F462871

General Info

Members Datasets Scaffolds Average Seq Length
553 213 1106 324

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10087878|Ga0207648_100878783
Length 371
Sequence MCGIGVVSRQLAIVSSRPRPPQYCELISGSAVADVWMQKRWSMLGWLKAPFDSVLVISFGGPQGLDDIRPFLANVLRGRRVSPERVEEVAHHYELFGGVSPITSITRRQAEGLRLRLEAAGHSLPVYVGMRNWHPLLPDTLRNMHAAGLRHAIGFITAAQHSYSSCQQYRENVTAARVELRNNGEDVDVTFVGSWFEHPLFIAANAAHVMGALARLPEGARAAARLVCTAHSIPIQMAQASRYEAQLKESARLVAEEVGMHDWALVYQSRSGRPGDPWLEPDVCDYLRRERAAGLQAAVLCPIGFVSDHIEVLYDLDREAADVSREIGLLLARAESVNDDPRFLDMMADVVLRTIKRHEQGRPLPLTAAAR

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
157 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0
Rhizoplane 0.54
Rhizosphere 96.75
Stem 0
Stem Tuber 0
Unclassified 15.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10087878 3300026089 Bacteria 2713
2 SwRhRL2b_contig_3115889 2162886007 Unclassified 1950
3 JGI24751J29686_10018045 3300002459 Bacteria 1459
4 JGI25406J46586_10000419 3300003203 Bacteria 19512
5 Ga0065704_10004376 3300005289 Bacteria 5688
6 Ga0065712_10001274 3300005290 Bacteria 8076
7 Ga0065715_10013853 3300005293 Bacteria 2202
8 Ga0065715_10015399 3300005293 Unclassified 2765
9 Ga0065715_10103262 3300005293 Unclassified 3046
10 Ga0065715_10165631 3300005293 Bacteria 1589
11 Ga0065707_10001808 3300005295 Bacteria 6679
12 Ga0065707_10114722 3300005295 Unclassified 2289
13 Ga0070676_10009842 3300005328 Bacteria 5171
14 Ga0070676_10097243 3300005328 Bacteria 1813
15 Ga0070676_10174796 3300005328 Unclassified 1392
16 Ga0070683_100006888 3300005329 Bacteria 9548
17 Ga0070683_100012012 3300005329 Bacteria 7512
18 Ga0070690_100002535 3300005330 Bacteria 9830
19 Ga0070670_100011516 3300005331 Bacteria 7566
20 Ga0070670_100034960 3300005331 Unclassified 4325
21 Ga0070670_100176958 3300005331 Unclassified 1852
22 Ga0070677_10013120 3300005333 Bacteria 2891
23 Ga0070677_10017079 3300005333 Bacteria 2592
24 Ga0068869_100004047 3300005334 Bacteria 9069
25 Ga0068869_100008308 3300005334 Bacteria 6688
26 Ga0068869_100028707 3300005334 Bacteria 3891
27 Ga0068869_100088545 3300005334 Bacteria 2324
28 Ga0068869_100147466 3300005334 Bacteria 1822
29 Ga0068869_100163743 3300005334 Bacteria 1733
30 Ga0068869_100172445 3300005334 Bacteria 1691
31 Ga0068869_100198419 3300005334 Bacteria 1581
32 Ga0070680_100108341 3300005336 Bacteria 2311
33 Ga0070680_100203484 3300005336 Bacteria 1670
34 Ga0070680_100251269 3300005336 Bacteria 1495
35 Ga0070680_100369689 3300005336 Bacteria 1220
36 Ga0068868_100317641 3300005338 Bacteria 1326
37 Ga0070689_100004481 3300005340 Bacteria 9446
38 Ga0070689_100009330 3300005340 Bacteria 6956
39 Ga0070689_100012629 3300005340 Bacteria 6090
40 Ga0070691_10029367 3300005341 Bacteria 2571
41 Ga0070687_100073024 3300005343 Bacteria 1848
42 Ga0070687_100177566 3300005343 Unclassified 1273
43 Ga0070668_100212667 3300005347 Bacteria 1591
44 Ga0070668_100313630 3300005347 Unclassified 1318
45 Ga0070669_100000432 3300005353 Bacteria 32010
46 Ga0070669_100015719 3300005353 Bacteria 5398
47 Ga0070669_100033302 3300005353 Bacteria 3726
48 Ga0070669_100041323 3300005353 Unclassified 3353
49 Ga0070669_100105067 3300005353 Bacteria 2136
50 Ga0070669_100113828 3300005353 Bacteria 2056
51 Ga0070675_100000109 3300005354 Bacteria 47889
52 Ga0070675_100010250 3300005354 Bacteria 7312
53 Ga0070675_100029687 3300005354 Unclassified 4411
54 Ga0070675_100033933 3300005354 Bacteria 4139
55 Ga0070671_100007712 3300005355 Bacteria 8598
56 Ga0070671_100046552 3300005355 Bacteria 3607
57 Ga0070674_100009659 3300005356 Bacteria 5787
58 Ga0070674_100088033 3300005356 Unclassified 2234
59 Ga0070674_100119491 3300005356 Bacteria 1949
60 Ga0070673_100000486 3300005364 Bacteria 21134
61 Ga0070673_100026385 3300005364 Bacteria 4290
62 Ga0070673_100055049 3300005364 Bacteria 3133
63 Ga0070673_100081855 3300005364 Bacteria 2619
64 Ga0070673_100327996 3300005364 Bacteria 1353
65 Ga0070688_100001310 3300005365 Bacteria 12411
66 Ga0070688_100023382 3300005365 Unclassified 3634
67 Ga0070659_100164303 3300005366 Bacteria 1816
68 Ga0070659_100324656 3300005366 Unclassified 1287
69 Ga0070667_100020613 3300005367 Bacteria 5472
70 Ga0070667_100376699 3300005367 Bacteria 1289
71 Ga0070703_10027233 3300005406 Bacteria 1703
72 Ga0070701_10001780 3300005438 Bacteria 8135
73 Ga0070701_10021737 3300005438 Bacteria 3067
74 Ga0070701_10050933 3300005438 Bacteria 2146
75 Ga0070701_10066463 3300005438 Bacteria 1916
76 Ga0070701_10096996 3300005438 Bacteria 1626
77 Ga0070705_100000366 3300005440 Bacteria 26473
78 Ga0070705_100234836 3300005440 Bacteria 1278
79 Ga0070700_100040517 3300005441 Bacteria 2852
80 Ga0070700_100067086 3300005441 Unclassified 2279
81 Ga0070700_100077374 3300005441 Unclassified 2139
82 Ga0070700_100097524 3300005441 Bacteria 1930
83 Ga0070700_100122214 3300005441 Bacteria 1746
84 Ga0070700_100215905 3300005441 Bacteria 1356
85 Ga0070694_100014180 3300005444 Unclassified 4987
86 Ga0070694_100248969 3300005444 Bacteria 1343
87 Ga0070708_100102137 3300005445 Bacteria 2627
88 Ga0070708_100128766 3300005445 Archaea 2342
89 Ga0070663_100010296 3300005455 Bacteria 5827
90 Ga0070663_100022604 3300005455 Bacteria 4207
91 Ga0070678_100111301 3300005456 Bacteria 2142
92 Ga0070678_100243134 3300005456 Bacteria 1506
93 Ga0070678_100316311 3300005456 Bacteria 1332
94 Ga0070662_100059024 3300005457 Unclassified 2794
95 Ga0070681_10025530 3300005458 Bacteria 5943
96 Ga0070681_10394414 3300005458 Bacteria 1295
97 Ga0068867_100016050 3300005459 Bacteria 5317
98 Ga0068867_100025615 3300005459 Bacteria 4233
99 Ga0068867_100082925 3300005459 Bacteria 2419
100 Ga0068867_100217160 3300005459 Bacteria 1539
101 Ga0070685_10065705 3300005466 Bacteria 2135
102 Ga0070707_100040857 3300005468 Bacteria 4438
103 Ga0070707_100067550 3300005468 Unclassified 3439
104 Ga0070698_100008063 3300005471 Bacteria 11394
105 Ga0070698_100373254 3300005471 Bacteria 1359
106 Ga0070699_100015391 3300005518 Bacteria 6574
107 Ga0070699_100042556 3300005518 Unclassified 3931
108 Ga0070699_100264644 3300005518 Unclassified 1538
109 Ga0070699_100421729 3300005518 Bacteria 1208
110 Ga0070679_100247742 3300005530 Bacteria 1738
111 Ga0070697_100021645 3300005536 Bacteria 5096
112 Ga0070672_100003914 3300005543 Bacteria 9702
113 Ga0070672_100008279 3300005543 Bacteria 7106
114 Ga0070672_100015999 3300005543 Bacteria 5360
115 Ga0070672_100024609 3300005543 Bacteria 4453
116 Ga0070672_100096494 3300005543 Bacteria 2392
117 Ga0070672_100169999 3300005543 Bacteria 1812
118 Ga0070672_100193374 3300005543 Bacteria 1699
119 Ga0070672_100340655 3300005543 Bacteria 1277
120 Ga0070686_100067381 3300005544 Unclassified 2332
121 Ga0070686_100106270 3300005544 Unclassified 1905
122 Ga0070686_100127192 3300005544 Bacteria 1757
123 Ga0070695_100000102 3300005545 Bacteria 37412
124 Ga0070696_100134165 3300005546 Unclassified 1804
125 Ga0070693_100032298 3300005547 Bacteria 2877
126 Ga0070665_100134590 3300005548 Bacteria 2473
127 Ga0070704_100036486 3300005549 Bacteria 3351
128 Ga0070664_100020927 3300005564 Bacteria 5390
129 Ga0070664_100027053 3300005564 Bacteria 4764
130 Ga0070664_100027251 3300005564 Bacteria 4747
131 Ga0068857_100009649 3300005577 Bacteria 8386
132 Ga0068857_100028877 3300005577 Bacteria 4894
133 Ga0068857_100091113 3300005577 Bacteria 2729
134 Ga0068854_100040865 3300005578 Bacteria 3274
135 Ga0070702_100018990 3300005615 Bacteria 3575
136 Ga0070702_100064147 3300005615 Bacteria 2148
137 Ga0068852_100131624 3300005616 Bacteria 2304
138 Ga0068859_100000459 3300005617 Bacteria 40396
139 Ga0068859_100006392 3300005617 Bacteria 11956
140 Ga0068859_100041433 3300005617 Bacteria 4625
141 Ga0068859_100085150 3300005617 Bacteria 3206
142 Ga0068859_100632179 3300005617 Bacteria 1163
143 Ga0068864_100015505 3300005618 Bacteria 6337
144 Ga0068864_100022648 3300005618 Bacteria 5269
145 Ga0068864_100030452 3300005618 Unclassified 4574
146 Ga0068864_100054827 3300005618 Bacteria 3441
147 Ga0068861_100005774 3300005719 Bacteria 8398
148 Ga0068861_100033621 3300005719 Bacteria 3785
149 Ga0068861_100168189 3300005719 Unclassified 1815
150 Ga0068870_10002247 3300005840 Bacteria 8022
151 Ga0068870_10020503 3300005840 Bacteria 3220
152 Ga0068870_10041255 3300005840 Bacteria 2397
153 Ga0068870_10053893 3300005840 Bacteria 2138
154 Ga0068863_100016660 3300005841 Bacteria 7052
155 Ga0068863_100037284 3300005841 Bacteria 4629
156 Ga0068863_100084580 3300005841 Bacteria 3006
157 Ga0068858_100008010 3300005842 Bacteria 10180
158 Ga0068858_100138947 3300005842 Unclassified 2280
159 Ga0068858_100140746 3300005842 Bacteria 2265
160 Ga0068860_100088839 3300005843 Bacteria 2942
161 Ga0068860_100150549 3300005843 Unclassified 2240
162 Ga0068862_100004233 3300005844 Bacteria 12157
163 Ga0068862_100108706 3300005844 Bacteria 2432
164 Ga0068862_100145040 3300005844 Bacteria 2109
165 Ga0081539_10000093 3300005985 Bacteria 207314
166 Ga0081539_10001997 3300005985 Bacteria 30967
167 Ga0081539_10008783 3300005985 Bacteria 8660
168 Ga0075365_10003211 3300006038 Bacteria 8360
169 Ga0075364_10016517 3300006051 Bacteria 4593
170 Ga0075367_10005389 3300006178 Bacteria 6346
171 Ga0075367_10210203 3300006178 Bacteria 1216
172 Ga0075366_10030064 3300006195 Bacteria 3192
173 Ga0075366_10064074 3300006195 Bacteria 2185
174 Ga0097621_100018708 3300006237 Bacteria 5300
175 Ga0075370_10060517 3300006353 Bacteria 2157
176 Ga0068871_100119157 3300006358 Bacteria 2228
177 Ga0075428_100001255 3300006844 Bacteria 27133
178 Ga0075428_100004233 3300006844 Bacteria 15796
179 Ga0075428_100023809 3300006844 Bacteria 6776
180 Ga0075428_100030417 3300006844 Bacteria 5971
181 Ga0075428_100034854 3300006844 Bacteria 5550
182 Ga0075428_100082065 3300006844 Unclassified 3518
183 Ga0075428_100156350 3300006844 Bacteria 2477
184 Ga0075428_100196420 3300006844 Bacteria 2182
185 Ga0075428_100291906 3300006844 Bacteria 1754
186 Ga0075428_100429726 3300006844 Bacteria 1415
187 Ga0075430_100001090 3300006846 Bacteria 21567
188 Ga0075430_100002851 3300006846 Bacteria 14473
189 Ga0075430_100005495 3300006846 Bacteria 10709
190 Ga0075430_100009021 3300006846 Bacteria 8429
191 Ga0075430_100033567 3300006846 Bacteria 4356
192 Ga0075430_100062744 3300006846 Bacteria 3121
193 Ga0075431_100004139 3300006847 Bacteria 14158
194 Ga0075431_100013770 3300006847 Bacteria 8168
195 Ga0075431_100080482 3300006847 Bacteria 3363
196 Ga0075431_100122105 3300006847 Bacteria 2688
197 Ga0075431_100240950 3300006847 Bacteria 1840
198 Ga0075433_10005324 3300006852 Bacteria 10093
199 Ga0075433_10019804 3300006852 Bacteria 5615
200 Ga0075433_10021868 3300006852 Bacteria 5366
201 Ga0075433_10033893 3300006852 Unclassified 4381
202 Ga0075433_10052443 3300006852 Bacteria 3554
203 Ga0075434_100001711 3300006871 Bacteria 18790
204 Ga0075434_100001730 3300006871 Bacteria 18736
205 Ga0075434_100030412 3300006871 Bacteria 5317
206 Ga0075434_100046243 3300006871 Unclassified 4319
207 Ga0075434_100166817 3300006871 Unclassified 2222
208 Ga0075434_100490664 3300006871 Bacteria 1249
209 Ga0075429_100001936 3300006880 Bacteria 17171
210 Ga0075429_100011739 3300006880 Bacteria 7598
211 Ga0075429_100013624 3300006880 Bacteria 7054
212 Ga0075429_100041462 3300006880 Bacteria 4009
213 Ga0075429_100066927 3300006880 Unclassified 3127
214 Ga0068865_100036934 3300006881 Bacteria 3296
215 Ga0068865_100105801 3300006881 Unclassified 2067
216 Ga0068865_100127457 3300006881 Bacteria 1902
217 Ga0097620_100000459 3300006931 Bacteria 40396
218 Ga0097620_100006392 3300006931 Bacteria 11956
219 Ga0097620_100041434 3300006931 Bacteria 4625
220 Ga0097620_100085145 3300006931 Bacteria 3206
221 Ga0097620_100632126 3300006931 Bacteria 1163
222 Ga0075435_100004581 3300007076 Bacteria 9517
223 Ga0075435_100028340 3300007076 Bacteria 4391
224 Ga0075435_100108242 3300007076 Unclassified 2309
225 Ga0075435_100245507 3300007076 Unclassified 1523
226 Ga0105240_10530511 3300009093 Bacteria 1305
227 Ga0111539_10000040 3300009094 Bacteria 136085
228 Ga0111539_10000465 3300009094 Bacteria 50988
229 Ga0111539_10002493 3300009094 Bacteria 24401
230 Ga0111539_10004729 3300009094 Bacteria 17791
231 Ga0111539_10006884 3300009094 Bacteria 14603
232 Ga0111539_10007204 3300009094 Bacteria 14254
233 Ga0111539_10013195 3300009094 Bacteria 10331
234 Ga0111539_10014889 3300009094 Bacteria 9695
235 Ga0111539_10017801 3300009094 Bacteria 8798
236 Ga0111539_10076513 3300009094 Bacteria 3940
237 Ga0111539_10192573 3300009094 Bacteria 2379
238 Ga0111539_10240544 3300009094 Bacteria 2107
239 Ga0111539_10255928 3300009094 Unclassified 2039
240 Ga0111539_10756038 3300009094 Bacteria 1131
241 Ga0105245_10016854 3300009098 Bacteria 6379
242 Ga0114129_10002401 3300009147 Bacteria 26029
243 Ga0114129_10004302 3300009147 Bacteria 20120
244 Ga0114129_10005462 3300009147 Bacteria 17965
245 Ga0114129_10006077 3300009147 Bacteria 17112
246 Ga0114129_10019676 3300009147 Bacteria 9609
247 Ga0114129_10027295 3300009147 Bacteria 8084
248 Ga0114129_10143778 3300009147 Bacteria 3268
249 Ga0114129_10166422 3300009147 Bacteria 3008
250 Ga0114129_10548740 3300009147 Bacteria 1503
251 Ga0114129_10580200 3300009147 Bacteria 1455
252 Ga0105243_10026115 3300009148 Bacteria 4469
253 Ga0105243_10026216 3300009148 Bacteria 4461
254 Ga0105243_10061941 3300009148 Bacteria 2994
255 Ga0105243_10555964 3300009148 Bacteria 1097
256 Ga0105242_10096002 3300009176 Bacteria 2503
257 Ga0105248_10014948 3300009177 Bacteria 8545
258 Ga0105248_10040061 3300009177 Bacteria 5251
259 Ga0105248_10133973 3300009177 Unclassified 2796
260 Ga0105249_10006847 3300009553 Bacteria 9940
261 Ga0105249_10026619 3300009553 Bacteria 5215
262 Ga0105249_10278407 3300009553 Bacteria 1670
263 Ga0157374_10097598 3300013296 Bacteria 2812
264 Ga0157374_10297420 3300013296 Bacteria 1596
265 Ga0157378_10391080 3300013297 Unclassified 1368
266 Ga0157378_10670008 3300013297 Bacteria 1055
267 Ga0163162_10005469 3300013306 Bacteria 12276
268 Ga0157375_10009065 3300013308 Bacteria 8710
269 Ga0163163_10077478 3300014325 Bacteria 3320
270 Ga0157380_10000369 3300014326 Bacteria 27154
271 Ga0157380_10019490 3300014326 Bacteria 5056
272 Ga0157380_10064470 3300014326 Bacteria 2941
273 Ga0157380_10076442 3300014326 Bacteria 2725
274 Ga0157380_10183238 3300014326 Unclassified 1842
275 Ga0157380_10215393 3300014326 Unclassified 1715
276 Ga0157380_10219053 3300014326 Bacteria 1701
277 Ga0157380_10294881 3300014326 Unclassified 1491
278 Ga0157377_10020689 3300014745 Bacteria 3451
279 Ga0157377_10024599 3300014745 Bacteria 3202
280 Ga0157377_10048258 3300014745 Bacteria 2388
281 Ga0157377_10118619 3300014745 Bacteria 1600
282 Ga0157377_10205602 3300014745 Bacteria 1252
283 Ga0157379_10014028 3300014968 Bacteria 7022
284 Ga0157376_10048059 3300014969 Bacteria 3526
285 Ga0157376_10120808 3300014969 Bacteria 2321
286 Ga0163161_10047090 3300017792 Bacteria 3113
287 Ga0163161_10087708 3300017792 Unclassified 2299
288 Ga0207697_10015924 3300025315 Bacteria 3102
289 Ga0207682_10000139 3300025893 Bacteria 32685
290 Ga0207682_10004632 3300025893 Bacteria 5714
291 Ga0207682_10008731 3300025893 Bacteria 4009
292 Ga0207688_10001936 3300025901 Bacteria 11088
293 Ga0207688_10003546 3300025901 Bacteria 8516
294 Ga0207688_10030191 3300025901 Bacteria 2988
295 Ga0207688_10143818 3300025901 Bacteria 1405
296 Ga0207680_10069597 3300025903 Unclassified 2175
297 Ga0207647_10130937 3300025904 Bacteria 1474
298 Ga0207645_10002241 3300025907 Bacteria 15394
299 Ga0207645_10009375 3300025907 Bacteria 6774
300 Ga0207645_10018389 3300025907 Bacteria 4597
301 Ga0207645_10195299 3300025907 Unclassified 1330
302 Ga0207643_10001178 3300025908 Bacteria 15524
303 Ga0207643_10006620 3300025908 Bacteria 6214
304 Ga0207643_10008746 3300025908 Bacteria 5433
305 Ga0207643_10035502 3300025908 Bacteria 2796
306 Ga0207662_10005189 3300025918 Bacteria 6914
307 Ga0207662_10044721 3300025918 Bacteria 2615
308 Ga0207662_10214707 3300025918 Bacteria 1250
309 Ga0207649_10113047 3300025920 Bacteria 1818
310 Ga0207652_10104468 3300025921 Bacteria 2506
311 Ga0207681_10019134 3300025923 Bacteria 4324
312 Ga0207681_10026181 3300025923 Bacteria 3760
313 Ga0207681_10029582 3300025923 Bacteria 3560
314 Ga0207681_10061657 3300025923 Unclassified 2579
315 Ga0207681_10066903 3300025923 Bacteria 2489
316 Ga0207681_10103711 3300025923 Bacteria 2056
317 Ga0207681_10127225 3300025923 Bacteria 1878
318 Ga0207681_10221775 3300025923 Bacteria 1463
319 Ga0207650_10048273 3300025925 Unclassified 3140
320 Ga0207650_10092664 3300025925 Unclassified 2311
321 Ga0207659_10000617 3300025926 Bacteria 21204
322 Ga0207659_10031802 3300025926 Bacteria 3616
323 Ga0207659_10093995 3300025926 Bacteria 2245
324 Ga0207659_10154396 3300025926 Bacteria 1796
325 Ga0207659_10256143 3300025926 Bacteria 1422
326 Ga0207659_10314136 3300025926 Bacteria 1291
327 Ga0207700_10039336 3300025928 Unclassified 3442
328 Ga0207644_10070550 3300025931 Bacteria 2554
329 Ga0207690_10135769 3300025932 Unclassified 1806
330 Ga0207706_10004608 3300025933 Bacteria 12938
331 Ga0207706_10008838 3300025933 Bacteria 9271
332 Ga0207706_10101887 3300025933 Unclassified 2526
333 Ga0207706_10137874 3300025933 Bacteria 2146
334 Ga0207706_10217965 3300025933 Bacteria 1672
335 Ga0207709_10016583 3300025935 Bacteria 4097
336 Ga0207670_10004689 3300025936 Bacteria 7412
337 Ga0207670_10013796 3300025936 Bacteria 4778
338 Ga0207670_10049236 3300025936 Bacteria 2817
339 Ga0207669_10003433 3300025937 Bacteria 6849
340 Ga0207704_10009137 3300025938 Bacteria 4769
341 Ga0207704_10035062 3300025938 Bacteria 2870
342 Ga0207704_10044601 3300025938 Bacteria 2628
343 Ga0207704_10104335 3300025938 Bacteria 1898
344 Ga0207691_10005343 3300025940 Bacteria 12400
345 Ga0207691_10007757 3300025940 Bacteria 10334
346 Ga0207691_10015851 3300025940 Bacteria 7163
347 Ga0207691_10027869 3300025940 Bacteria 5293
348 Ga0207691_10117911 3300025940 Bacteria 2355
349 Ga0207691_10120332 3300025940 Bacteria 2328
350 Ga0207691_10128683 3300025940 Bacteria 2238
351 Ga0207711_10137987 3300025941 Bacteria 2192
352 Ga0207711_10206169 3300025941 Bacteria 1795
353 Ga0207689_10001767 3300025942 Bacteria 20394
354 Ga0207689_10032790 3300025942 Bacteria 4318
355 Ga0207689_10075257 3300025942 Bacteria 2775
356 Ga0207689_10095531 3300025942 Bacteria 2441
357 Ga0207689_10095537 3300025942 Bacteria 2441
358 Ga0207661_10025066 3300025944 Unclassified 4530
359 Ga0207679_10013217 3300025945 Bacteria 5408
360 Ga0207679_10048707 3300025945 Unclassified 3087
361 Ga0207679_10199730 3300025945 Bacteria 1669
362 Ga0207651_10002809 3300025960 Bacteria 8373
363 Ga0207651_10007566 3300025960 Bacteria 5795
364 Ga0207651_10047572 3300025960 Bacteria 2893
365 Ga0207651_10088650 3300025960 Bacteria 2256
366 Ga0207651_10238769 3300025960 Bacteria 1480
367 Ga0207712_10007908 3300025961 Bacteria 6718
368 Ga0207640_10256497 3300025981 Bacteria 1360
369 Ga0207658_10048860 3300025986 Bacteria 3105
370 Ga0207658_10401637 3300025986 Bacteria 1205
371 Ga0207677_10093036 3300026023 Bacteria 2197
372 Ga0207703_10015787 3300026035 Bacteria 5890
373 Ga0207703_10042575 3300026035 Bacteria 3643
374 Ga0207703_10222426 3300026035 Bacteria 1689
375 Ga0207678_10034790 3300026067 Bacteria 4388
376 Ga0207708_10009001 3300026075 Bacteria 7390
377 Ga0207708_10019636 3300026075 Bacteria 5096
378 Ga0207708_10033389 3300026075 Bacteria 3910
379 Ga0207708_10104785 3300026075 Unclassified 2191
380 Ga0207708_10137666 3300026075 Bacteria 1913
381 Ga0207708_10175154 3300026075 Bacteria 1701
382 Ga0207708_10220470 3300026075 Bacteria 1519
383 Ga0207641_10052416 3300026088 Bacteria 3455
384 Ga0207641_10118438 3300026088 Bacteria 2359
385 Ga0207641_10271722 3300026088 Bacteria 1591
386 Ga0207648_10000375 3300026089 Bacteria 49109
387 Ga0207648_10011159 3300026089 Bacteria 8476
388 Ga0207648_10014276 3300026089 Bacteria 7342
389 Ga0207648_10100505 3300026089 Bacteria 2534
390 Ga0207676_10270722 3300026095 Bacteria 1538
391 Ga0207674_10038952 3300026116 Bacteria 4929
392 Ga0207674_10042147 3300026116 Bacteria 4717
393 Ga0207674_10149243 3300026116 Unclassified 2295
394 Ga0207674_10179429 3300026116 Bacteria 2069
395 Ga0207675_100005097 3300026118 Bacteria 12640
396 Ga0207675_100005161 3300026118 Bacteria 12572
397 Ga0207675_100080696 3300026118 Bacteria 3050
398 Ga0207683_10028347 3300026121 Bacteria 4841
399 Ga0207683_10101372 3300026121 Bacteria 2570
400 Ga0207683_10102431 3300026121 Bacteria 2557
401 Ga0207683_10102820 3300026121 Bacteria 2552
402 Ga0207683_10167334 3300026121 Unclassified 1990
403 Ga0207428_10000750 3300027907 Bacteria 37156
404 Ga0207428_10001319 3300027907 Bacteria 26409
405 Ga0207428_10003324 3300027907 Bacteria 15634
406 Ga0207428_10005991 3300027907 Bacteria 11256
407 Ga0207428_10006349 3300027907 Bacteria 10935
408 Ga0207428_10013109 3300027907 Bacteria 7258
409 Ga0207428_10032221 3300027907 Bacteria 4313
410 Ga0268265_10000263 3300028380 Bacteria 59820
411 Ga0268265_10016194 3300028380 Bacteria 5118
412 Ga0268265_10108634 3300028380 Unclassified 2259
413 Ga0268265_10217867 3300028380 Bacteria 1668
414 Ga0268265_10252515 3300028380 Bacteria 1563
415 Ga0268265_10336916 3300028380 Bacteria 1372
416 Ga0268264_10002400 3300028381 Bacteria 16495
417 Ga0268264_10049927 3300028381 Bacteria 3482
418 Ga0268264_10092345 3300028381 Bacteria 2613
419 Ga0268264_10126791 3300028381 Unclassified 2257
420 Ga0307408_100000559 3300031548 Bacteria 32129
421 Ga0307407_10013328 3300031903 Bacteria 3986
422 Ga0307409_100034105 3300031995 Bacteria 3713
423 Ga0307416_100014688 3300032002 Bacteria 5380
424 Ga0307416_100171469 3300032002 Bacteria 2020
425 Ga0307416_100351958 3300032002 Bacteria 1491
426 Ga0307416_100516167 3300032002 Bacteria 1262
427 Ga0307411_10026784 3300032005 Bacteria 3476
428 Ga0307411_10106555 3300032005 Bacteria 1995
429 Ga0307415_100042982 3300032126 Bacteria 3011
430 Ga0373932_0015725 3300035112 Bacteria 1922
431 Ga0373931_0153463 3300035691 Bacteria 1344
432 Ga0373933_0041138 3300035724 Bacteria 2727
433 Ga0373947_0034276 3300035725 Bacteria 3002
434 Ga0373947_0191510 3300035725 Unclassified 1335
435 Ga0373937_0006141 3300036401 Bacteria 10343
436 Ga0373925_0035988 3300037068 Bacteria 3654
437 Ga0451807_2469453 3300041486 Bacteria 1443
438 Ga0439450_005826 3300042008 Bacteria 2189
439 Ga0439450_013275 3300042008 Bacteria 1652
440 Ga0450923_005171 3300042125 Unclassified 2091
441 Ga0439464_0005119 3300042439 Bacteria 3374
442 Ga0453683_0214270 3300044673 Bacteria 1224
443 Ga0451576_0024372 3300045051 Bacteria 6535
444 Ga0451576_0029521 3300045051 Bacteria 5867
445 Ga0451576_0159236 3300045051 Bacteria 2355
446 Ga0451576_0361296 3300045051 Bacteria 1521
447 Ga0495603_0084178 3300046455 Bacteria 1862
448 Ga0495629_0003222 3300046459 Bacteria 12351
449 Ga0495582_0033481 3300046473 Bacteria 2825
450 Ga0495582_0144120 3300046473 Unclassified 1351
451 Ga0495584_0122747 3300046491 Bacteria 1316
452 Ga0495594_0087102 3300046499 Unclassified 1747
453 Ga0495643_0003874 3300046522 Bacteria 10750
454 Ga0495642_0013249 3300046528 Bacteria 3187
455 Ga0495609_0035857 3300046538 Unclassified 2243
456 Ga0495621_0000764 3300046539 Bacteria 8145
457 Ga0495622_0088430 3300046557 Bacteria 1424
458 Ga0495633_0070797 3300046558 Bacteria 1627
459 Ga0495659_0026780 3300046664 Unclassified 1984
460 Ga0495659_0039453 3300046664 Bacteria 1679
461 Ga0495659_0079583 3300046664 Bacteria 1241
462 Ga0495588_0001691 3300046674 Bacteria 9392
463 Ga0495670_0052328 3300046691 Bacteria 2044
464 Ga0495636_0006616 3300047318 Bacteria 4556
465 Ga0495676_0041004 3300047321 Bacteria 3815
466 Ga0496109_0239044 3300048912 Bacteria 1709
467 Ga0496113_0255267 3300048916 Bacteria 1400
468 Ga0501034_0056321 3300049571 Bacteria 3956
469 Ga0501039_0006794 3300049575 Bacteria 8701
470 Ga0501040_0044695 3300049576 Unclassified 3020
471 Ga0501040_0129415 3300049576 Bacteria 1774
472 Ga0501041_0004230 3300049577 Bacteria 8311
473 Ga0501042_0004487 3300049578 Bacteria 8905
474 Ga0501072_0109737 3300049588 Unclassified 2196
475 Ga0501075_0007297 3300049591 Bacteria 7665
476 Ga0501075_0127704 3300049591 Bacteria 1936
477 Ga0501076_0040803 3300049592 Unclassified 3648
478 Ga0501217_012511 3300049661 Bacteria 1891
479 Ga0501217_025215 3300049661 Unclassified 1429
480 Ga0501079_0095319 3300049741 Bacteria 2306
481 Ga0501080_0149697 3300049742 Bacteria 2158
482 Ga0501081_0042538 3300049743 Unclassified 3113
483 Ga0501083_0360123 3300049744 Bacteria 946
484 Ga0501044_0026417 3300049823 Bacteria 6144
485 Ga0501045_0010502 3300049824 Bacteria 6486
486 Ga0501045_0115477 3300049824 Bacteria 1991
487 nmdc:mga03683_4517_c1 3300050489 Bacteria 4629
488 nmdc:mga00v17_140757_c1 3300050491 Bacteria 1547
489 nmdc:mga00v17_1939_c1 3300050491 Bacteria 10684
490 nmdc:mga0yw44_98960_c1 3300050492 Bacteria 1855
491 nmdc:mga0k408_29825_c1 3300050493 Bacteria 3107
492 nmdc:mga06z11_35931_c1 3300050494 Bacteria 2442
493 nmdc:mga06z11_43569_c1 3300050494 Bacteria 2259
494 nmdc:mga05p37_108082_c1 3300050507 Unclassified 3422
495 nmdc:mga05p37_1148_c1 3300050507 Bacteria 30482
496 nmdc:mga05p37_163460_c1 3300050507 Bacteria 2718
497 nmdc:mga05p37_320977_c1 3300050507 Unclassified 1833
498 nmdc:mga05p37_33553_c1 3300050507 Bacteria 6287
499 nmdc:mga05p37_341376_c1 3300050507 Unclassified 1766
500 nmdc:mga05p37_3595_c1 3300050507 Bacteria 18111
501 nmdc:mga05p37_400215_c1 3300050507 Bacteria 1603
502 nmdc:mga05p37_433259_c1 3300050507 Bacteria 1527
503 nmdc:mga05p37_4471_c1 3300050507 Bacteria 16336
504 nmdc:mga05p37_552323_c1 3300050507 Bacteria 1311
505 nmdc:mga09592_115130_c1 3300050508 Unclassified 2308
506 nmdc:mga09592_24167_c1 3300050508 Bacteria 5024
507 nmdc:mga09592_59957_c1 3300050508 Unclassified 3217
508 nmdc:mga09592_69785_c1 3300050508 Bacteria 2981
509 nmdc:mga09592_86496_c1 3300050508 Unclassified 2675
510 nmdc:mga0qj67_276313_c1 3300050509 Bacteria 1362
511 nmdc:mga0qj67_30242_c1 3300050509 Bacteria 4213
512 nmdc:mga0qj67_480202_c1 3300050509 Bacteria 1000
513 nmdc:mga0qj67_4864_c2 3300050509 Bacteria 9271
514 nmdc:mga0qj67_70020_c1 3300050509 Bacteria 2798
515 nmdc:mga06r32_349650_c1 3300050510 Bacteria 1463
516 nmdc:mga06r32_39152_c1 3300050510 Unclassified 4497
517 nmdc:mga06r32_81377_c1 3300050510 Bacteria 3154
518 nmdc:mga06r32_85540_c1 3300050510 Unclassified 3075
519 nmdc:mga08y16_105820_c1 3300050511 Bacteria 2929
520 nmdc:mga08y16_1149_c1 3300050511 Bacteria 26073
521 nmdc:mga08y16_14292_c1 3300050511 Bacteria 8357
522 nmdc:mga08y16_156_c1 3300050511 Bacteria 59323
523 nmdc:mga08y16_178577_c1 3300050511 Bacteria 2205
524 nmdc:mga08y16_25196_c1 3300050511 Bacteria 6272
525 nmdc:mga08y16_339523_c1 3300050511 Unclassified 1544
526 nmdc:mga08y16_355173_c1 3300050511 Unclassified 1505
527 nmdc:mga08y16_40753_c1 3300050511 Bacteria 4866
528 nmdc:mga08y16_639_c1 3300050511 Bacteria 32927
529 nmdc:mga08y16_83_c1 3300050511 Bacteria 80182
530 nmdc:mga0n895_130606_c1 3300050512 Unclassified 2537
531 nmdc:mga0n895_137637_c1 3300050512 Bacteria 2469
532 nmdc:mga0n895_300185_c1 3300050512 Unclassified 1628
533 nmdc:mga0n895_31123_c1 3300050512 Bacteria 5106
534 nmdc:mga0n895_3603_c1 3300050512 Bacteria 12518
535 nmdc:mga0n895_487445_c1 3300050512 Bacteria 1243
536 nmdc:mga0n895_51493_c1 3300050512 Bacteria 4039
537 nmdc:mga0rr50_206474_c1 3300050513 Unclassified 1617
538 nmdc:mga0rr50_407615_c1 3300050513 Bacteria 1149
539 nmdc:mga0rr50_5035_c1 3300050513 Bacteria 7833
540 nmdc:mga0rr50_773_c1 3300050513 Bacteria 17222
541 nmdc:mga0a205_229967_c1 3300050515 Bacteria 1738
542 nmdc:mga0a205_231649_c1 3300050515 Bacteria 1730
543 nmdc:mga0a205_38252_c1 3300050515 Bacteria 4615
544 nmdc:mga0a205_6894_c1 3300050515 Bacteria 10270
545 nmdc:mga0a205_9084_c1 3300050515 Bacteria 9068
546 Ga0500556_0016051 3300053104 Bacteria 2323
547 Ga0501084_0079406 3300054114 Bacteria 2750
548 Ga0590071_000024 3300059421 Bacteria 39075
549 Ga0590074_000167 3300059423 Bacteria 8029
550 Ga0590075_000297 3300059424 Bacteria 14053
551 Ga0590077_000948 3300059426 Bacteria 7399
552 Ga0590077_006313 3300059426 Bacteria 2431
553 Ga0501082_0027190 3300060353 Unclassified 4927
554 Ga0207648_10087878
555 SwRhRL2b_contig_3115889
556 JGI24751J29686_10018045
557 JGI25406J46586_10000419
558 Ga0065704_10004376
559 Ga0065712_10001274
560 Ga0065715_10013853
561 Ga0065715_10015399
562 Ga0065715_10103262
563 Ga0065715_10165631
564 Ga0065707_10001808
565 Ga0065707_10114722
566 Ga0070676_10009842
567 Ga0070676_10097243
568 Ga0070676_10174796
569 Ga0070683_100006888
570 Ga0070683_100012012
571 Ga0070690_100002535
572 Ga0070670_100011516
573 Ga0070670_100034960
574 Ga0070670_100176958
575 Ga0070677_10013120
576 Ga0070677_10017079
577 Ga0068869_100004047
578 Ga0068869_100008308
579 Ga0068869_100028707
580 Ga0068869_100088545
581 Ga0068869_100147466
582 Ga0068869_100163743
583 Ga0068869_100172445
584 Ga0068869_100198419
585 Ga0070680_100108341
586 Ga0070680_100203484
587 Ga0070680_100251269
588 Ga0070680_100369689
589 Ga0068868_100317641
590 Ga0070689_100004481
591 Ga0070689_100009330
592 Ga0070689_100012629
593 Ga0070691_10029367
594 Ga0070687_100073024
595 Ga0070687_100177566
596 Ga0070668_100212667
597 Ga0070668_100313630
598 Ga0070669_100000432
599 Ga0070669_100015719
600 Ga0070669_100033302
601 Ga0070669_100041323
602 Ga0070669_100105067
603 Ga0070669_100113828
604 Ga0070675_100000109
605 Ga0070675_100010250
606 Ga0070675_100029687
607 Ga0070675_100033933
608 Ga0070671_100007712
609 Ga0070671_100046552
610 Ga0070674_100009659
611 Ga0070674_100088033
612 Ga0070674_100119491
613 Ga0070673_100000486
614 Ga0070673_100026385
615 Ga0070673_100055049
616 Ga0070673_100081855
617 Ga0070673_100327996
618 Ga0070688_100001310
619 Ga0070688_100023382
620 Ga0070659_100164303
621 Ga0070659_100324656
622 Ga0070667_100020613
623 Ga0070667_100376699
624 Ga0070703_10027233
625 Ga0070701_10001780
626 Ga0070701_10021737
627 Ga0070701_10050933
628 Ga0070701_10066463
629 Ga0070701_10096996
630 Ga0070705_100000366
631 Ga0070705_100234836
632 Ga0070700_100040517
633 Ga0070700_100067086
634 Ga0070700_100077374
635 Ga0070700_100097524
636 Ga0070700_100122214
637 Ga0070700_100215905
638 Ga0070694_100014180
639 Ga0070694_100248969
640 Ga0070708_100102137
641 Ga0070708_100128766
642 Ga0070663_100010296
643 Ga0070663_100022604
644 Ga0070678_100111301
645 Ga0070678_100243134
646 Ga0070678_100316311
647 Ga0070662_100059024
648 Ga0070681_10025530
649 Ga0070681_10394414
650 Ga0068867_100016050
651 Ga0068867_100025615
652 Ga0068867_100082925
653 Ga0068867_100217160
654 Ga0070685_10065705
655 Ga0070707_100040857
656 Ga0070707_100067550
657 Ga0070698_100008063
658 Ga0070698_100373254
659 Ga0070699_100015391
660 Ga0070699_100042556
661 Ga0070699_100264644
662 Ga0070699_100421729
663 Ga0070679_100247742
664 Ga0070697_100021645
665 Ga0070672_100003914
666 Ga0070672_100008279
667 Ga0070672_100015999
668 Ga0070672_100024609
669 Ga0070672_100096494
670 Ga0070672_100169999
671 Ga0070672_100193374
672 Ga0070672_100340655
673 Ga0070686_100067381
674 Ga0070686_100106270
675 Ga0070686_100127192
676 Ga0070695_100000102
677 Ga0070696_100134165
678 Ga0070693_100032298
679 Ga0070665_100134590
680 Ga0070704_100036486
681 Ga0070664_100020927
682 Ga0070664_100027053
683 Ga0070664_100027251
684 Ga0068857_100009649
685 Ga0068857_100028877
686 Ga0068857_100091113
687 Ga0068854_100040865
688 Ga0070702_100018990
689 Ga0070702_100064147
690 Ga0068852_100131624
691 Ga0068859_100000459
692 Ga0068859_100006392
693 Ga0068859_100041433
694 Ga0068859_100085150
695 Ga0068859_100632179
696 Ga0068864_100015505
697 Ga0068864_100022648
698 Ga0068864_100030452
699 Ga0068864_100054827
700 Ga0068861_100005774
701 Ga0068861_100033621
702 Ga0068861_100168189
703 Ga0068870_10002247
704 Ga0068870_10020503
705 Ga0068870_10041255
706 Ga0068870_10053893
707 Ga0068863_100016660
708 Ga0068863_100037284
709 Ga0068863_100084580
710 Ga0068858_100008010
711 Ga0068858_100138947
712 Ga0068858_100140746
713 Ga0068860_100088839
714 Ga0068860_100150549
715 Ga0068862_100004233
716 Ga0068862_100108706
717 Ga0068862_100145040
718 Ga0081539_10000093
719 Ga0081539_10001997
720 Ga0081539_10008783
721 Ga0075365_10003211
722 Ga0075364_10016517
723 Ga0075367_10005389
724 Ga0075367_10210203
725 Ga0075366_10030064
726 Ga0075366_10064074
727 Ga0097621_100018708
728 Ga0075370_10060517
729 Ga0068871_100119157
730 Ga0075428_100001255
731 Ga0075428_100004233
732 Ga0075428_100023809
733 Ga0075428_100030417
734 Ga0075428_100034854
735 Ga0075428_100082065
736 Ga0075428_100156350
737 Ga0075428_100196420
738 Ga0075428_100291906
739 Ga0075428_100429726
740 Ga0075430_100001090
741 Ga0075430_100002851
742 Ga0075430_100005495
743 Ga0075430_100009021
744 Ga0075430_100033567
745 Ga0075430_100062744
746 Ga0075431_100004139
747 Ga0075431_100013770
748 Ga0075431_100080482
749 Ga0075431_100122105
750 Ga0075431_100240950
751 Ga0075433_10005324
752 Ga0075433_10019804
753 Ga0075433_10021868
754 Ga0075433_10033893
755 Ga0075433_10052443
756 Ga0075434_100001711
757 Ga0075434_100001730
758 Ga0075434_100030412
759 Ga0075434_100046243
760 Ga0075434_100166817
761 Ga0075434_100490664
762 Ga0075429_100001936
763 Ga0075429_100011739
764 Ga0075429_100013624
765 Ga0075429_100041462
766 Ga0075429_100066927
767 Ga0068865_100036934
768 Ga0068865_100105801
769 Ga0068865_100127457
770 Ga0097620_100000459
771 Ga0097620_100006392
772 Ga0097620_100041434
773 Ga0097620_100085145
774 Ga0097620_100632126
775 Ga0075435_100004581
776 Ga0075435_100028340
777 Ga0075435_100108242
778 Ga0075435_100245507
779 Ga0105240_10530511
780 Ga0111539_10000040
781 Ga0111539_10000465
782 Ga0111539_10002493
783 Ga0111539_10004729
784 Ga0111539_10006884
785 Ga0111539_10007204
786 Ga0111539_10013195
787 Ga0111539_10014889
788 Ga0111539_10017801
789 Ga0111539_10076513
790 Ga0111539_10192573
791 Ga0111539_10240544
792 Ga0111539_10255928
793 Ga0111539_10756038
794 Ga0105245_10016854
795 Ga0114129_10002401
796 Ga0114129_10004302
797 Ga0114129_10005462
798 Ga0114129_10006077
799 Ga0114129_10019676
800 Ga0114129_10027295
801 Ga0114129_10143778
802 Ga0114129_10166422
803 Ga0114129_10548740
804 Ga0114129_10580200
805 Ga0105243_10026115
806 Ga0105243_10026216
807 Ga0105243_10061941
808 Ga0105243_10555964
809 Ga0105242_10096002
810 Ga0105248_10014948
811 Ga0105248_10040061
812 Ga0105248_10133973
813 Ga0105249_10006847
814 Ga0105249_10026619
815 Ga0105249_10278407
816 Ga0157374_10097598
817 Ga0157374_10297420
818 Ga0157378_10391080
819 Ga0157378_10670008
820 Ga0163162_10005469
821 Ga0157375_10009065
822 Ga0163163_10077478
823 Ga0157380_10000369
824 Ga0157380_10019490
825 Ga0157380_10064470
826 Ga0157380_10076442
827 Ga0157380_10183238
828 Ga0157380_10215393
829 Ga0157380_10219053
830 Ga0157380_10294881
831 Ga0157377_10020689
832 Ga0157377_10024599
833 Ga0157377_10048258
834 Ga0157377_10118619
835 Ga0157377_10205602
836 Ga0157379_10014028
837 Ga0157376_10048059
838 Ga0157376_10120808
839 Ga0163161_10047090
840 Ga0163161_10087708
841 Ga0207697_10015924
842 Ga0207682_10000139
843 Ga0207682_10004632
844 Ga0207682_10008731
845 Ga0207688_10001936
846 Ga0207688_10003546
847 Ga0207688_10030191
848 Ga0207688_10143818
849 Ga0207680_10069597
850 Ga0207647_10130937
851 Ga0207645_10002241
852 Ga0207645_10009375
853 Ga0207645_10018389
854 Ga0207645_10195299
855 Ga0207643_10001178
856 Ga0207643_10006620
857 Ga0207643_10008746
858 Ga0207643_10035502
859 Ga0207662_10005189
860 Ga0207662_10044721
861 Ga0207662_10214707
862 Ga0207649_10113047
863 Ga0207652_10104468
864 Ga0207681_10019134
865 Ga0207681_10026181
866 Ga0207681_10029582
867 Ga0207681_10061657
868 Ga0207681_10066903
869 Ga0207681_10103711
870 Ga0207681_10127225
871 Ga0207681_10221775
872 Ga0207650_10048273
873 Ga0207650_10092664
874 Ga0207659_10000617
875 Ga0207659_10031802
876 Ga0207659_10093995
877 Ga0207659_10154396
878 Ga0207659_10256143
879 Ga0207659_10314136
880 Ga0207700_10039336
881 Ga0207644_10070550
882 Ga0207690_10135769
883 Ga0207706_10004608
884 Ga0207706_10008838
885 Ga0207706_10101887
886 Ga0207706_10137874
887 Ga0207706_10217965
888 Ga0207709_10016583
889 Ga0207670_10004689
890 Ga0207670_10013796
891 Ga0207670_10049236
892 Ga0207669_10003433
893 Ga0207704_10009137
894 Ga0207704_10035062
895 Ga0207704_10044601
896 Ga0207704_10104335
897 Ga0207691_10005343
898 Ga0207691_10007757
899 Ga0207691_10015851
900 Ga0207691_10027869
901 Ga0207691_10117911
902 Ga0207691_10120332
903 Ga0207691_10128683
904 Ga0207711_10137987
905 Ga0207711_10206169
906 Ga0207689_10001767
907 Ga0207689_10032790
908 Ga0207689_10075257
909 Ga0207689_10095531
910 Ga0207689_10095537
911 Ga0207661_10025066
912 Ga0207679_10013217
913 Ga0207679_10048707
914 Ga0207679_10199730
915 Ga0207651_10002809
916 Ga0207651_10007566
917 Ga0207651_10047572
918 Ga0207651_10088650
919 Ga0207651_10238769
920 Ga0207712_10007908
921 Ga0207640_10256497
922 Ga0207658_10048860
923 Ga0207658_10401637
924 Ga0207677_10093036
925 Ga0207703_10015787
926 Ga0207703_10042575
927 Ga0207703_10222426
928 Ga0207678_10034790
929 Ga0207708_10009001
930 Ga0207708_10019636
931 Ga0207708_10033389
932 Ga0207708_10104785
933 Ga0207708_10137666
934 Ga0207708_10175154
935 Ga0207708_10220470
936 Ga0207641_10052416
937 Ga0207641_10118438
938 Ga0207641_10271722
939 Ga0207648_10000375
940 Ga0207648_10011159
941 Ga0207648_10014276
942 Ga0207648_10100505
943 Ga0207676_10270722
944 Ga0207674_10038952
945 Ga0207674_10042147
946 Ga0207674_10149243
947 Ga0207674_10179429
948 Ga0207675_100005097
949 Ga0207675_100005161
950 Ga0207675_100080696
951 Ga0207683_10028347
952 Ga0207683_10101372
953 Ga0207683_10102431
954 Ga0207683_10102820
955 Ga0207683_10167334
956 Ga0207428_10000750
957 Ga0207428_10001319
958 Ga0207428_10003324
959 Ga0207428_10005991
960 Ga0207428_10006349
961 Ga0207428_10013109
962 Ga0207428_10032221
963 Ga0268265_10000263
964 Ga0268265_10016194
965 Ga0268265_10108634
966 Ga0268265_10217867
967 Ga0268265_10252515
968 Ga0268265_10336916
969 Ga0268264_10002400
970 Ga0268264_10049927
971 Ga0268264_10092345
972 Ga0268264_10126791
973 Ga0307408_100000559
974 Ga0307407_10013328
975 Ga0307409_100034105
976 Ga0307416_100014688
977 Ga0307416_100171469
978 Ga0307416_100351958
979 Ga0307416_100516167
980 Ga0307411_10026784
981 Ga0307411_10106555
982 Ga0307415_100042982
983 Ga0373932_0015725
984 Ga0373931_0153463
985 Ga0373933_0041138
986 Ga0373947_0034276
987 Ga0373947_0191510
988 Ga0373937_0006141
989 Ga0373925_0035988
990 Ga0451807_2469453
991 Ga0439450_005826
992 Ga0439450_013275
993 Ga0450923_005171
994 Ga0439464_0005119
995 Ga0453683_0214270
996 Ga0451576_0024372
997 Ga0451576_0029521
998 Ga0451576_0159236
999 Ga0451576_0361296
1000 Ga0495603_0084178
1001 Ga0495629_0003222
1002 Ga0495582_0033481
1003 Ga0495582_0144120
1004 Ga0495584_0122747
1005 Ga0495594_0087102
1006 Ga0495643_0003874
1007 Ga0495642_0013249
1008 Ga0495609_0035857
1009 Ga0495621_0000764
1010 Ga0495622_0088430
1011 Ga0495633_0070797
1012 Ga0495659_0026780
1013 Ga0495659_0039453
1014 Ga0495659_0079583
1015 Ga0495588_0001691
1016 Ga0495670_0052328
1017 Ga0495636_0006616
1018 Ga0495676_0041004
1019 Ga0496109_0239044
1020 Ga0496113_0255267
1021 Ga0501034_0056321
1022 Ga0501039_0006794
1023 Ga0501040_0044695
1024 Ga0501040_0129415
1025 Ga0501041_0004230
1026 Ga0501042_0004487
1027 Ga0501072_0109737
1028 Ga0501075_0007297
1029 Ga0501075_0127704
1030 Ga0501076_0040803
1031 Ga0501217_012511
1032 Ga0501217_025215
1033 Ga0501079_0095319
1034 Ga0501080_0149697
1035 Ga0501081_0042538
1036 Ga0501083_0360123
1037 Ga0501044_0026417
1038 Ga0501045_0010502
1039 Ga0501045_0115477
1040 nmdc:mga03683_4517_c1
1041 nmdc:mga00v17_140757_c1
1042 nmdc:mga00v17_1939_c1
1043 nmdc:mga0yw44_98960_c1
1044 nmdc:mga0k408_29825_c1
1045 nmdc:mga06z11_35931_c1
1046 nmdc:mga06z11_43569_c1
1047 nmdc:mga05p37_108082_c1
1048 nmdc:mga05p37_1148_c1
1049 nmdc:mga05p37_163460_c1
1050 nmdc:mga05p37_320977_c1
1051 nmdc:mga05p37_33553_c1
1052 nmdc:mga05p37_341376_c1
1053 nmdc:mga05p37_3595_c1
1054 nmdc:mga05p37_400215_c1
1055 nmdc:mga05p37_433259_c1
1056 nmdc:mga05p37_4471_c1
1057 nmdc:mga05p37_552323_c1
1058 nmdc:mga09592_115130_c1
1059 nmdc:mga09592_24167_c1
1060 nmdc:mga09592_59957_c1
1061 nmdc:mga09592_69785_c1
1062 nmdc:mga09592_86496_c1
1063 nmdc:mga0qj67_276313_c1
1064 nmdc:mga0qj67_30242_c1
1065 nmdc:mga0qj67_480202_c1
1066 nmdc:mga0qj67_4864_c2
1067 nmdc:mga0qj67_70020_c1
1068 nmdc:mga06r32_349650_c1
1069 nmdc:mga06r32_39152_c1
1070 nmdc:mga06r32_81377_c1
1071 nmdc:mga06r32_85540_c1
1072 nmdc:mga08y16_105820_c1
1073 nmdc:mga08y16_1149_c1
1074 nmdc:mga08y16_14292_c1
1075 nmdc:mga08y16_156_c1
1076 nmdc:mga08y16_178577_c1
1077 nmdc:mga08y16_25196_c1
1078 nmdc:mga08y16_339523_c1
1079 nmdc:mga08y16_355173_c1
1080 nmdc:mga08y16_40753_c1
1081 nmdc:mga08y16_639_c1
1082 nmdc:mga08y16_83_c1
1083 nmdc:mga0n895_130606_c1
1084 nmdc:mga0n895_137637_c1
1085 nmdc:mga0n895_300185_c1
1086 nmdc:mga0n895_31123_c1
1087 nmdc:mga0n895_3603_c1
1088 nmdc:mga0n895_487445_c1
1089 nmdc:mga0n895_51493_c1
1090 nmdc:mga0rr50_206474_c1
1091 nmdc:mga0rr50_407615_c1
1092 nmdc:mga0rr50_5035_c1
1093 nmdc:mga0rr50_773_c1
1094 nmdc:mga0a205_229967_c1
1095 nmdc:mga0a205_231649_c1
1096 nmdc:mga0a205_38252_c1
1097 nmdc:mga0a205_6894_c1
1098 nmdc:mga0a205_9084_c1
1099 Ga0500556_0016051
1100 Ga0501084_0079406
1101 Ga0590071_000024
1102 Ga0590074_000167
1103 Ga0590075_000297
1104 Ga0590077_000948
1105 Ga0590077_006313
1106 Ga0501082_0027190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

52

355

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9249 9 311
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9213 9 313
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9133 9 311
2h1v-assembly1.cif.gz_A crystal structure of the lys87ala mutant variant of bacillus subtilis ferrochelatase 0.91 9 312
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9071 9 313
ID Description Score Start End Superfamily
af_P9WNE3_5_124_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9377 9 132 3.40.50.1400
1ak1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9292 153 290 3.40.50.1400
af_P9WNE3_146_279_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9275 158 290 3.40.50.1400
af_P9WNE3_5_124_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9226 9 132 3.40.50.1400
af_P9WNE3_146_279_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9141 158 290 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A383BKM2-F1-model_v4 Ferrochelatase 0.9873 6 239 GO:0004325
GO:0006783
AF-A0A7Y4WFJ6-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9856 6 323 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A382CW72-F1-model_v4 Ferrochelatase 0.9803 4 159 GO:0004325
GO:0006783
AF-A0A2V9XY23-F1-model_v4 Ferrochelatase 0.9792 7 100 GO:0004325
GO:0006783
AF-A0A7Y4WUD1-F1-model_v4 Ferrochelatase 0.9789 4 199 GO:0004325
GO:0006783

Map