_100058492
594 Ga0070663_100321885
595 Ga0070678_100193781
596 Ga0070678_100757754
597 Ga0070685_10018362
598 Ga0070706_100000319
599 Ga0070706_100000552
600 Ga0070706_100002250
601 Ga0070706_100003818
602 Ga0070706_100024935
603 Ga0070706_100025195
604 Ga0070707_100004077
605 Ga0070707_100052925
606 Ga0070707_100059394
607 Ga0070707_100145739
608 Ga0070707_100163024
609 Ga0070707_100168766
610 Ga0070707_100436804
611 Ga0070698_100002376
612 Ga0070698_100002690
613 Ga0070698_100002742
614 Ga0070698_100006529
615 Ga0070698_100289025
616 Ga0070699_100000370
617 Ga0070699_100017119
618 Ga0070699_100093472
619 Ga0070699_100106924
620 Ga0070699_100667808
621 Ga0070697_100000016
622 Ga0070697_100014014
623 Ga0070697_100194880
624 Ga0070697_100219686
625 Ga0070697_100230796
626 Ga0070697_100278101
627 Ga0070686_100038958
628 Ga0070686_100061416
629 Ga0070695_100180107
630 Ga0070695_100286932
631 Ga0070695_100938902
632 Ga0070693_100159047
633 Ga0070693_100181395
634 Ga0070704_100134010
635 Ga0070704_100141541
636 Ga0070704_100205667
637 Ga0068856_100269805
638 Ga0070702_100004623
639 Ga0068852_100026170
640 Ga0068859_100217696
641 Ga0068866_10007002
642 Ga0068861_100054245
643 Ga0068858_100142418
644 Ga0068860_100349362
645 Ga0068862_100595602
646 Ga0081538_10000887
647 Ga0081538_10020180
648 Ga0081540_1100643
649 Ga0081539_10038229
650 Ga0070717_10104881
651 Ga0070715_10471258
652 Ga0070716_100095034
653 Ga0070716_100219466
654 Ga0070716_100391814
655 Ga0070712_100026281
656 Ga0070712_100255466
657 Ga0070712_100281920
658 Ga0070712_100411608
659 Ga0075367_10069225
660 Ga0097621_100038676
661 Ga0068871_100024923
662 Ga0075428_100261663
663 Ga0075428_100320599
664 Ga0075430_100301328
665 Ga0075431_100678788
666 Ga0075433_10022481
667 Ga0075434_100666194
668 Ga0075434_100774764
669 Ga0075434_100807200
670 Ga0075429_100474943
671 Ga0075436_100063928
672 Ga0097620_100217688
673 Ga0075435_100306849
674 Ga0075435_100350822
675 Ga0075435_100502177
676 Ga0105251_10035458
677 Ga0105245_10067804
678 Ga0105245_10102870
679 Ga0105245_10171349
680 Ga0105247_10096398
681 Ga0105247_10100597
682 Ga0114129_10003282
683 Ga0114129_10084845
684 Ga0114129_10284435
685 Ga0114129_10503201
686 Ga0114129_10834705
687 Ga0114129_10837878
688 Ga0114129_12328872
689 Ga0105243_10006352
690 Ga0105243_10182765
691 Ga0105243_10922732
692 Ga0105241_10066965
693 Ga0105241_10420982
694 Ga0105242_10008423
695 Ga0105248_10157151
696 Ga0105237_11375011
697 Ga0105238_10541562
698 Ga0105249_11166100
699 Ga0099796_10023429
700 Ga0105239_10834335
701 Ga0105246_10199664
702 Ga0105246_10748692
703 Ga0157374_11563812
704 Ga0157378_10056105
705 Ga0163162_10197862
706 Ga0163162_10835631
707 Ga0157372_10489226
708 Ga0157375_10272582
709 Ga0157375_11849022
710 Ga0157380_10185422
711 Ga0182008_10156025
712 Ga0157377_10195728
713 Ga0157379_10012887
714 Ga0157379_10123111
715 Ga0157379_10153304
716 Ga0157379_10253715
717 Ga0157376_10009311
718 Ga0206353_11863289
719 Ga0213876_10116089
720 Ga0213876_10262091
721 Ga0213875_10018706
722 Ga0213875_10148932
723 Ga0207656_10369242
724 Ga0207713_1150154
725 Ga0207653_10034684
726 Ga0207653_10063141
727 Ga0207692_10007246
728 Ga0207642_10074019
729 Ga0207642_10085697
730 Ga0207710_10135592
731 Ga0207710_10199958
732 Ga0207688_10042031
733 Ga0207688_10062965
734 Ga0207688_10222899
735 Ga0207685_10040075
736 Ga0207699_10085348
737 Ga0207643_10064219
738 Ga0207643_10065868
739 Ga0207684_10002278
740 Ga0207684_10020317
741 Ga0207684_10041187
742 Ga0207684_10154582
743 Ga0207654_10156706
744 Ga0207693_10096034
745 Ga0207693_10134156
746 Ga0207663_10018636
747 Ga0207663_10059399
748 Ga0207662_10064462
749 Ga0207646_10003448
750 Ga0207646_10016850
751 Ga0207646_10194590
752 Ga0207646_10337603
753 Ga0207650_10090824
754 Ga0207687_10032774
755 Ga0207687_10081014
756 Ga0207687_10142253
757 Ga0207700_10023762
758 Ga0207700_10075429
759 Ga0207700_10376405
760 Ga0207700_10553384
761 Ga0207664_10007337
762 Ga0207664_10011601
763 Ga0207664_10066792
764 Ga0207664_10171667
765 Ga0207664_10292246
766 Ga0207644_10370998
767 Ga0207644_10645301
768 Ga0207706_10374389
769 Ga0207686_10529884
770 Ga0207709_10049020
771 Ga0207709_10778509
772 Ga0207669_10075690
773 Ga0207669_11074041
774 Ga0207704_10823508
775 Ga0207665_10134045
776 Ga0207665_10249753
777 Ga0207711_11010935
778 Ga0207711_11287267
779 Ga0207689_10098848
780 Ga0207712_10298899
781 Ga0207712_10666910
782 Ga0207668_10000773
783 Ga0207658_10101174
784 Ga0207677_10036388
785 Ga0207677_10050705
786 Ga0207677_10409762
787 Ga0207703_10234164
788 Ga0207639_10212476
789 Ga0207678_10059407
790 Ga0207678_10093910
791 Ga0207708_10016938
792 Ga0207708_10046853
793 Ga0207702_10357332
794 Ga0207648_10115553
795 Ga0207676_10186018
796 Ga0207675_100107711
797 Ga0207683_10008390
798 Ga0207698_10688435
799 Ga0268265_10719778
800 Ga0268265_11366570
801 Ga0268264_10073250
802 Ga0268264_10217511
803 Ga0307410_10819558
804 Ga0307414_10141220
805 Ga0307415_100827847
806 Ga0307507_10000017
807 Ga0373926_0001597
808 Ga0373929_0063946
809 Ga0373934_0008445
810 Ga0373934_0261834
811 Ga0373944_0004417
812 Ga0373951_0049553
813 Ga0373951_0095749
814 Ga0373923_0103051
815 Ga0373936_0019260
816 Ga0373945_0022830
817 Ga0373945_0048441
818 Ga0373945_0077769
819 Ga0373953_0006797
820 Ga0373953_0158265
821 Ga0373954_0267927
822 Ga0373956_0103322
823 Ga0373957_0018035
824 Ga0373957_0080609
825 Ga0373960_0016072
826 Ga0373960_0188291
827 Ga0373943_0000433
828 Ga0373943_0008839
829 Ga0373946_0003551
830 Ga0373946_0007290
831 Ga0373962_0028392
832 Ga0373924_0041087
833 Ga0373924_0120829
834 Ga0373935_0043754
835 Ga0373927_0013304
836 Ga0373927_0051375
837 Ga0373947_0004052
838 Ga0373947_0017692
839 Ga0373947_0090806
840 Ga0373937_0112241
841 Ga0373925_0011456
842 Ga0395900_0204271
843 Ga0395900_0290221
844 Ga0395900_0400793
845 Ga0395900_0505455
846 Ga0395900_0939051
847 Ga0395898_0093928
848 Ga0395898_0519841
849 Ga0395898_0657599
850 Ga0395905_0622713
851 Ga0395905_0809413
852 Ga0436364_0381117
853 Ga0436364_0396546
854 Ga0436364_0841830
855 Ga0436364_1231099
856 Ga0436364_1232393
857 Ga0395901_0010437
858 Ga0395901_0049310
859 Ga0395901_0063215
860 Ga0436365_1210781
861 Ga0436365_1627795
862 Ga0451853_2650434
863 Ga0439463_031856
864 Ga0466969_0019624
865 Ga0466966_0007110
866 Ga0466961_0012478
867 Ga0466961_0013514
868 Ga0466963_0002840
869 Ga0466963_0020711
870 Ga0466971_0003304
871 Ga0466971_0048620
872 Ga0466971_0161967
873 Ga0466968_0057553
874 Ga0466968_0067137
875 Ga0466968_0183315
876 Ga0466970_0052899
877 Ga0466970_0078823
878 Ga0466957_0061156
879 Ga0466957_0147749
880 Ga0466959_0005154
881 Ga0466959_0007236
882 Ga0466959_0016190
883 Ga0466958_0000986
884 Ga0466958_0009977
885 Ga0466958_0014241
886 Ga0466958_0076171
887 Ga0495592_0003761
888 Ga0495592_0049472
889 Ga0495603_0004840
890 Ga0495603_0023342
891 Ga0495603_0205318
892 Ga0495603_0363966
893 Ga0495629_0000079
894 Ga0495629_0006537
895 Ga0495629_0016137
896 Ga0495641_0005325
897 Ga0495641_0018999
898 Ga0495641_0020782
899 Ga0495651_0017579
900 Ga0495651_0054901
901 Ga0495653_0015762
902 Ga0495653_0033840
903 Ga0495580_0002412
904 Ga0495580_0005682
905 Ga0495582_0003393
906 Ga0495582_0009339
907 Ga0495582_0009345
908 Ga0495639_0000500
909 Ga0495639_0001820
910 Ga0495662_0000266
911 Ga0495662_0000357
912 Ga0495662_0010702
913 Ga0495662_0116861
914 Ga0495664_0016677
915 Ga0495664_0040534
916 Ga0495594_0008847
917 Ga0495594_0034540
918 Ga0495594_0143246
919 Ga0495608_0005524
920 Ga0495618_0009989
921 Ga0495618_0376530
922 Ga0495618_0595433
923 Ga0495628_0053510
924 Ga0495628_0076189
925 Ga0495630_0001894
926 Ga0495630_0036434
927 Ga0495630_0079009
928 Ga0495666_0031079
929 Ga0495652_0072907
930 Ga0495652_0073877
931 Ga0495665_0001529
932 Ga0495665_0022828
933 Ga0495640_0011298
934 Ga0495640_0021179
935 Ga0495586_0014832
936 Ga0495586_0033096
937 Ga0495587_0016237
938 Ga0495587_0150653
939 Ga0495645_0044208
940 Ga0495645_0053434
941 Ga0495645_0064712
942 Ga0495667_0007074
943 Ga0495656_0105137
944 Ga0495634_0007366
945 Ga0495634_0031079
946 Ga0495634_0182820
947 Ga0495635_0016001
948 Ga0495635_0019979
949 Ga0495635_0145662
950 Ga0495588_0033763
951 Ga0495657_0042072
952 Ga0495657_0114004
953 Ga0495599_0014823
954 Ga0495599_0022987
955 Ga0495599_0073738
956 Ga0495599_0176609
957 Ga0495623_0015065
958 Ga0495623_0068367
959 Ga0495623_0181005
960 Ga0495646_0036592
961 Ga0495646_0040092
962 Ga0495646_0054743
963 Ga0495647_0003919
964 Ga0495647_0009580
965 Ga0495658_0002080
966 Ga0495658_0011380
967 Ga0495658_0069628
968 Ga0495613_0004092
969 Ga0495613_0005986
970 Ga0495613_0069122
971 Ga0495613_0409498
972 Ga0495624_0007418
973 Ga0495624_0008116
974 Ga0495624_0129700
975 Ga0495600_0020161
976 Ga0495581_0002603
977 Ga0495581_0004661
978 Ga0495604_0005094
979 Ga0495604_0033284
980 Ga0495674_0015777
981 Ga0495674_0041849
982 Ga0495674_0056266
983 Ga0495676_0002367
984 Ga0495676_0009695
985 Ga0495676_0016386
986 Ga0495676_0370824
987 Ga0495680_0002371
988 Ga0495680_0011414
989 Ga0495680_0026557
990 Ga0495675_0079367
991 Ga0495684_0000917
992 Ga0495684_0001955
993 Ga0495684_0017532
994 Ga0495684_0104859
995 Ga0495593_0000862
996 Ga0495593_0009147
997 Ga0495602_0012960
998 Ga0495602_0018501
999 Ga0495602_0225960
1000 Ga0495614_0002807
1001 Ga0495614_0010376
1002 Ga0495614_0234486
1003 Ga0495626_0027668
1004 Ga0496100_0005946
1005 Ga0496100_0554796
1006 Ga0496100_0675015
1007 Ga0496101_0002935
1008 Ga0496101_0052002
1009 Ga0496101_0340549
1010 Ga0496101_0557777
1011 Ga0496102_0008433
1012 Ga0496102_0584572
1013 Ga0496103_0081748
1014 Ga0496103_0299007
1015 Ga0496103_0377061
1016 Ga0496104_0002772
1017 Ga0496105_0049142
1018 Ga0496105_0351121
1019 Ga0496105_0507061
1020 Ga0496106_0005898
1021 Ga0496106_0120487
1022 Ga0496107_0007964
1023 Ga0496108_0072763
1024 Ga0496108_0188834
1025 Ga0496109_0125645
1026 Ga0496109_0136824
1027 Ga0496109_0148150
1028 Ga0496110_0051913
1029 Ga0496110_0183592
1030 Ga0496110_0247697
1031 Ga0496111_0067396
1032 Ga0496112_0137763
1033 Ga0496112_0181050
1034 Ga0496112_1143615
1035 Ga0496113_0150382
1036 Ga0496113_0301697
1037 Ga0496114_0013358
1038 Ga0496114_0027986
1039 Ga0496114_0124376
1040 Ga0496114_0812244
1041 Ga0496115_0003019
1042 Ga0496115_0033458
1043 Ga0501031_0188568
1044 Ga0501032_0048070
1045 Ga0501033_0035433
1046 Ga0501033_0413699
1047 Ga0501034_0018452
1048 Ga0501036_0098797
1049 Ga0501036_0232826
1050 Ga0501036_1151866
1051 Ga0501037_0138901
1052 Ga0501038_0117907
1053 Ga0501038_0210083
1054 Ga0501039_0267142
1055 Ga0501040_0000355
1056 Ga0501040_0691514
1057 Ga0501041_0061291
1058 Ga0501041_0174638
1059 Ga0501042_0061264
1060 Ga0501042_0228054
1061 Ga0501043_0576398
1062 Ga0501046_0020166
1063 Ga0501046_0169041
1064 Ga0501048_0529178
1065 Ga0501067_0023853
1066 Ga0501068_0002915
1067 Ga0501068_0500735
1068 Ga0501071_0307437
1069 Ga0501071_0417313
1070 Ga0501072_0331034
1071 Ga0501073_0062329
1072 Ga0501075_0002312
1073 Ga0501075_0100931
1074 Ga0501076_0001306
1075 Ga0501076_0074516
1076 Ga0501077_0179269
1077 Ga0501077_0235213
1078 Ga0501079_0016236
1079 Ga0501079_0216632
1080 Ga0501081_0231891
1081 Ga0501083_0038603
1082 Ga0501035_0123770
1083 Ga0501035_0218704
1084 Ga0501044_0417314
1085 Ga0501044_0780399
1086 Ga0501045_0072140
1087 Ga0501045_0106726
1088 Ga0501045_0240862
1089 nmdc:mga05p37_1266527_c1
1090 nmdc:mga05p37_1282663_c1
1091 nmdc:mga05p37_364780_c1
1092 nmdc:mga05p37_703878_c1
1093 nmdc:mga0qj67_556732_c1
1094 nmdc:mga0n895_1037139_c1
1095 Ga0495601_0007706
1096 Ga0495601_0051359
1097 Ga0495601_0383143
1098 Ga0495612_0013322
1099 Ga0495612_0181165
1100 Ga0495619_0001098
1101 Ga0495619_0001469
1102 Ga0495619_0006173
1103 Ga0501084_0002037
1104 Ga0501082_0282950
1105 Ga0466962_0001997
1106 Ga0466962_0015757
1107 Ga0530510_0202554
1108 Ga0530510_0241946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

50

231

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8266 1 185
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8181 1 185
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8137 3 187
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8129 3 187
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8048 3 187
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8314 3 184 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8217 3 184 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8074 3 190 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7978 1 187 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7946 3 190 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A538J2D1-F1-model_v4 Dihydrofolate reductase 0.9646 30 189 GO:0008703
GO:0009231
AF-A0A538J2D1-F1-model_v4 Dihydrofolate reductase 0.9587 30 189 GO:0008703
GO:0009231
AF-A0A3N5K9Y5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9492 50 188 GO:0008703
GO:0009231
AF-A0A5M3XEI8-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9444 1 188 GO:0008703
GO:0009231
AF-A0A7M2SKC3-F1-model_v4 Dihydrofolate reductase family protein 0.9408 38 187 GO:0008703
GO:0009231

Map