F462887

General Info

Members Datasets Scaffolds Average Seq Length
553 200 533 329

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0325648|Ga0395905_0325648_346_1254
Length 302
Sequence LGADSVRALALSAIEAGQSLRQRVEAQGFGAAVDLKAALAEGRVLPPVDHPDDAHVLVAGTGLTHLGSAEGRDKMHKDLADPAKMTDSMKMFRMGLEGGRPAPGREGVQPEWFYKGDGSTVIAPGAPLPSPSFALDAGEEPEIAGLYVNGPDGTPHRIGFALGNEFSDHVTERQNYLYLAHSKLRASAIGPELLVGDLPPDVRGTSRIIRGGEVVWEKPFLTGEANMSHTVANLEGHHFKYALFRRPGDVNIHYFGTATLSVSDGFKTLEGDIFEIAADAFGLPLSNPIGSVAAPWPVVKAL

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221684 Massilia sp. Root133 Isolate Unclassified
5 2738541297 Duganella sp. GV083 Isolate Unclassified
6 2738541357 Duganella sp. GV053 Isolate Unclassified
7 2738543003 Duganella sp. GV066 Isolate Unclassified
8 2738543026 Duganella sp. GV089 Isolate Unclassified
9 2738543029 Duganella sp. GV039 Isolate Unclassified
10 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
11 2821131069 Duganella sp. 1224 Isolate Unclassified
12 2842711865 Duganella sp. R-73148 Isolate Unclassified
13 2857553236 Duganella sp. R-74557 Isolate Unclassified
14 2857558681 Duganella sp. R-74565 Isolate Unclassified
15 2857564685 Duganella sp. R-74599 Isolate Unclassified
16 2904424332 Duganella sp. 1411 Isolate Rhizosphere
17 2919476304 Duganella sp. 3397 Isolate Unclassified
18 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
19 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
20 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
26 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
85 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
96 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
192 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
193 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
194 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
198 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
199 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0.36
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 0.54
Rhizoplane 1.99
Rhizosphere 78.3
Stem 0
Stem Tuber 0
Unclassified 6.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1003928 3300002739 Bacteria 2254
2 JGI25152J39213_1000026 3300002773 Bacteria 101759
3 JGI25150J39212_1000478 3300002774 Bacteria 16992
4 JGI25159J45721_1004244 3300002987 Bacteria 4823
5 JGI25159J45721_1009926 3300002987 Bacteria 2472
6 JGI25153J46596_10011364 3300003215 Bacteria 3939
7 JGI25161J50226_1000886 3300003374 Bacteria 10945
8 JGI25161J50226_1004983 3300003374 Bacteria 2678
9 Ga0007409J51694_1018609 3300003575 Bacteria 3124
10 Ga0055525_1000006 3300003759 Bacteria 642912
11 Ga0055529_1000032 3300003763 Bacteria 255895
12 Ga0055526_1000018 3300003771 Bacteria 198838
13 Ga0055526_1000445 3300003771 Bacteria 32889
14 Ga0055526_1001212 3300003771 Bacteria 18573
15 Ga0055526_1014640 3300003771 Bacteria 3208
16 Ga0055537_1000027 3300003773 Bacteria 102244
17 Ga0055537_1010865 3300003773 Bacteria 1888
18 Ga0055524_1000297 3300003775 Bacteria 47728
19 Ga0055524_1002730 3300003775 Bacteria 8915
20 Ga0055524_1002925 3300003775 Bacteria 8521
21 Ga0055524_1003992 3300003775 Bacteria 6961
22 Ga0055534_1000051 3300003784 Bacteria 92183
23 Ga0055534_1003639 3300003784 Bacteria 4779
24 Ga0055528_1000731 3300003790 Bacteria 23155
25 Ga0055530_10001347 3300003791 Bacteria 18338
26 Ga0055530_10038449 3300003791 Bacteria 1189
27 Ga0055531_10019181 3300003794 Bacteria 2782
28 Ga0055543_1000103 3300004625 Bacteria 73828
29 Ga0065165_1001082 3300005262 Bacteria 32470
30 Ga0065165_1001148 3300005262 Bacteria 30990
31 Ga0070661_100039302 3300005344 Bacteria 3448
32 Ga0070664_100051148 3300005564 Bacteria 3498
33 Ga0068856_100576147 3300005614 Bacteria 1147
34 Ga0068852_100257146 3300005616 Bacteria 1675
35 Ga0068865_100059923 3300006881 Bacteria 2664
36 Ga0079104_1011061 3300006946 Bacteria 2927
37 Ga0099826_10000001 3300006948 Bacteria 1155201
38 Ga0105244_10001201 3300009036 Bacteria 21301
39 Ga0105244_10003881 3300009036 Bacteria 10515
40 Ga0105245_10242721 3300009098 Bacteria 1747
41 Ga0105243_10011176 3300009148 Bacteria 6791
42 Ga0105241_10008838 3300009174 Bacteria 7405
43 Ga0105242_10043677 3300009176 Bacteria 3626
44 Ga0105239_10127305 3300010375 Bacteria 2831
45 Ga0157371_10000014 3300013102 Bacteria 347490
46 Ga0157378_10427726 3300013297 Bacteria 1310
47 Ga0182006_1000040 3300015261 Bacteria 209209
48 Ga0182005_1000051 3300015265 Bacteria 114808
49 Ga0213872_10000040 3300021361 Bacteria 122419
50 Ga0209436_101815 3300025208 Bacteria 6923
51 Ga0209436_103379 3300025208 Bacteria 4274
52 Ga0209563_100022 3300025230 Bacteria 643318
53 Ga0207425_1000017 3300025245 Bacteria 423851
54 Ga0207425_1000085 3300025245 Bacteria 95577
55 Ga0207425_1000326 3300025245 Bacteria 33697
56 Ga0207425_1000347 3300025245 Bacteria 32216
57 Ga0209646_1000051 3300025246 Bacteria 296525
58 Ga0209677_103912 3300025253 Bacteria 4549
59 Ga0209148_1000678 3300025254 Bacteria 28482
60 Ga0209129_1000162 3300025258 Bacteria 101248
61 Ga0209565_1000017 3300025263 Bacteria 462438
62 Ga0209565_1000452 3300025263 Bacteria 31667
63 Ga0209565_1006037 3300025263 Bacteria 3452
64 Ga0209455_1000043 3300025272 Bacteria 413928
65 Ga0209673_1000007 3300025273 Bacteria 634477
66 Ga0209130_1000078 3300025284 Bacteria 169374
67 Ga0209130_1000188 3300025284 Bacteria 86963
68 Ga0209675_1000009 3300025291 Bacteria 562872
69 Ga0209675_1005478 3300025291 Bacteria 5307
70 Ga0209675_1010389 3300025291 Bacteria 3183
71 Ga0209025_1001273 3300025294 Bacteria 34682
72 Ga0209564_1000011 3300025295 Bacteria 822327
73 Ga0209564_1000036 3300025295 Bacteria 423455
74 Ga0209564_1000055 3300025295 Bacteria 343782
75 Ga0209564_1000068 3300025295 Bacteria 311171
76 Ga0209564_1000343 3300025295 Bacteria 89036
77 Ga0209564_1002854 3300025295 Bacteria 12705
78 Ga0209564_1004142 3300025295 Bacteria 9092
79 Ga0209758_1000250 3300025297 Bacteria 109992
80 Ga0209758_1001409 3300025297 Bacteria 28501
81 Ga0209050_1000316 3300025298 Bacteria 98257
82 Ga0209050_1000612 3300025298 Bacteria 56207
83 Ga0209050_1001484 3300025298 Bacteria 24939
84 Ga0209256_1000167 3300025299 Bacteria 133419
85 Ga0209256_1000184 3300025299 Bacteria 121336
86 Ga0209256_1000841 3300025299 Bacteria 38507
87 Ga0209256_1003010 3300025299 Bacteria 12470
88 Ga0207426_1024022 3300025302 Bacteria 2073
89 Ga0209257_1000123 3300025304 Bacteria 219092
90 Ga0207655_1004932 3300025728 Bacteria 9259
91 Ga0207655_1008847 3300025728 Bacteria 6329
92 Ga0207705_10082021 3300025909 Bacteria 2351
93 Ga0207654_10007226 3300025911 Bacteria 5595
94 Ga0207657_10221869 3300025919 Bacteria 1514
95 Ga0207690_10121924 3300025932 Bacteria 1895
96 Ga0207706_10036350 3300025933 Bacteria 4374
97 Ga0207709_10015451 3300025935 Bacteria 4233
98 Ga0207678_10041031 3300026067 Bacteria 4012
99 Ga0207698_10151323 3300026142 Bacteria 2014
100 Ga0209282_1000001 3300027666 Bacteria 2450367
101 Ga0316181_1078105 3300030744 Bacteria 2866
102 Ga0307408_100000092 3300031548 Bacteria 98953
103 Ga0307408_100001578 3300031548 Bacteria 16829
104 Ga0307408_100003582 3300031548 Bacteria 10582
105 Ga0307408_100005970 3300031548 Bacteria 8110
106 Ga0307408_100009216 3300031548 Bacteria 6508
107 Ga0307518_10094823 3300031838 Bacteria 2143
108 Ga0395899_0000293 3300037312 Bacteria 64438
109 Ga0395899_0090053 3300037312 Bacteria 2224
110 Ga0395900_0000202 3300037418 Bacteria 93773
111 Ga0395900_0028193 3300037418 Bacteria 5751
112 Ga0395900_0217451 3300037418 Bacteria 1927
113 Ga0395900_0297742 3300037418 Bacteria 1600
114 Ga0395898_0029352 3300037466 Bacteria 5510
115 Ga0395898_0227117 3300037466 Bacteria 1780
116 Ga0395898_0227397 3300037466 Bacteria 1779
117 Ga0395905_0222002 3300037471 Bacteria 1768
118 Ga0395905_0325648 3300037471 Bacteria 1427
119 Ga0395901_0000019 3300038443 Bacteria 317063
120 Ga0395901_0150596 3300038443 Bacteria 2444
121 Ga0395901_0258533 3300038443 Bacteria 1813
122 Ga0395901_0369125 3300038443 Bacteria 1478
123 Ga0436360_1167795 3300039438 Bacteria 1521
124 Ga0436360_1230647 3300039438 Bacteria 2999
125 Ga0436361_0748526 3300039447 Bacteria 34472
126 Ga0436361_1063317 3300039447 Bacteria 2281
127 Ga0439465_0071441 3300041413 Bacteria 1164
128 Ga0439448_0015869 3300042005 Bacteria 2286
129 Ga0466972_0000072 3300044658 Bacteria 98587
130 Ga0466972_0005351 3300044658 Bacteria 6429
131 Ga0466965_0046623 3300044683 Bacteria 2145
132 Ga0466965_0051607 3300044683 Bacteria 2040
133 Ga0466966_0045728 3300044684 Bacteria 2797
134 Ga0466966_0049500 3300044684 Bacteria 2677
135 Ga0466966_0096352 3300044684 Bacteria 1832
136 Ga0466966_0155619 3300044684 Bacteria 1392
137 Ga0466963_0075452 3300044694 Bacteria 2275
138 Ga0466964_0007753 3300044706 Bacteria 4017
139 Ga0466964_0030463 3300044706 Bacteria 2135
140 Ga0466964_0060121 3300044706 Bacteria 1579
141 Ga0466964_0088628 3300044706 Bacteria 1342
142 Ga0466968_0000207 3300044735 Bacteria 18092
143 Ga0466968_0007718 3300044735 Bacteria 4097
144 Ga0466957_0014693 3300044842 Bacteria 4561
145 Ga0466957_0036871 3300044842 Bacteria 2941
146 Ga0466957_0099124 3300044842 Bacteria 1834
147 Ga0466960_0070500 3300044901 Bacteria 1739
148 Ga0466959_0039802 3300045049 Bacteria 3474
149 Ga0466958_0023150 3300045836 Bacteria 3643
150 Ga0466967_0028983 3300045976 Bacteria 4628
151 Ga0495617_000003 3300046452 Bacteria 541914
152 Ga0495617_000208 3300046452 Bacteria 36937
153 Ga0495617_008747 3300046452 Bacteria 3485
154 Ga0495627_000008 3300046453 Bacteria 572150
155 Ga0495590_0000001 3300046457 Bacteria 762984
156 Ga0495590_0001769 3300046457 Bacteria 9174
157 Ga0495590_0020432 3300046457 Bacteria 2353
158 Ga0495590_0080098 3300046457 Bacteria 1150
159 Ga0495638_0000017 3300046460 Bacteria 391117
160 Ga0495638_0005173 3300046460 Bacteria 9756
161 Ga0495638_0017751 3300046460 Bacteria 4738
162 Ga0495638_0020287 3300046460 Bacteria 4391
163 Ga0495638_0021299 3300046460 Bacteria 4274
164 Ga0495638_0023355 3300046460 Bacteria 4045
165 Ga0495638_0101706 3300046460 Bacteria 1718
166 Ga0495653_0000002 3300046463 Bacteria 507262
167 Ga0495653_0019967 3300046463 Bacteria 5431
168 Ga0495653_0042554 3300046463 Bacteria 3536
169 Ga0495650_0000001 3300046471 Bacteria 1085492
170 Ga0495650_0000072 3300046471 Bacteria 257886
171 Ga0495650_0000267 3300046471 Bacteria 100234
172 Ga0495650_0000344 3300046471 Bacteria 83050
173 Ga0495650_0000427 3300046471 Bacteria 68283
174 Ga0495650_0001400 3300046471 Bacteria 23592
175 Ga0495650_0012501 3300046471 Bacteria 4563
176 Ga0495582_0046530 3300046473 Bacteria 2389
177 Ga0495605_0000065 3300046474 Bacteria 139441
178 Ga0495605_0000103 3300046474 Bacteria 105879
179 Ga0495605_0002266 3300046474 Bacteria 12011
180 Ga0495605_0006806 3300046474 Bacteria 6530
181 Ga0495605_0027182 3300046474 Bacteria 2966
182 Ga0495605_0033785 3300046474 Bacteria 2594
183 Ga0495605_0041364 3300046474 Bacteria 2296
184 Ga0495605_0061233 3300046474 Bacteria 1802
185 Ga0495605_0070653 3300046474 Bacteria 1650
186 Ga0495584_0000009 3300046491 Bacteria 236318
187 Ga0495584_0000057 3300046491 Bacteria 81182
188 Ga0495584_0000182 3300046491 Bacteria 44393
189 Ga0495584_0000904 3300046491 Bacteria 18948
190 Ga0495584_0001765 3300046491 Bacteria 12597
191 Ga0495584_0002700 3300046491 Bacteria 9971
192 Ga0495584_0004270 3300046491 Bacteria 7702
193 Ga0495584_0008823 3300046491 Bacteria 5212
194 Ga0495584_0015054 3300046491 Bacteria 3942
195 Ga0495584_0028660 3300046491 Bacteria 2822
196 Ga0495585_0000077 3300046492 Bacteria 100338
197 Ga0495585_0000094 3300046492 Bacteria 94735
198 Ga0495585_0000154 3300046492 Bacteria 73681
199 Ga0495585_0000940 3300046492 Bacteria 24573
200 Ga0495585_0001952 3300046492 Bacteria 15409
201 Ga0495585_0002583 3300046492 Bacteria 12807
202 Ga0495585_0007860 3300046492 Bacteria 6488
203 Ga0495585_0024507 3300046492 Bacteria 3459
204 Ga0495585_0057018 3300046492 Bacteria 2156
205 Ga0495585_0082081 3300046492 Bacteria 1745
206 Ga0495596_0000961 3300046500 Bacteria 17168
207 Ga0495596_0009123 3300046500 Bacteria 4379
208 Ga0495596_0012041 3300046500 Bacteria 3712
209 Ga0495596_0037712 3300046500 Bacteria 1910
210 Ga0495596_0038677 3300046500 Bacteria 1885
211 Ga0495596_0062218 3300046500 Bacteria 1453
212 Ga0495607_0002416 3300046501 Bacteria 15240
213 Ga0495607_0002798 3300046501 Bacteria 13876
214 Ga0495607_0010564 3300046501 Bacteria 6199
215 Ga0495607_0011987 3300046501 Bacteria 5738
216 Ga0495607_0012148 3300046501 Bacteria 5693
217 Ga0495607_0028843 3300046501 Bacteria 3418
218 Ga0495607_0038103 3300046501 Bacteria 2882
219 Ga0495607_0054462 3300046501 Bacteria 2305
220 Ga0495607_0060614 3300046501 Bacteria 2153
221 Ga0495607_0065407 3300046501 Bacteria 2050
222 Ga0495607_0087401 3300046501 Bacteria 1696
223 Ga0495583_0000008 3300046506 Bacteria 411092
224 Ga0495583_0000050 3300046506 Bacteria 213627
225 Ga0495583_0000064 3300046506 Bacteria 192380
226 Ga0495583_0000067 3300046506 Bacteria 189381
227 Ga0495583_0000250 3300046506 Bacteria 88815
228 Ga0495583_0000253 3300046506 Bacteria 88398
229 Ga0495583_0000485 3300046506 Bacteria 58196
230 Ga0495583_0002249 3300046506 Bacteria 16985
231 Ga0495583_0019755 3300046506 Bacteria 3508
232 Ga0495583_0025861 3300046506 Bacteria 2923
233 Ga0495583_0030893 3300046506 Bacteria 2603
234 Ga0495583_0048389 3300046506 Bacteria 1951
235 Ga0495583_0091100 3300046506 Bacteria 1312
236 Ga0495606_0000001 3300046507 Bacteria 592123
237 Ga0495606_0000030 3300046507 Bacteria 249484
238 Ga0495606_0000282 3300046507 Bacteria 88450
239 Ga0495606_0018842 3300046507 Bacteria 5161
240 Ga0495606_0030636 3300046507 Bacteria 3755
241 Ga0495606_0035060 3300046507 Bacteria 3435
242 Ga0495606_0045077 3300046507 Bacteria 2926
243 Ga0495606_0050770 3300046507 Bacteria 2710
244 Ga0495606_0057289 3300046507 Bacteria 2510
245 Ga0495606_0057510 3300046507 Bacteria 2504
246 Ga0495606_0093851 3300046507 Bacteria 1840
247 Ga0495606_0133882 3300046507 Bacteria 1470
248 Ga0495610_0000003 3300046512 Bacteria 1203910
249 Ga0495610_0001826 3300046512 Bacteria 18503
250 Ga0495610_0005555 3300046512 Bacteria 8922
251 Ga0495610_0011630 3300046512 Bacteria 5363
252 Ga0495610_0020310 3300046512 Bacteria 3690
253 Ga0495610_0112087 3300046512 Bacteria 1207
254 Ga0495616_0000924 3300046513 Bacteria 21120
255 Ga0495616_0001100 3300046513 Bacteria 19247
256 Ga0495616_0002444 3300046513 Bacteria 12326
257 Ga0495616_0005518 3300046513 Bacteria 7773
258 Ga0495616_0011725 3300046513 Bacteria 5009
259 Ga0495616_0012575 3300046513 Bacteria 4798
260 Ga0495616_0013364 3300046513 Bacteria 4632
261 Ga0495616_0021407 3300046513 Bacteria 3502
262 Ga0495616_0040240 3300046513 Bacteria 2389
263 Ga0495616_0053341 3300046513 Bacteria 2009
264 Ga0495616_0092110 3300046513 Bacteria 1433
265 Ga0495620_0019918 3300046515 Bacteria 3286
266 Ga0495631_0000214 3300046518 Bacteria 39867
267 Ga0495631_0012700 3300046518 Bacteria 4105
268 Ga0495631_0019176 3300046518 Bacteria 3210
269 Ga0495631_0051537 3300046518 Bacteria 1798
270 Ga0495631_0057036 3300046518 Bacteria 1700
271 Ga0495631_0062284 3300046518 Bacteria 1616
272 Ga0495632_0000151 3300046519 Bacteria 71855
273 Ga0495632_0003007 3300046519 Bacteria 12305
274 Ga0495632_0026713 3300046519 Bacteria 3034
275 Ga0495632_0051765 3300046519 Bacteria 2020
276 Ga0495632_0058582 3300046519 Bacteria 1876
277 Ga0495637_0000042 3300046520 Bacteria 114979
278 Ga0495643_0000028 3300046522 Bacteria 262886
279 Ga0495643_0000285 3300046522 Bacteria 72233
280 Ga0495643_0002751 3300046522 Bacteria 13492
281 Ga0495643_0015685 3300046522 Bacteria 4469
282 Ga0495643_0015776 3300046522 Bacteria 4456
283 Ga0495643_0052974 3300046522 Bacteria 2177
284 Ga0495644_0002436 3300046523 Bacteria 7425
285 Ga0495644_0002963 3300046523 Bacteria 6734
286 Ga0495644_0004943 3300046523 Bacteria 5233
287 Ga0495644_0010462 3300046523 Bacteria 3576
288 Ga0495644_0018077 3300046523 Bacteria 2692
289 Ga0495648_0000001 3300046524 Bacteria 696872
290 Ga0495648_0000079 3300046524 Bacteria 126099
291 Ga0495648_0001359 3300046524 Bacteria 24164
292 Ga0495648_0002750 3300046524 Bacteria 15879
293 Ga0495648_0003215 3300046524 Bacteria 14496
294 Ga0495648_0014566 3300046524 Bacteria 5748
295 Ga0495648_0014982 3300046524 Bacteria 5647
296 Ga0495648_0022727 3300046524 Bacteria 4309
297 Ga0495648_0028372 3300046524 Bacteria 3729
298 Ga0495648_0042340 3300046524 Bacteria 2866
299 Ga0495648_0055139 3300046524 Bacteria 2397
300 Ga0495663_0006483 3300046525 Bacteria 3231
301 Ga0495666_0011013 3300046526 Bacteria 4511
302 Ga0495642_0003301 3300046528 Bacteria 6376
303 Ga0495642_0005123 3300046528 Bacteria 5044
304 Ga0495642_0005946 3300046528 Bacteria 4682
305 Ga0495642_0023913 3300046528 Bacteria 2415
306 Ga0495642_0037924 3300046528 Bacteria 1951
307 Ga0495642_0088514 3300046528 Bacteria 1309
308 Ga0495652_0028471 3300046529 Bacteria 4915
309 Ga0495654_0000037 3300046530 Bacteria 188218
310 Ga0495654_0040533 3300046530 Bacteria 2320
311 Ga0495654_0060273 3300046530 Bacteria 1824
312 Ga0495665_0024664 3300046531 Bacteria 3230
313 Ga0495665_0044440 3300046531 Bacteria 2360
314 Ga0495587_0121870 3300046536 Bacteria 1493
315 Ga0495609_0000026 3300046538 Bacteria 251973
316 Ga0495609_0000241 3300046538 Bacteria 52185
317 Ga0495609_0001046 3300046538 Bacteria 19408
318 Ga0495609_0001294 3300046538 Bacteria 17071
319 Ga0495609_0001330 3300046538 Bacteria 16776
320 Ga0495609_0001851 3300046538 Bacteria 13510
321 Ga0495609_0007727 3300046538 Bacteria 5329
322 Ga0495609_0018057 3300046538 Bacteria 3272
323 Ga0495609_0036406 3300046538 Bacteria 2222
324 Ga0495609_0041751 3300046538 Bacteria 2060
325 Ga0495609_0062144 3300046538 Bacteria 1649
326 Ga0495597_0000056 3300046542 Bacteria 95149
327 Ga0495597_0000705 3300046542 Bacteria 26750
328 Ga0495597_0000864 3300046542 Bacteria 23742
329 Ga0495597_0001532 3300046542 Bacteria 16422
330 Ga0495597_0006593 3300046542 Bacteria 5987
331 Ga0495597_0006628 3300046542 Bacteria 5968
332 Ga0495597_0007484 3300046542 Bacteria 5539
333 Ga0495597_0016163 3300046542 Bacteria 3528
334 Ga0495597_0046928 3300046542 Bacteria 1913
335 Ga0495622_0000131 3300046557 Bacteria 64280
336 Ga0495633_0000055 3300046558 Bacteria 151013
337 Ga0495633_0000106 3300046558 Bacteria 113381
338 Ga0495633_0001613 3300046558 Bacteria 17048
339 Ga0495633_0003359 3300046558 Bacteria 10734
340 Ga0495633_0017106 3300046558 Bacteria 3717
341 Ga0495633_0029947 3300046558 Bacteria 2646
342 Ga0495633_0095094 3300046558 Bacteria 1384
343 Ga0495656_0005067 3300046615 Bacteria 4542
344 Ga0495656_0040201 3300046615 Bacteria 1948
345 Ga0495656_0042855 3300046615 Bacteria 1897
346 Ga0495656_0074243 3300046615 Bacteria 1518
347 Ga0495656_0078987 3300046615 Bacteria 1480
348 Ga0495668_0000018 3300046616 Bacteria 417480
349 Ga0495668_0000190 3300046616 Bacteria 91473
350 Ga0495668_0001065 3300046616 Bacteria 29015
351 Ga0495668_0001873 3300046616 Bacteria 18839
352 Ga0495668_0002041 3300046616 Bacteria 17578
353 Ga0495668_0002146 3300046616 Bacteria 16984
354 Ga0495668_0006520 3300046616 Bacteria 7632
355 Ga0495668_0035836 3300046616 Bacteria 2780
356 Ga0495668_0041656 3300046616 Bacteria 2557
357 Ga0495668_0193873 3300046616 Bacteria 1113
358 Ga0495634_0071936 3300046642 Bacteria 2275
359 Ga0495611_0000151 3300046648 Bacteria 49625
360 Ga0495611_0002359 3300046648 Bacteria 8694
361 Ga0495611_0011731 3300046648 Bacteria 3717
362 Ga0495625_0000035 3300046660 Bacteria 224323
363 Ga0495625_0000391 3300046660 Bacteria 66888
364 Ga0495625_0002897 3300046660 Bacteria 17926
365 Ga0495625_0004167 3300046660 Bacteria 13781
366 Ga0495625_0007248 3300046660 Bacteria 9703
367 Ga0495625_0007938 3300046660 Bacteria 9122
368 Ga0495625_0020170 3300046660 Bacteria 5151
369 Ga0495625_0091623 3300046660 Bacteria 2101
370 Ga0495661_0000152 3300046665 Bacteria 81192
371 Ga0495661_0000715 3300046665 Bacteria 32660
372 Ga0495661_0008169 3300046665 Bacteria 7257
373 Ga0495661_0039547 3300046665 Bacteria 2930
374 Ga0495661_0040312 3300046665 Bacteria 2897
375 Ga0495661_0041699 3300046665 Bacteria 2837
376 Ga0495661_0051554 3300046665 Bacteria 2484
377 Ga0495661_0186036 3300046665 Bacteria 1097
378 Ga0495588_0000139 3300046674 Bacteria 109955
379 Ga0495599_0193189 3300046678 Bacteria 1252
380 Ga0495623_0039508 3300046679 Bacteria 3015
381 Ga0495623_0093049 3300046679 Bacteria 1846
382 Ga0495646_0050462 3300046680 Bacteria 2522
383 Ga0495669_0008861 3300046684 Bacteria 4239
384 Ga0495669_0024761 3300046684 Bacteria 2614
385 Ga0495669_0034607 3300046684 Bacteria 2227
386 Ga0495669_0059457 3300046684 Bacteria 1726
387 Ga0495670_0000513 3300046691 Bacteria 18250
388 Ga0495670_0031688 3300046691 Bacteria 2627
389 Ga0495670_0054252 3300046691 Bacteria 2007
390 Ga0495670_0062515 3300046691 Bacteria 1873
391 Ga0495670_0088109 3300046691 Bacteria 1586
392 Ga0495671_0000010 3300046692 Bacteria 368641
393 Ga0495671_0003853 3300046692 Bacteria 9116
394 Ga0495671_0004731 3300046692 Bacteria 8044
395 Ga0495671_0020732 3300046692 Bacteria 3461
396 Ga0495671_0037809 3300046692 Bacteria 2440
397 Ga0495649_0011975 3300046694 Bacteria 5066
398 Ga0495649_0015437 3300046694 Bacteria 4347
399 Ga0495649_0016169 3300046694 Bacteria 4233
400 Ga0495589_0000045 3300046794 Bacteria 123922
401 Ga0495589_0000100 3300046794 Bacteria 83307
402 Ga0495589_0000101 3300046794 Bacteria 82583
403 Ga0495589_0014427 3300046794 Bacteria 4069
404 Ga0495589_0023533 3300046794 Bacteria 3138
405 Ga0495589_0029595 3300046794 Bacteria 2761
406 Ga0495660_0000027 3300046810 Bacteria 254331
407 Ga0495660_0000335 3300046810 Bacteria 41632
408 Ga0495660_0000555 3300046810 Bacteria 30632
409 Ga0495660_0007649 3300046810 Bacteria 6346
410 Ga0495660_0015261 3300046810 Bacteria 4438
411 Ga0495660_0015437 3300046810 Bacteria 4412
412 Ga0495660_0020381 3300046810 Bacteria 3800
413 Ga0495660_0021709 3300046810 Bacteria 3672
414 Ga0495660_0031740 3300046810 Bacteria 2969
415 Ga0495660_0054308 3300046810 Bacteria 2170
416 Ga0495660_0097256 3300046810 Bacteria 1520
417 Ga0495581_0092627 3300047315 Bacteria 1754
418 Ga0495604_0060169 3300047317 Bacteria 2909
419 Ga0495636_0000169 3300047318 Bacteria 26280
420 Ga0495636_0042664 3300047318 Bacteria 1885
421 Ga0495672_0000127 3300047320 Bacteria 117475
422 Ga0495672_0002015 3300047320 Bacteria 19155
423 Ga0495672_0002441 3300047320 Bacteria 17100
424 Ga0495672_0002622 3300047320 Bacteria 16258
425 Ga0495672_0020028 3300047320 Bacteria 4395
426 Ga0495672_0043110 3300047320 Bacteria 2715
427 Ga0495676_0083159 3300047321 Bacteria 2420
428 Ga0495683_0000064 3300047323 Bacteria 112558
429 Ga0495683_0000498 3300047323 Bacteria 30337
430 Ga0495683_0015275 3300047323 Bacteria 3997
431 Ga0495683_0034198 3300047323 Bacteria 2585
432 Ga0495683_0036509 3300047323 Bacteria 2493
433 Ga0495683_0041784 3300047323 Bacteria 2313
434 Ga0495683_0044945 3300047323 Bacteria 2220
435 Ga0495687_000037 3300047443 Bacteria 252363
436 Ga0495687_000062 3300047443 Bacteria 176135
437 Ga0495687_000122 3300047443 Bacteria 119372
438 Ga0495687_001241 3300047443 Bacteria 24342
439 Ga0495687_001859 3300047443 Bacteria 18393
440 Ga0495687_002590 3300047443 Bacteria 14240
441 Ga0495687_011036 3300047443 Bacteria 4891
442 Ga0495687_076340 3300047443 Bacteria 1326
443 Ga0495675_0017159 3300047444 Bacteria 4584
444 Ga0495675_0062981 3300047444 Bacteria 2347
445 Ga0495677_0000014 3300047445 Bacteria 136236
446 Ga0495677_0002033 3300047445 Bacteria 8070
447 Ga0495677_0002363 3300047445 Bacteria 7413
448 Ga0495677_0006994 3300047445 Bacteria 4229
449 Ga0495677_0019243 3300047445 Bacteria 2476
450 Ga0495677_0033972 3300047445 Bacteria 1860
451 Ga0495679_000603 3300047446 Bacteria 24373
452 Ga0495679_006022 3300047446 Bacteria 5298
453 Ga0495679_006467 3300047446 Bacteria 5038
454 Ga0495679_041789 3300047446 Bacteria 1417
455 Ga0495685_000011 3300047447 Bacteria 83484
456 Ga0495685_000262 3300047447 Bacteria 18174
457 Ga0495685_001458 3300047447 Bacteria 7246
458 Ga0495685_014337 3300047447 Bacteria 2692
459 Ga0495673_0000003 3300047469 Bacteria 1491337
460 Ga0495673_0000016 3300047469 Bacteria 580643
461 Ga0495673_0004771 3300047469 Bacteria 8395
462 Ga0495673_0006851 3300047469 Bacteria 6644
463 Ga0495681_0000021 3300047470 Bacteria 166534
464 Ga0495681_0012652 3300047470 Bacteria 4944
465 Ga0495681_0029160 3300047470 Bacteria 2828
466 Ga0495681_0043803 3300047470 Bacteria 2155
467 Ga0495681_0050544 3300047470 Bacteria 1959
468 Ga0495681_0066072 3300047470 Bacteria 1651
469 Ga0495681_0067202 3300047470 Bacteria 1634
470 Ga0495686_0000047 3300047472 Bacteria 280086
471 Ga0495686_0022915 3300047472 Bacteria 4126
472 Ga0495686_0087568 3300047472 Bacteria 1894
473 Ga0495686_0195479 3300047472 Bacteria 1163
474 Ga0495602_0030671 3300048088 Bacteria 5096
475 Ga0495626_0000222 3300048091 Bacteria 67304
476 Ga0495626_0001089 3300048091 Bacteria 23065
477 Ga0495626_0004011 3300048091 Bacteria 9188
478 Ga0495626_0004015 3300048091 Bacteria 9180
479 Ga0495626_0007268 3300048091 Bacteria 6178
480 Ga0495626_0011693 3300048091 Bacteria 4631
481 Ga0495626_0015368 3300048091 Bacteria 3922
482 Ga0495626_0017751 3300048091 Bacteria 3587
483 Ga0495626_0035868 3300048091 Bacteria 2366
484 Ga0495626_0046256 3300048091 Bacteria 2028
485 Ga0496102_0518472 3300048905 Bacteria 1114
486 Ga0496105_0334932 3300048908 Bacteria 1211
487 Ga0496106_0058992 3300048909 Bacteria 2906
488 Ga0496106_0319677 3300048909 Bacteria 1246
489 Ga0496110_0000026 3300048913 Bacteria 71385
490 Ga0496110_0212265 3300048913 Bacteria 1760
491 Ga0496111_0033724 3300048914 Bacteria 3653
492 Ga0496113_0063902 3300048916 Bacteria 2782
493 Ga0496113_0234278 3300048916 Bacteria 1464
494 Ga0496114_0022834 3300048917 Bacteria 5099
495 Ga0496115_0120610 3300048918 Bacteria 2158
496 Ga0496116_0089325 3300048919 Bacteria 1880
497 Ga0496116_0149534 3300048919 Bacteria 1300
498 Ga0496119_0167686 3300048922 Bacteria 1162
499 Ga0496121_0009608 3300048924 Bacteria 11081
500 Ga0496121_0226897 3300048924 Bacteria 1311
501 Ga0496122_0037249 3300048925 Bacteria 3918
502 Ga0496122_0044295 3300048925 Bacteria 3474
503 Ga0496122_0093488 3300048925 Bacteria 2039
504 Ga0496123_0003516 3300048926 Bacteria 17450
505 Ga0496123_0005149 3300048926 Bacteria 13318
506 Ga0496124_0005355 3300048927 Bacteria 14485
507 Ga0496124_0019908 3300048927 Bacteria 6223
508 Ga0496124_0063664 3300048927 Bacteria 3080
509 Ga0496124_0072048 3300048927 Bacteria 2862
510 Ga0496124_0121706 3300048927 Bacteria 2084
511 Ga0496124_0136485 3300048927 Bacteria 1941
512 Ga0496124_0137183 3300048927 Bacteria 1935
513 Ga0496126_0004427 3300048929 Bacteria 16812
514 Ga0495678_000002 3300049459 Bacteria 999613
515 Ga0495678_000029 3300049459 Bacteria 219803
516 Ga0495678_000045 3300049459 Bacteria 171880
517 Ga0495678_004461 3300049459 Bacteria 8085
518 Ga0495678_005099 3300049459 Bacteria 7379
519 Ga0495678_006315 3300049459 Bacteria 6323
520 Ga0495678_014701 3300049459 Bacteria 3629
521 Ga0495682_0000062 3300049460 Bacteria 100699
522 Ga0495682_0000082 3300049460 Bacteria 83453
523 Ga0495682_0000490 3300049460 Bacteria 27359
524 Ga0495682_0002339 3300049460 Bacteria 9010
525 Ga0501249_002364 3300049679 Bacteria 3809
526 Ga0501234_008639 3300049707 Bacteria 1587
527 Ga0501269_001065 3300049766 Bacteria 3839
528 Ga0501279_003371 3300049775 Bacteria 2084
529 Ga0501035_0003225 3300049822 Bacteria 15630
530 nmdc:mga03683_33274_c1 3300050489 Bacteria 2078
531 Ga0500618_000068 3300053125 Bacteria 88668
532 Ga0500586_005470 3300053145 Bacteria 3216
533 Ga0587068_005599 3300059641 Bacteria 1722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047446 Ga0495679_006467 Ga0495679_006467_3604_4470 288
2 3300039438 Ga0436360_1230647 Ga0436360_1230647_1877_2767 295
3 3300037471 Ga0395905_0325648 Ga0395905_0325648_346_1254 301
4 3300039438 Ga0436360_1167795 Ga0436360_1167795_474_1460 302
5 3300046506 Ga0495583_0025861 Ga0495583_0025861_1443_2441 303
6 3300046513 Ga0495616_0012575 Ga0495616_0012575_2277_3275 303
7 3300046528 Ga0495642_0005946 Ga0495642_0005946_2792_3787 303
8 3300046694 Ga0495649_0015437 Ga0495649_0015437_3104_4102 303
9 3300046506 Ga0495583_0000250 Ga0495583_0000250_1394_2392 304
10 3300046471 Ga0495650_0000344 Ga0495650_0000344_36928_37932 305
11 3300048927 Ga0496124_0005355 Ga0496124_0005355_10339_11331 307
12 3300046500 Ga0495596_0012041 Ga0495596_0012041_1841_2839 308
13 3300046538 Ga0495609_0001851 Ga0495609_0001851_1107_2105 308
14 3300047320 Ga0495672_0002441 Ga0495672_0002441_14680_15678 308
15 3300009148 Ga0105243_10011176 Ga0105243_100111762 309
16 3300025935 Ga0207709_10015451 Ga0207709_100154513 309
17 3300037418 Ga0395900_0028193 Ga0395900_0028193_1534_2526 309
18 3300037466 Ga0395898_0029352 Ga0395898_0029352_2816_3808 309
19 3300044706 Ga0466964_0007753 Ga0466964_0007753_2968_3960 313
20 3300045976 Ga0466967_0028983 Ga0466967_0028983_3377_4369 314
21 3300046474 Ga0495605_0033785 Ga0495605_0033785_1175_2179 314
22 3300047443 Ga0495687_001859 Ga0495687_001859_1476_2477 314
23 3300044842 Ga0466957_0036871 Ga0466957_0036871_1841_2836 315
24 3300046501 Ga0495607_0065407 Ga0495607_0065407_467_1471 318
25 3300009176 Ga0105242_10043677 Ga0105242_100436772 321
26 3300031548 Ga0307408_100000092 Ga0307408_10000009265 321
27 3300025263 Ga0209565_1000452 Ga0209565_10004522 322
28 3300025291 Ga0209675_1010389 Ga0209675_10103891 322
29 3300025299 Ga0209256_1003010 Ga0209256_10030106 322
30 3300046660 Ga0495625_0020170 Ga0495625_0020170_3170_4162 323
31 3300048913 Ga0496110_0000026 Ga0496110_0000026_39707_40702 323
32 3300048914 Ga0496111_0033724 Ga0496111_0033724_1983_2978 323
33 3300046506 Ga0495583_0091100 Ga0495583_0091100_105_1115 324
34 3300031838 Ga0307518_10094823 Ga0307518_100948232 325
35 3300002987 JGI25159J45721_1009926 JGI25159J45721_10099261 326
36 3300003771 Ga0055526_1000445 Ga0055526_10004454 326
37 3300003773 Ga0055537_1000027 Ga0055537_10000272 326
38 3300003775 Ga0055524_1002925 Ga0055524_10029252 326
39 3300003784 Ga0055534_1000051 Ga0055534_100005140 326
40 3300003790 Ga0055528_1000731 Ga0055528_10007317 326
41 3300005262 Ga0065165_1001148 Ga0065165_100114812 326
42 3300025263 Ga0209565_1000017 Ga0209565_1000017223 326
43 3300025273 Ga0209673_1000007 Ga0209673_1000007206 326
44 3300025284 Ga0209130_1000078 Ga0209130_1000078152 326
45 3300025291 Ga0209675_1000009 Ga0209675_1000009312 326
46 3300025295 Ga0209564_1000036 Ga0209564_1000036206 326
47 3300025295 Ga0209564_1000055 Ga0209564_1000055247 326
48 3300025299 Ga0209256_1000167 Ga0209256_100016721 326
49 3300046457 Ga0495590_0020432 Ga0495590_0020432_961_1941 326
50 3300046460 Ga0495638_0023355 Ga0495638_0023355_935_1915 326
51 3300046501 Ga0495607_0011987 Ga0495607_0011987_4556_5536 326
52 3300046506 Ga0495583_0048389 Ga0495583_0048389_142_1122 326
53 3300046513 Ga0495616_0005518 Ga0495616_0005518_3375_4355 326
54 3300046538 Ga0495609_0001046 Ga0495609_0001046_1918_2898 326
55 3300046616 Ga0495668_0000018 Ga0495668_0000018_288927_289907 326
56 3300046616 Ga0495668_0193873 Ga0495668_0193873_89_1087 326
57 3300046660 Ga0495625_0002897 Ga0495625_0002897_7047_8027 326
58 3300046684 Ga0495669_0008861 Ga0495669_0008861_1002_1982 326
59 3300046810 Ga0495660_0031740 Ga0495660_0031740_1295_2275 326
60 3300047443 Ga0495687_076340 Ga0495687_076340_81_1061 326
61 3300047447 Ga0495685_001458 Ga0495685_001458_179_1159 326
62 3300047470 Ga0495681_0029160 Ga0495681_0029160_1011_1991 326
63 iso_pu_bacteria 2643221554 2643789483 326
64 iso_pu_bacteria 2643221556 2643801496 326
65 iso_pu_bacteria 2643221638 2644216060 326
66 iso_pu_bacteria 2643221684 2644471442 326
67 iso_pu_bacteria 2738541297 2738829887 326
68 iso_pu_bacteria 2738541357 2739153683 326
69 iso_pu_bacteria 2738543003 2739195603 326
70 iso_pu_bacteria 2738543026 2739322079 326
71 iso_pu_bacteria 2738543029 2739340320 326
72 iso_pu_bacteria 2808606418 2809142135 326
73 iso_pu_bacteria 2821131069 2821131834 326
74 iso_pu_bacteria 2842711865 2842715521 326
75 iso_pu_bacteria 2857553236 2857555918 326
76 iso_pu_bacteria 2857558681 2857559135 326
77 iso_pu_bacteria 2857564685 2857566934 326
78 iso_pu_bacteria 2904424332 2904425717 326
79 iso_pu_bacteria 2919476304 2919478251 326
80 iso_pu_bacteria 2932410948 2932415453 326
81 iso_pu_bacteria 2932416698 2932421386 326
82 iso_pu_bacteria 8047673197 8047677200 326
83 3300046500 Ga0495596_0038677 Ga0495596_0038677_838_1833 327
84 3300046519 Ga0495632_0000151 Ga0495632_0000151_42245_43240 327
85 3300046542 Ga0495597_0046928 Ga0495597_0046928_562_1557 327
86 3300046616 Ga0495668_0035836 Ga0495668_0035836_845_1840 327
87 3300046684 Ga0495669_0024761 Ga0495669_0024761_423_1418 327
88 3300046691 Ga0495670_0062515 Ga0495670_0062515_95_1090 327
89 3300046692 Ga0495671_0003853 Ga0495671_0003853_6305_7300 327
90 3300046692 Ga0495671_0004731 Ga0495671_0004731_6285_7280 327
91 3300046810 Ga0495660_0021709 Ga0495660_0021709_1132_2127 327
92 3300048091 Ga0495626_0046256 Ga0495626_0046256_911_1906 327
93 3300048924 Ga0496121_0226897 Ga0496121_0226897_260_1276 327
94 3300049459 Ga0495678_005099 Ga0495678_005099_4952_5947 327
95 3300046506 Ga0495583_0000008 Ga0495583_0000008_218819_219805 328
96 3300046506 Ga0495583_0030893 Ga0495583_0030893_480_1469 329
97 3300046810 Ga0495660_0097256 Ga0495660_0097256_343_1335 329
98 3300047320 Ga0495672_0000127 Ga0495672_0000127_116196_117188 329
99 3300047472 Ga0495686_0087568 Ga0495686_0087568_595_1587 329
100 3300002739 JGI25158J39367_1003928 JGI25158J39367_10039282 330
101 3300002773 JGI25152J39213_1000026 JGI25152J39213_100002666 330
102 3300002774 JGI25150J39212_1000478 JGI25150J39212_10004785 330
103 3300002987 JGI25159J45721_1004244 JGI25159J45721_10042442 330
104 3300003215 JGI25153J46596_10011364 JGI25153J46596_100113642 330
105 3300003374 JGI25161J50226_1000886 JGI25161J50226_10008863 330
106 3300003374 JGI25161J50226_1004983 JGI25161J50226_10049832 330
107 3300003575 Ga0007409J51694_1018609 Ga0007409J51694_10186092 330
108 3300003759 Ga0055525_1000006 Ga0055525_1000006537 330
109 3300003763 Ga0055529_1000032 Ga0055529_1000032227 330
110 3300003771 Ga0055526_1000018 Ga0055526_1000018138 330
111 3300003771 Ga0055526_1001212 Ga0055526_10012122 330
112 3300003771 Ga0055526_1014640 Ga0055526_10146402 330
113 3300003773 Ga0055537_1010865 Ga0055537_10108652 330
114 3300003775 Ga0055524_1000297 Ga0055524_100029745 330
115 3300003775 Ga0055524_1002730 Ga0055524_10027306 330
116 3300003775 Ga0055524_1003992 Ga0055524_10039925 330
117 3300003784 Ga0055534_1003639 Ga0055534_10036392 330
118 3300003791 Ga0055530_10001347 Ga0055530_100013472 330
119 3300003791 Ga0055530_10038449 Ga0055530_100384492 330
120 3300003794 Ga0055531_10019181 Ga0055531_100191811 330
121 3300004625 Ga0055543_1000103 Ga0055543_100010329 330
122 3300005262 Ga0065165_1001082 Ga0065165_10010825 330
123 3300005344 Ga0070661_100039302 Ga0070661_1000393022 330
124 3300005564 Ga0070664_100051148 Ga0070664_1000511481 330
125 3300005614 Ga0068856_100576147 Ga0068856_1005761471 330
126 3300005616 Ga0068852_100257146 Ga0068852_1002571462 330
127 3300006881 Ga0068865_100059923 Ga0068865_1000599232 330
128 3300006946 Ga0079104_1011061 Ga0079104_10110612 330
129 3300006948 Ga0099826_10000001 Ga0099826_10000001500 330
130 3300009036 Ga0105244_10001201 Ga0105244_100012019 330
131 3300009036 Ga0105244_10003881 Ga0105244_100038812 330
132 3300009098 Ga0105245_10242721 Ga0105245_102427212 330
133 3300009174 Ga0105241_10008838 Ga0105241_100088382 330
134 3300010375 Ga0105239_10127305 Ga0105239_101273052 330
135 3300013102 Ga0157371_10000014 Ga0157371_10000014259 330
136 3300013297 Ga0157378_10427726 Ga0157378_104277261 330
137 3300015261 Ga0182006_1000040 Ga0182006_10000405 330
138 3300015265 Ga0182005_1000051 Ga0182005_100005131 330
139 3300021361 Ga0213872_10000040 Ga0213872_1000004081 330
140 3300025208 Ga0209436_101815 Ga0209436_1018152 330
141 3300025208 Ga0209436_103379 Ga0209436_1033793 330
142 3300025230 Ga0209563_100022 Ga0209563_100022535 330
143 3300025245 Ga0207425_1000017 Ga0207425_100001731 330
144 3300025245 Ga0207425_1000085 Ga0207425_100008525 330
145 3300025245 Ga0207425_1000326 Ga0207425_10003268 330
146 3300025245 Ga0207425_1000347 Ga0207425_100034727 330
147 3300025246 Ga0209646_1000051 Ga0209646_100005117 330
148 3300025253 Ga0209677_103912 Ga0209677_1039124 330
149 3300025254 Ga0209148_1000678 Ga0209148_10006789 330
150 3300025258 Ga0209129_1000162 Ga0209129_100016264 330
151 3300025263 Ga0209565_1006037 Ga0209565_10060372 330
152 3300025272 Ga0209455_1000043 Ga0209455_1000043319 330
153 3300025284 Ga0209130_1000188 Ga0209130_100018856 330
154 3300025291 Ga0209675_1005478 Ga0209675_10054782 330
155 3300025294 Ga0209025_1001273 Ga0209025_100127329 330
156 3300025295 Ga0209564_1000011 Ga0209564_100001152 330
157 3300025295 Ga0209564_1000068 Ga0209564_1000068244 330
158 3300025295 Ga0209564_1000343 Ga0209564_100034365 330
159 3300025295 Ga0209564_1002854 Ga0209564_10028546 330
160 3300025295 Ga0209564_1004142 Ga0209564_10041426 330
161 3300025297 Ga0209758_1000250 Ga0209758_100025074 330
162 3300025297 Ga0209758_1001409 Ga0209758_10014092 330
163 3300025298 Ga0209050_1000316 Ga0209050_100031661 330
164 3300025298 Ga0209050_1000612 Ga0209050_100061224 330
165 3300025298 Ga0209050_1001484 Ga0209050_10014843 330
166 3300025299 Ga0209256_1000184 Ga0209256_100018464 330
167 3300025299 Ga0209256_1000841 Ga0209256_100084133 330
168 3300025302 Ga0207426_1024022 Ga0207426_10240222 330
169 3300025304 Ga0209257_1000123 Ga0209257_1000123141 330
170 3300025728 Ga0207655_1004932 Ga0207655_10049325 330
171 3300025728 Ga0207655_1008847 Ga0207655_10088472 330
172 3300025909 Ga0207705_10082021 Ga0207705_100820212 330
173 3300025911 Ga0207654_10007226 Ga0207654_100072261 330
174 3300025919 Ga0207657_10221869 Ga0207657_102218692 330
175 3300025932 Ga0207690_10121924 Ga0207690_101219242 330
176 3300025933 Ga0207706_10036350 Ga0207706_100363503 330
177 3300026067 Ga0207678_10041031 Ga0207678_100410312 330
178 3300026142 Ga0207698_10151323 Ga0207698_101513232 330
179 3300027666 Ga0209282_1000001 Ga0209282_10000011638 330
180 3300030744 Ga0316181_1078105 Ga0316181_10781052 330
181 3300031548 Ga0307408_100001578 Ga0307408_1000015786 330
182 3300031548 Ga0307408_100003582 Ga0307408_1000035825 330
183 3300031548 Ga0307408_100005970 Ga0307408_1000059703 330
184 3300031548 Ga0307408_100009216 Ga0307408_1000092162 330
185 3300037312 Ga0395899_0000293 Ga0395899_0000293_54262_55254 330
186 3300037312 Ga0395899_0090053 Ga0395899_0090053_101_1093 330
187 3300037418 Ga0395900_0000202 Ga0395900_0000202_91326_92318 330
188 3300037418 Ga0395900_0217451 Ga0395900_0217451_449_1498 330
189 3300037418 Ga0395900_0297742 Ga0395900_0297742_271_1263 330
190 3300037466 Ga0395898_0227117 Ga0395898_0227117_573_1565 330
191 3300037466 Ga0395898_0227397 Ga0395898_0227397_443_1435 330
192 3300037471 Ga0395905_0222002 Ga0395905_0222002_493_1485 330
193 3300038443 Ga0395901_0000019 Ga0395901_0000019_216180_217172 330
194 3300038443 Ga0395901_0150596 Ga0395901_0150596_459_1451 330
195 3300038443 Ga0395901_0258533 Ga0395901_0258533_722_1714 330
196 3300038443 Ga0395901_0369125 Ga0395901_0369125_444_1436 330
197 3300039447 Ga0436361_0748526 Ga0436361_0748526_33341_34333 330
198 3300039447 Ga0436361_1063317 Ga0436361_1063317_129_1121 330
199 3300041413 Ga0439465_0071441 Ga0439465_0071441_91_1083 330
200 3300042005 Ga0439448_0015869 Ga0439448_0015869_858_1850 330
201 3300044658 Ga0466972_0000072 Ga0466972_0000072_23249_24241 330
202 3300044658 Ga0466972_0005351 Ga0466972_0005351_4933_5925 330
203 3300044683 Ga0466965_0046623 Ga0466965_0046623_909_1901 330
204 3300044683 Ga0466965_0051607 Ga0466965_0051607_697_1689 330
205 3300044684 Ga0466966_0045728 Ga0466966_0045728_1301_2293 330
206 3300044684 Ga0466966_0049500 Ga0466966_0049500_105_1103 330
207 3300044684 Ga0466966_0096352 Ga0466966_0096352_614_1606 330
208 3300044684 Ga0466966_0155619 Ga0466966_0155619_46_1038 330
209 3300044694 Ga0466963_0075452 Ga0466963_0075452_317_1309 330
210 3300044706 Ga0466964_0030463 Ga0466964_0030463_449_1441 330
211 3300044706 Ga0466964_0060121 Ga0466964_0060121_315_1307 330
212 3300044706 Ga0466964_0088628 Ga0466964_0088628_106_1098 330
213 3300044735 Ga0466968_0000207 Ga0466968_0000207_922_1914 330
214 3300044735 Ga0466968_0007718 Ga0466968_0007718_393_1385 330
215 3300044842 Ga0466957_0014693 Ga0466957_0014693_3137_4129 330
216 3300044842 Ga0466957_0099124 Ga0466957_0099124_98_1090 330
217 3300044901 Ga0466960_0070500 Ga0466960_0070500_394_1386 330
218 3300045049 Ga0466959_0039802 Ga0466959_0039802_370_1362 330
219 3300045836 Ga0466958_0023150 Ga0466958_0023150_291_1283 330
220 3300046452 Ga0495617_000003 Ga0495617_000003_267200_268192 330
221 3300046452 Ga0495617_000208 Ga0495617_000208_21462_22454 330
222 3300046452 Ga0495617_008747 Ga0495617_008747_401_1393 330
223 3300046453 Ga0495627_000008 Ga0495627_000008_33180_34172 330
224 3300046457 Ga0495590_0000001 Ga0495590_0000001_197706_198698 330
225 3300046457 Ga0495590_0001769 Ga0495590_0001769_241_1245 330
226 3300046457 Ga0495590_0080098 Ga0495590_0080098_120_1112 330
227 3300046460 Ga0495638_0000017 Ga0495638_0000017_166815_167807 330
228 3300046460 Ga0495638_0005173 Ga0495638_0005173_719_1711 330
229 3300046460 Ga0495638_0017751 Ga0495638_0017751_2932_3924 330
230 3300046460 Ga0495638_0020287 Ga0495638_0020287_735_1727 330
231 3300046460 Ga0495638_0021299 Ga0495638_0021299_658_1650 330
232 3300046460 Ga0495638_0101706 Ga0495638_0101706_249_1253 330
233 3300046463 Ga0495653_0000002 Ga0495653_0000002_455838_456830 330
234 3300046463 Ga0495653_0019967 Ga0495653_0019967_1152_2144 330
235 3300046463 Ga0495653_0042554 Ga0495653_0042554_1197_2192 330
236 3300046471 Ga0495650_0000001 Ga0495650_0000001_476669_477661 330
237 3300046471 Ga0495650_0000072 Ga0495650_0000072_149983_150975 330
238 3300046471 Ga0495650_0000267 Ga0495650_0000267_2435_3427 330
239 3300046471 Ga0495650_0000427 Ga0495650_0000427_57336_58328 330
240 3300046471 Ga0495650_0001400 Ga0495650_0001400_22244_23236 330
241 3300046471 Ga0495650_0012501 Ga0495650_0012501_479_1471 330
242 3300046473 Ga0495582_0046530 Ga0495582_0046530_552_1547 330
243 3300046474 Ga0495605_0000065 Ga0495605_0000065_36675_37667 330
244 3300046474 Ga0495605_0000103 Ga0495605_0000103_20797_21789 330
245 3300046474 Ga0495605_0002266 Ga0495605_0002266_2174_3166 330
246 3300046474 Ga0495605_0006806 Ga0495605_0006806_5374_6366 330
247 3300046474 Ga0495605_0027182 Ga0495605_0027182_585_1589 330
248 3300046474 Ga0495605_0041364 Ga0495605_0041364_911_1903 330
249 3300046474 Ga0495605_0061233 Ga0495605_0061233_470_1462 330
250 3300046474 Ga0495605_0070653 Ga0495605_0070653_70_1062 330
251 3300046491 Ga0495584_0000009 Ga0495584_0000009_217307_218299 330
252 3300046491 Ga0495584_0000057 Ga0495584_0000057_47904_48896 330
253 3300046491 Ga0495584_0000182 Ga0495584_0000182_25986_26978 330
254 3300046491 Ga0495584_0000904 Ga0495584_0000904_5857_6849 330
255 3300046491 Ga0495584_0001765 Ga0495584_0001765_1354_2346 330
256 3300046491 Ga0495584_0002700 Ga0495584_0002700_7712_8704 330
257 3300046491 Ga0495584_0004270 Ga0495584_0004270_1187_2191 330
258 3300046491 Ga0495584_0008823 Ga0495584_0008823_2069_3061 330
259 3300046491 Ga0495584_0015054 Ga0495584_0015054_935_1927 330
260 3300046491 Ga0495584_0028660 Ga0495584_0028660_23_1015 330
261 3300046492 Ga0495585_0000077 Ga0495585_0000077_1023_2015 330
262 3300046492 Ga0495585_0000094 Ga0495585_0000094_1521_2513 330
263 3300046492 Ga0495585_0000154 Ga0495585_0000154_62931_63923 330
264 3300046492 Ga0495585_0000940 Ga0495585_0000940_21039_22031 330
265 3300046492 Ga0495585_0001952 Ga0495585_0001952_1202_2194 330
266 3300046492 Ga0495585_0002583 Ga0495585_0002583_2152_3144 330
267 3300046492 Ga0495585_0007860 Ga0495585_0007860_944_1936 330
268 3300046492 Ga0495585_0024507 Ga0495585_0024507_2092_3084 330
269 3300046492 Ga0495585_0057018 Ga0495585_0057018_313_1305 330
270 3300046492 Ga0495585_0082081 Ga0495585_0082081_378_1370 330
271 3300046500 Ga0495596_0000961 Ga0495596_0000961_14222_15214 330
272 3300046500 Ga0495596_0009123 Ga0495596_0009123_2550_3542 330
273 3300046500 Ga0495596_0037712 Ga0495596_0037712_436_1428 330
274 3300046500 Ga0495596_0062218 Ga0495596_0062218_99_1091 330
275 3300046501 Ga0495607_0002416 Ga0495607_0002416_11565_12557 330
276 3300046501 Ga0495607_0002798 Ga0495607_0002798_1600_2592 330
277 3300046501 Ga0495607_0010564 Ga0495607_0010564_1337_2329 330
278 3300046501 Ga0495607_0012148 Ga0495607_0012148_3543_4535 330
279 3300046501 Ga0495607_0028843 Ga0495607_0028843_20_1012 330
280 3300046501 Ga0495607_0038103 Ga0495607_0038103_1337_2329 330
281 3300046501 Ga0495607_0054462 Ga0495607_0054462_727_1719 330
282 3300046501 Ga0495607_0060614 Ga0495607_0060614_939_1931 330
283 3300046501 Ga0495607_0087401 Ga0495607_0087401_263_1255 330
284 3300046506 Ga0495583_0000050 Ga0495583_0000050_103829_104821 330
285 3300046506 Ga0495583_0000064 Ga0495583_0000064_162333_163325 330
286 3300046506 Ga0495583_0000067 Ga0495583_0000067_64623_65615 330
287 3300046506 Ga0495583_0000253 Ga0495583_0000253_17192_18184 330
288 3300046506 Ga0495583_0000485 Ga0495583_0000485_1516_2508 330
289 3300046506 Ga0495583_0002249 Ga0495583_0002249_14995_15999 330
290 3300046506 Ga0495583_0019755 Ga0495583_0019755_986_1978 330
291 3300046507 Ga0495606_0000001 Ga0495606_0000001_295214_296206 330
292 3300046507 Ga0495606_0000030 Ga0495606_0000030_39375_40367 330
293 3300046507 Ga0495606_0000282 Ga0495606_0000282_37362_38354 330
294 3300046507 Ga0495606_0018842 Ga0495606_0018842_280_1272 330
295 3300046507 Ga0495606_0030636 Ga0495606_0030636_770_1762 330
296 3300046507 Ga0495606_0035060 Ga0495606_0035060_235_1227 330
297 3300046507 Ga0495606_0045077 Ga0495606_0045077_952_1944 330
298 3300046507 Ga0495606_0050770 Ga0495606_0050770_194_1189 330
299 3300046507 Ga0495606_0057289 Ga0495606_0057289_525_1517 330
300 3300046507 Ga0495606_0057510 Ga0495606_0057510_1124_2116 330
301 3300046507 Ga0495606_0093851 Ga0495606_0093851_450_1442 330
302 3300046507 Ga0495606_0133882 Ga0495606_0133882_150_1142 330
303 3300046512 Ga0495610_0000003 Ga0495610_0000003_956664_957656 330
304 3300046512 Ga0495610_0001826 Ga0495610_0001826_2212_3204 330
305 3300046512 Ga0495610_0005555 Ga0495610_0005555_7639_8631 330
306 3300046512 Ga0495610_0011630 Ga0495610_0011630_2005_2997 330
307 3300046512 Ga0495610_0020310 Ga0495610_0020310_1766_2758 330
308 3300046512 Ga0495610_0112087 Ga0495610_0112087_204_1196 330
309 3300046513 Ga0495616_0000924 Ga0495616_0000924_2113_3105 330
310 3300046513 Ga0495616_0001100 Ga0495616_0001100_1853_2845 330
311 3300046513 Ga0495616_0002444 Ga0495616_0002444_9864_10856 330
312 3300046513 Ga0495616_0011725 Ga0495616_0011725_1437_2429 330
313 3300046513 Ga0495616_0013364 Ga0495616_0013364_171_1163 330
314 3300046513 Ga0495616_0021407 Ga0495616_0021407_1023_2033 330
315 3300046513 Ga0495616_0040240 Ga0495616_0040240_72_1064 330
316 3300046513 Ga0495616_0053341 Ga0495616_0053341_40_1044 330
317 3300046513 Ga0495616_0092110 Ga0495616_0092110_381_1373 330
318 3300046515 Ga0495620_0019918 Ga0495620_0019918_2050_3042 330
319 3300046518 Ga0495631_0000214 Ga0495631_0000214_30934_31938 330
320 3300046518 Ga0495631_0012700 Ga0495631_0012700_1116_2126 330
321 3300046518 Ga0495631_0019176 Ga0495631_0019176_1442_2434 330
322 3300046518 Ga0495631_0051537 Ga0495631_0051537_22_1014 330
323 3300046518 Ga0495631_0057036 Ga0495631_0057036_677_1669 330
324 3300046518 Ga0495631_0062284 Ga0495631_0062284_55_1047 330
325 3300046519 Ga0495632_0003007 Ga0495632_0003007_771_1763 330
326 3300046519 Ga0495632_0026713 Ga0495632_0026713_1131_2123 330
327 3300046519 Ga0495632_0051765 Ga0495632_0051765_314_1306 330
328 3300046519 Ga0495632_0058582 Ga0495632_0058582_97_1089 330
329 3300046520 Ga0495637_0000042 Ga0495637_0000042_49505_50497 330
330 3300046522 Ga0495643_0000028 Ga0495643_0000028_65708_66700 330
331 3300046522 Ga0495643_0000285 Ga0495643_0000285_61944_62936 330
332 3300046522 Ga0495643_0002751 Ga0495643_0002751_11179_12171 330
333 3300046522 Ga0495643_0015685 Ga0495643_0015685_2373_3365 330
334 3300046522 Ga0495643_0015776 Ga0495643_0015776_3031_4023 330
335 3300046522 Ga0495643_0052974 Ga0495643_0052974_15_1007 330
336 3300046523 Ga0495644_0002436 Ga0495644_0002436_4699_5691 330
337 3300046523 Ga0495644_0002963 Ga0495644_0002963_3374_4366 330
338 3300046523 Ga0495644_0004943 Ga0495644_0004943_60_1052 330
339 3300046523 Ga0495644_0010462 Ga0495644_0010462_1152_2144 330
340 3300046523 Ga0495644_0018077 Ga0495644_0018077_1080_2072 330
341 3300046524 Ga0495648_0000001 Ga0495648_0000001_654118_655110 330
342 3300046524 Ga0495648_0000079 Ga0495648_0000079_69546_70538 330
343 3300046524 Ga0495648_0001359 Ga0495648_0001359_856_1848 330
344 3300046524 Ga0495648_0002750 Ga0495648_0002750_13382_14386 330
345 3300046524 Ga0495648_0003215 Ga0495648_0003215_745_1737 330
346 3300046524 Ga0495648_0014566 Ga0495648_0014566_3879_4871 330
347 3300046524 Ga0495648_0014982 Ga0495648_0014982_589_1581 330
348 3300046524 Ga0495648_0022727 Ga0495648_0022727_1069_2073 330
349 3300046524 Ga0495648_0028372 Ga0495648_0028372_1003_1995 330
350 3300046524 Ga0495648_0042340 Ga0495648_0042340_1361_2365 330
351 3300046524 Ga0495648_0055139 Ga0495648_0055139_504_1496 330
352 3300046525 Ga0495663_0006483 Ga0495663_0006483_1228_2220 330
353 3300046526 Ga0495666_0011013 Ga0495666_0011013_119_1114 330
354 3300046528 Ga0495642_0003301 Ga0495642_0003301_3916_4908 330
355 3300046528 Ga0495642_0005123 Ga0495642_0005123_3522_4514 330
356 3300046528 Ga0495642_0023913 Ga0495642_0023913_1307_2299 330
357 3300046528 Ga0495642_0037924 Ga0495642_0037924_519_1511 330
358 3300046528 Ga0495642_0088514 Ga0495642_0088514_227_1219 330
359 3300046529 Ga0495652_0028471 Ga0495652_0028471_2409_3404 330
360 3300046530 Ga0495654_0000037 Ga0495654_0000037_87765_88757 330
361 3300046530 Ga0495654_0040533 Ga0495654_0040533_1073_2065 330
362 3300046530 Ga0495654_0060273 Ga0495654_0060273_651_1655 330
363 3300046531 Ga0495665_0024664 Ga0495665_0024664_101_1096 330
364 3300046531 Ga0495665_0044440 Ga0495665_0044440_546_1538 330
365 3300046536 Ga0495587_0121870 Ga0495587_0121870_190_1185 330
366 3300046538 Ga0495609_0000026 Ga0495609_0000026_78718_79710 330
367 3300046538 Ga0495609_0000241 Ga0495609_0000241_38894_39886 330
368 3300046538 Ga0495609_0001294 Ga0495609_0001294_312_1304 330
369 3300046538 Ga0495609_0001330 Ga0495609_0001330_8428_9420 330
370 3300046538 Ga0495609_0007727 Ga0495609_0007727_3467_4471 330
371 3300046538 Ga0495609_0018057 Ga0495609_0018057_1106_2098 330
372 3300046538 Ga0495609_0036406 Ga0495609_0036406_728_1732 330
373 3300046538 Ga0495609_0041751 Ga0495609_0041751_470_1462 330
374 3300046538 Ga0495609_0062144 Ga0495609_0062144_75_1067 330
375 3300046542 Ga0495597_0000056 Ga0495597_0000056_78299_79291 330
376 3300046542 Ga0495597_0000705 Ga0495597_0000705_14436_15428 330
377 3300046542 Ga0495597_0000864 Ga0495597_0000864_6780_7772 330
378 3300046542 Ga0495597_0001532 Ga0495597_0001532_14319_15323 330
379 3300046542 Ga0495597_0006593 Ga0495597_0006593_1992_2984 330
380 3300046542 Ga0495597_0006628 Ga0495597_0006628_4503_5507 330
381 3300046542 Ga0495597_0007484 Ga0495597_0007484_1050_2042 330
382 3300046542 Ga0495597_0016163 Ga0495597_0016163_1728_2720 330
383 3300046557 Ga0495622_0000131 Ga0495622_0000131_9197_10189 330
384 3300046558 Ga0495633_0000055 Ga0495633_0000055_133469_134461 330
385 3300046558 Ga0495633_0000106 Ga0495633_0000106_14488_15480 330
386 3300046558 Ga0495633_0001613 Ga0495633_0001613_542_1534 330
387 3300046558 Ga0495633_0003359 Ga0495633_0003359_4519_5511 330
388 3300046558 Ga0495633_0017106 Ga0495633_0017106_2455_3447 330
389 3300046558 Ga0495633_0029947 Ga0495633_0029947_1036_2028 330
390 3300046558 Ga0495633_0095094 Ga0495633_0095094_117_1109 330
391 3300046615 Ga0495656_0005067 Ga0495656_0005067_2606_3598 330
392 3300046615 Ga0495656_0040201 Ga0495656_0040201_820_1812 330
393 3300046615 Ga0495656_0042855 Ga0495656_0042855_374_1366 330
394 3300046615 Ga0495656_0074243 Ga0495656_0074243_480_1472 330
395 3300046615 Ga0495656_0078987 Ga0495656_0078987_350_1342 330
396 3300046616 Ga0495668_0000190 Ga0495668_0000190_56650_57642 330
397 3300046616 Ga0495668_0001065 Ga0495668_0001065_11764_12756 330
398 3300046616 Ga0495668_0001873 Ga0495668_0001873_8254_9246 330
399 3300046616 Ga0495668_0002041 Ga0495668_0002041_15887_16879 330
400 3300046616 Ga0495668_0002146 Ga0495668_0002146_14086_15078 330
401 3300046616 Ga0495668_0006520 Ga0495668_0006520_1020_2024 330
402 3300046616 Ga0495668_0041656 Ga0495668_0041656_575_1567 330
403 3300046642 Ga0495634_0071936 Ga0495634_0071936_440_1435 330
404 3300046648 Ga0495611_0000151 Ga0495611_0000151_19483_20475 330
405 3300046648 Ga0495611_0002359 Ga0495611_0002359_6845_7837 330
406 3300046648 Ga0495611_0011731 Ga0495611_0011731_1217_2209 330
407 3300046660 Ga0495625_0000035 Ga0495625_0000035_115674_116666 330
408 3300046660 Ga0495625_0000391 Ga0495625_0000391_29990_30982 330
409 3300046660 Ga0495625_0004167 Ga0495625_0004167_12045_13037 330
410 3300046660 Ga0495625_0007248 Ga0495625_0007248_2857_3849 330
411 3300046660 Ga0495625_0007938 Ga0495625_0007938_420_1424 330
412 3300046660 Ga0495625_0091623 Ga0495625_0091623_690_1682 330
413 3300046665 Ga0495661_0000152 Ga0495661_0000152_78700_79692 330
414 3300046665 Ga0495661_0000715 Ga0495661_0000715_29728_30720 330
415 3300046665 Ga0495661_0008169 Ga0495661_0008169_1703_2695 330
416 3300046665 Ga0495661_0039547 Ga0495661_0039547_182_1174 330
417 3300046665 Ga0495661_0040312 Ga0495661_0040312_1401_2393 330
418 3300046665 Ga0495661_0041699 Ga0495661_0041699_1738_2730 330
419 3300046665 Ga0495661_0051554 Ga0495661_0051554_749_1741 330
420 3300046665 Ga0495661_0186036 Ga0495661_0186036_55_1047 330
421 3300046674 Ga0495588_0000139 Ga0495588_0000139_37272_38264 330
422 3300046678 Ga0495599_0193189 Ga0495599_0193189_49_1047 330
423 3300046679 Ga0495623_0039508 Ga0495623_0039508_538_1533 330
424 3300046679 Ga0495623_0093049 Ga0495623_0093049_639_1634 330
425 3300046680 Ga0495646_0050462 Ga0495646_0050462_898_1896 330
426 3300046684 Ga0495669_0034607 Ga0495669_0034607_737_1729 330
427 3300046684 Ga0495669_0059457 Ga0495669_0059457_428_1420 330
428 3300046691 Ga0495670_0000513 Ga0495670_0000513_16764_17756 330
429 3300046691 Ga0495670_0031688 Ga0495670_0031688_1026_2018 330
430 3300046691 Ga0495670_0054252 Ga0495670_0054252_129_1121 330
431 3300046691 Ga0495670_0088109 Ga0495670_0088109_529_1521 330
432 3300046692 Ga0495671_0000010 Ga0495671_0000010_210842_211834 330
433 3300046692 Ga0495671_0020732 Ga0495671_0020732_394_1386 330
434 3300046692 Ga0495671_0037809 Ga0495671_0037809_1112_2104 330
435 3300046694 Ga0495649_0011975 Ga0495649_0011975_3852_4844 330
436 3300046694 Ga0495649_0016169 Ga0495649_0016169_951_1943 330
437 3300046794 Ga0495589_0000045 Ga0495589_0000045_39386_40378 330
438 3300046794 Ga0495589_0000100 Ga0495589_0000100_62995_63987 330
439 3300046794 Ga0495589_0000101 Ga0495589_0000101_2874_3866 330
440 3300046794 Ga0495589_0014427 Ga0495589_0014427_2367_3371 330
441 3300046794 Ga0495589_0023533 Ga0495589_0023533_1172_2164 330
442 3300046794 Ga0495589_0029595 Ga0495589_0029595_1694_2686 330
443 3300046810 Ga0495660_0000027 Ga0495660_0000027_190903_191895 330
444 3300046810 Ga0495660_0000335 Ga0495660_0000335_13242_14234 330
445 3300046810 Ga0495660_0000555 Ga0495660_0000555_1933_2925 330
446 3300046810 Ga0495660_0007649 Ga0495660_0007649_1704_2696 330
447 3300046810 Ga0495660_0015261 Ga0495660_0015261_3381_4373 330
448 3300046810 Ga0495660_0015437 Ga0495660_0015437_956_1948 330
449 3300046810 Ga0495660_0020381 Ga0495660_0020381_962_1954 330
450 3300046810 Ga0495660_0054308 Ga0495660_0054308_516_1520 330
451 3300047315 Ga0495581_0092627 Ga0495581_0092627_77_1069 330
452 3300047317 Ga0495604_0060169 Ga0495604_0060169_843_1838 330
453 3300047318 Ga0495636_0000169 Ga0495636_0000169_4723_5715 330
454 3300047318 Ga0495636_0042664 Ga0495636_0042664_441_1433 330
455 3300047320 Ga0495672_0002015 Ga0495672_0002015_18090_19082 330
456 3300047320 Ga0495672_0002622 Ga0495672_0002622_612_1604 330
457 3300047320 Ga0495672_0020028 Ga0495672_0020028_1258_2262 330
458 3300047320 Ga0495672_0043110 Ga0495672_0043110_850_1842 330
459 3300047321 Ga0495676_0083159 Ga0495676_0083159_1035_2033 330
460 3300047323 Ga0495683_0000064 Ga0495683_0000064_48898_49890 330
461 3300047323 Ga0495683_0000498 Ga0495683_0000498_898_1890 330
462 3300047323 Ga0495683_0015275 Ga0495683_0015275_565_1557 330
463 3300047323 Ga0495683_0034198 Ga0495683_0034198_1026_2018 330
464 3300047323 Ga0495683_0036509 Ga0495683_0036509_1473_2465 330
465 3300047323 Ga0495683_0041784 Ga0495683_0041784_848_1840 330
466 3300047323 Ga0495683_0044945 Ga0495683_0044945_804_1796 330
467 3300047443 Ga0495687_000037 Ga0495687_000037_78718_79710 330
468 3300047443 Ga0495687_000062 Ga0495687_000062_119705_120697 330
469 3300047443 Ga0495687_000122 Ga0495687_000122_34770_35762 330
470 3300047443 Ga0495687_001241 Ga0495687_001241_29_1021 330
471 3300047443 Ga0495687_002590 Ga0495687_002590_9397_10389 330
472 3300047443 Ga0495687_011036 Ga0495687_011036_3690_4682 330
473 3300047444 Ga0495675_0017159 Ga0495675_0017159_1213_2208 330
474 3300047444 Ga0495675_0062981 Ga0495675_0062981_374_1366 330
475 3300047445 Ga0495677_0000014 Ga0495677_0000014_56527_57519 330
476 3300047445 Ga0495677_0002033 Ga0495677_0002033_6842_7834 330
477 3300047445 Ga0495677_0002363 Ga0495677_0002363_908_1900 330
478 3300047445 Ga0495677_0006994 Ga0495677_0006994_2511_3503 330
479 3300047445 Ga0495677_0019243 Ga0495677_0019243_212_1204 330
480 3300047445 Ga0495677_0033972 Ga0495677_0033972_764_1756 330
481 3300047446 Ga0495679_000603 Ga0495679_000603_19342_20334 330
482 3300047446 Ga0495679_006022 Ga0495679_006022_797_1801 330
483 3300047446 Ga0495679_041789 Ga0495679_041789_382_1374 330
484 3300047447 Ga0495685_000011 Ga0495685_000011_856_1848 330
485 3300047447 Ga0495685_000262 Ga0495685_000262_2102_3094 330
486 3300047447 Ga0495685_014337 Ga0495685_014337_1233_2225 330
487 3300047469 Ga0495673_0000003 Ga0495673_0000003_954003_954995 330
488 3300047469 Ga0495673_0000016 Ga0495673_0000016_240683_241675 330
489 3300047469 Ga0495673_0004771 Ga0495673_0004771_7009_8001 330
490 3300047469 Ga0495673_0006851 Ga0495673_0006851_5394_6386 330
491 3300047470 Ga0495681_0000021 Ga0495681_0000021_148294_149286 330
492 3300047470 Ga0495681_0012652 Ga0495681_0012652_1399_2391 330
493 3300047470 Ga0495681_0043803 Ga0495681_0043803_86_1078 330
494 3300047470 Ga0495681_0050544 Ga0495681_0050544_602_1594 330
495 3300047470 Ga0495681_0066072 Ga0495681_0066072_58_1050 330
496 3300047470 Ga0495681_0067202 Ga0495681_0067202_92_1084 330
497 3300047472 Ga0495686_0000047 Ga0495686_0000047_88091_89083 330
498 3300047472 Ga0495686_0022915 Ga0495686_0022915_648_1640 330
499 3300047472 Ga0495686_0195479 Ga0495686_0195479_142_1134 330
500 3300048088 Ga0495602_0030671 Ga0495602_0030671_1380_2375 330
501 3300048091 Ga0495626_0000222 Ga0495626_0000222_35540_36532 330
502 3300048091 Ga0495626_0001089 Ga0495626_0001089_5490_6482 330
503 3300048091 Ga0495626_0004011 Ga0495626_0004011_3904_4896 330
504 3300048091 Ga0495626_0004015 Ga0495626_0004015_6866_7858 330
505 3300048091 Ga0495626_0007268 Ga0495626_0007268_2056_3048 330
506 3300048091 Ga0495626_0011693 Ga0495626_0011693_3594_4586 330
507 3300048091 Ga0495626_0015368 Ga0495626_0015368_475_1467 330
508 3300048091 Ga0495626_0017751 Ga0495626_0017751_758_1750 330
509 3300048091 Ga0495626_0035868 Ga0495626_0035868_990_1982 330
510 3300048905 Ga0496102_0518472 Ga0496102_0518472_29_1078 330
511 3300048908 Ga0496105_0334932 Ga0496105_0334932_138_1187 330
512 3300048909 Ga0496106_0058992 Ga0496106_0058992_1396_2388 330
513 3300048909 Ga0496106_0319677 Ga0496106_0319677_237_1229 330
514 3300048913 Ga0496110_0212265 Ga0496110_0212265_672_1664 330
515 3300048916 Ga0496113_0063902 Ga0496113_0063902_83_1075 330
516 3300048916 Ga0496113_0234278 Ga0496113_0234278_386_1378 330
517 3300048917 Ga0496114_0022834 Ga0496114_0022834_3561_4553 330
518 3300048918 Ga0496115_0120610 Ga0496115_0120610_787_1785 330
519 3300048919 Ga0496116_0089325 Ga0496116_0089325_876_1868 330
520 3300048919 Ga0496116_0149534 Ga0496116_0149534_81_1073 330
521 3300048922 Ga0496119_0167686 Ga0496119_0167686_96_1088 330
522 3300048924 Ga0496121_0009608 Ga0496121_0009608_8528_9520 330
523 3300048925 Ga0496122_0037249 Ga0496122_0037249_2228_3220 330
524 3300048925 Ga0496122_0044295 Ga0496122_0044295_27_1019 330
525 3300048925 Ga0496122_0093488 Ga0496122_0093488_131_1123 330
526 3300048926 Ga0496123_0003516 Ga0496123_0003516_8839_9831 330
527 3300048926 Ga0496123_0005149 Ga0496123_0005149_5920_6912 330
528 3300048927 Ga0496124_0019908 Ga0496124_0019908_4468_5460 330
529 3300048927 Ga0496124_0063664 Ga0496124_0063664_1163_2155 330
530 3300048927 Ga0496124_0072048 Ga0496124_0072048_1110_2102 330
531 3300048927 Ga0496124_0121706 Ga0496124_0121706_451_1443 330
532 3300048927 Ga0496124_0136485 Ga0496124_0136485_923_1915 330
533 3300048927 Ga0496124_0137183 Ga0496124_0137183_486_1478 330
534 3300048929 Ga0496126_0004427 Ga0496126_0004427_14106_15098 330
535 3300049459 Ga0495678_000002 Ga0495678_000002_953889_954881 330
536 3300049459 Ga0495678_000029 Ga0495678_000029_170269_171261 330
537 3300049459 Ga0495678_000045 Ga0495678_000045_84016_85020 330
538 3300049459 Ga0495678_004461 Ga0495678_004461_5643_6653 330
539 3300049459 Ga0495678_006315 Ga0495678_006315_895_1887 330
540 3300049459 Ga0495678_014701 Ga0495678_014701_875_1867 330
541 3300049460 Ga0495682_0000062 Ga0495682_0000062_99346_100338 330
542 3300049460 Ga0495682_0000082 Ga0495682_0000082_1484_2494 330
543 3300049460 Ga0495682_0000490 Ga0495682_0000490_16492_17484 330
544 3300049460 Ga0495682_0002339 Ga0495682_0002339_6094_7086 330
545 3300049679 Ga0501249_002364 Ga0501249_002364_2397_3389 330
546 3300049707 Ga0501234_008639 Ga0501234_008639_84_1076 330
547 3300049766 Ga0501269_001065 Ga0501269_001065_2356_3348 330
548 3300049775 Ga0501279_003371 Ga0501279_003371_538_1530 330
549 3300049822 Ga0501035_0003225 Ga0501035_0003225_670_1662 330
550 3300050489 nmdc:mga03683_33274_c1 nmdc:mga03683_33274_c1_61_1053 330
551 3300053125 Ga0500618_000068 Ga0500618_000068_51606_52598 330
552 3300053145 Ga0500586_005470 Ga0500586_005470_1148_2140 330
553 3300059641 Ga0587068_005599 Ga0587068_005599_432_1424 330

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.7642 1 322
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.7619 1 322
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.756 1 320
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.7512 1 322
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.7507 1 322
ID Description Score Start End Superfamily
af_I1K703_28_109_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7997 229 254 2.60.40.10
af_Q54SH6_478_772_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7913 228 250 3.90.70.10
af_Q3TZL0_37_246_3.90.310.10 Alpha Beta;Alpha-Beta Complex;Viral Glycoprotein Gp70;ENV polyprotein, receptor-binding domain 0.7824 224 251 3.90.310.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7769 83 322 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.7605 83 322 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A5F0LK97-F1-model_v4 FAH family protein 0.9715 1 71
AF-A0A435FF96-F1-model_v4 FAH family protein 0.9675 1 93
AF-A0A5F0LK97-F1-model_v4 FAH family protein 0.9584 1 71
AF-A0A5Q8CGY0-F1-model_v4 GguC protein 0.9531 140 330 GO:0003824
AF-A0A317I7K1-F1-model_v4 FAH family protein 0.952 136 320 GO:0003824

Feature Viewer

pLDDT pTM Quality
81.6 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map