F462818

General Info

Members Datasets Scaffolds Average Seq Length
553 259 1106 135

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10038229|Ga0070658_100382294
Length 146
Sequence VSAQDDMTIPQHLQLQIVSADRSLVNEQVDEVQIPGADGYFGVLPGHTQLLTTMQVGVLWYRQGTEKHYLSVAFGFAEVQPDRVTILAQIAEKAEEIDLPRAETAKKRAEERMAKPTMDMDFERARIAMLKALIRLQAAAHARTRA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
91 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 6.15
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10038229 3300005327 Bacteria 3871
2 MBSR1b_contig_7242444 2162886012 Bacteria 874
3 JGI24746J21847_1002002 3300001977 Bacteria 3248
4 Ga0065704_10010453 3300005289 Bacteria 1953
5 Ga0065704_10113837 3300005289 Bacteria 1904
6 Ga0065704_10150954 3300005289 Bacteria 1429
7 Ga0065712_10074095 3300005290 Bacteria 4185
8 Ga0065712_10437086 3300005290 Bacteria 698
9 Ga0065715_10091879 3300005293 Bacteria 5488
10 Ga0065715_10133885 3300005293 Bacteria 1964
11 Ga0065715_10472943 3300005293 Unclassified 804
12 Ga0065707_10112266 3300005295 Bacteria 2366
13 Ga0065707_10367540 3300005295 Bacteria 886
14 Ga0070676_10023288 3300005328 Bacteria 3480
15 Ga0070683_100615218 3300005329 Bacteria 1040
16 Ga0070690_100001753 3300005330 Bacteria 11472
17 Ga0070690_100345500 3300005330 Bacteria 1078
18 Ga0070670_100700542 3300005331 Bacteria 911
19 Ga0070677_10007125 3300005333 Bacteria 3726
20 Ga0068869_100236227 3300005334 Bacteria 1454
21 Ga0068869_100478291 3300005334 Bacteria 1037
22 Ga0068869_101053283 3300005334 Bacteria 710
23 Ga0068869_101070274 3300005334 Bacteria 704
24 Ga0070666_10006400 3300005335 Bacteria 7241
25 Ga0070682_101770979 3300005337 Bacteria 538
26 Ga0068868_100236693 3300005338 Bacteria 1533
27 Ga0068868_100317411 3300005338 Unclassified 1327
28 Ga0070689_100019341 3300005340 Bacteria 5035
29 Ga0070687_100002640 3300005343 Bacteria 6777
30 Ga0070687_100038243 3300005343 Bacteria 2404
31 Ga0070661_100012460 3300005344 Bacteria 5948
32 Ga0070668_100047434 3300005347 Bacteria 3303
33 Ga0070668_100092920 3300005347 Bacteria 2380
34 Ga0070669_100026526 3300005353 Bacteria 4168
35 Ga0070669_100031389 3300005353 Bacteria 3838
36 Ga0070675_100109832 3300005354 Bacteria 2331
37 Ga0070675_101383980 3300005354 Bacteria 649
38 Ga0070671_100021204 3300005355 Bacteria 5305
39 Ga0070671_100388368 3300005355 Bacteria 1193
40 Ga0070671_101741382 3300005355 Unclassified 553
41 Ga0070674_100280003 3300005356 Bacteria 1321
42 Ga0070673_100010889 3300005364 Bacteria 6182
43 Ga0070673_100943396 3300005364 Bacteria 801
44 Ga0070688_100037527 3300005365 Bacteria 2952
45 Ga0070667_100148419 3300005367 Bacteria 2058
46 Ga0070667_100578007 3300005367 Unclassified 1034
47 Ga0070709_10259220 3300005434 Bacteria 1256
48 Ga0070714_100003070 3300005435 Bacteria 12391
49 Ga0070713_100107478 3300005436 Bacteria 2427
50 Ga0070701_10008398 3300005438 Bacteria 4466
51 Ga0070700_100011510 3300005441 Bacteria 4902
52 Ga0070700_100718682 3300005441 Bacteria 796
53 Ga0070694_101670494 3300005444 Unclassified 541
54 Ga0070708_100119660 3300005445 Bacteria 2428
55 Ga0070708_100346979 3300005445 Bacteria 1399
56 Ga0070708_100951662 3300005445 Unclassified 806
57 Ga0070708_101061667 3300005445 Bacteria 759
58 Ga0070708_101421226 3300005445 Bacteria 647
59 Ga0070663_100035344 3300005455 Bacteria 3467
60 Ga0070678_100016006 3300005456 Bacteria 4782
61 Ga0070678_100909555 3300005456 Bacteria 805
62 Ga0070678_101433976 3300005456 Bacteria 645
63 Ga0070681_10133031 3300005458 Bacteria 2419
64 Ga0070681_10356122 3300005458 Bacteria 1374
65 Ga0070681_11286411 3300005458 Bacteria 654
66 Ga0068867_100023577 3300005459 Bacteria 4406
67 Ga0068867_100416757 3300005459 Bacteria 1137
68 Ga0068867_100503147 3300005459 Bacteria 1042
69 Ga0070685_10033701 3300005466 Bacteria 2879
70 Ga0070685_10149558 3300005466 Bacteria 1478
71 Ga0070707_100454094 3300005468 Bacteria 1242
72 Ga0070707_100454934 3300005468 Bacteria 1241
73 Ga0070699_100013629 3300005518 Bacteria 6998
74 Ga0070679_100068341 3300005530 Bacteria 3544
75 Ga0070679_100071942 3300005530 Bacteria 3450
76 Ga0070679_101269918 3300005530 Bacteria 682
77 Ga0070684_101225625 3300005535 Bacteria 706
78 Ga0070684_102149278 3300005535 Bacteria 527
79 Ga0070697_100211627 3300005536 Bacteria 1651
80 Ga0070672_100066736 3300005543 Bacteria 2849
81 Ga0070672_100203789 3300005543 Bacteria 1655
82 Ga0070672_100476114 3300005543 Bacteria 1078
83 Ga0070672_100566141 3300005543 Bacteria 988
84 Ga0070686_100002460 3300005544 Bacteria 10205
85 Ga0070686_100317773 3300005544 Bacteria 1160
86 Ga0070686_100759046 3300005544 Bacteria 778
87 Ga0070665_100063249 3300005548 Bacteria 3710
88 Ga0070665_100082906 3300005548 Bacteria 3211
89 Ga0070665_100086416 3300005548 Bacteria 3141
90 Ga0070665_100340394 3300005548 Bacteria 1505
91 Ga0070704_100539432 3300005549 Bacteria 1018
92 Ga0070704_100952878 3300005549 Bacteria 774
93 Ga0068855_100092401 3300005563 Bacteria 3490
94 Ga0068855_100385535 3300005563 Bacteria 1538
95 Ga0068855_100535012 3300005563 Bacteria 1270
96 Ga0068855_100758897 3300005563 Bacteria 1034
97 Ga0068855_102131470 3300005563 Bacteria 564
98 Ga0070664_100003952 3300005564 Bacteria 11940
99 Ga0070664_100285535 3300005564 Bacteria 1489
100 Ga0070664_101560826 3300005564 Bacteria 625
101 Ga0068857_100232619 3300005577 Bacteria 1686
102 Ga0068854_100038489 3300005578 Bacteria 3364
103 Ga0068854_101068076 3300005578 Bacteria 718
104 Ga0068856_100063822 3300005614 Bacteria 3639
105 Ga0068856_101475190 3300005614 Bacteria 694
106 Ga0070702_100021674 3300005615 Bacteria 3386
107 Ga0070702_100140613 3300005615 Bacteria 1537
108 Ga0068852_100036602 3300005616 Bacteria 4109
109 Ga0068852_100307675 3300005616 Bacteria 1536
110 Ga0068852_100680632 3300005616 Bacteria 1038
111 Ga0068852_101057798 3300005616 Unclassified 831
112 Ga0068859_100118080 3300005617 Unclassified 2718
113 Ga0068859_100120138 3300005617 Bacteria 2694
114 Ga0068859_100302935 3300005617 Bacteria 1692
115 Ga0068859_100551949 3300005617 Bacteria 1246
116 Ga0068864_100028406 3300005618 Bacteria 4727
117 Ga0068864_100164354 3300005618 Bacteria 2020
118 Ga0068864_100718455 3300005618 Bacteria 977
119 Ga0068864_100820521 3300005618 Unclassified 915
120 Ga0068864_100889254 3300005618 Bacteria 879
121 Ga0068864_101118968 3300005618 Bacteria 784
122 Ga0068866_10212645 3300005718 Bacteria 1162
123 Ga0068866_10649968 3300005718 Bacteria 718
124 Ga0068861_100002126 3300005719 Bacteria 12824
125 Ga0068870_10001197 3300005840 Bacteria 10403
126 Ga0068870_10123362 3300005840 Bacteria 1495
127 Ga0068863_100010742 3300005841 Bacteria 8884
128 Ga0068863_100061146 3300005841 Bacteria 3561
129 Ga0068863_100180486 3300005841 Bacteria 2026
130 Ga0068863_100352374 3300005841 Bacteria 1434
131 Ga0068863_100353426 3300005841 Bacteria 1431
132 Ga0068863_102019930 3300005841 Bacteria 587
133 Ga0068858_100020774 3300005842 Bacteria 6136
134 Ga0068858_100021973 3300005842 Bacteria 5958
135 Ga0068858_100073792 3300005842 Bacteria 3167
136 Ga0068858_100320120 3300005842 Bacteria 1482
137 Ga0068858_100472426 3300005842 Bacteria 1210
138 Ga0068858_100660828 3300005842 Bacteria 1016
139 Ga0068858_100805213 3300005842 Bacteria 917
140 Ga0068860_100011326 3300005843 Bacteria 8788
141 Ga0068860_100126978 3300005843 Bacteria 2445
142 Ga0068860_100283082 3300005843 Unclassified 1621
143 Ga0068860_100379268 3300005843 Bacteria 1396
144 Ga0068862_100003536 3300005844 Bacteria 13406
145 Ga0068862_100606479 3300005844 Bacteria 1052
146 Ga0081455_10147321 3300005937 Bacteria 1819
147 Ga0081455_10983304 3300005937 Unclassified 523
148 Ga0075432_10152392 3300006058 Bacteria 889
149 Ga0070715_10019060 3300006163 Bacteria 2625
150 Ga0070715_10525292 3300006163 Bacteria 682
151 Ga0070712_100629786 3300006175 Bacteria 910
152 Ga0097621_100021199 3300006237 Bacteria 5021
153 Ga0097621_100029672 3300006237 Bacteria 4322
154 Ga0097621_100105972 3300006237 Bacteria 2371
155 Ga0097621_100709709 3300006237 Bacteria 926
156 Ga0097621_101160476 3300006237 Unclassified 727
157 Ga0068871_100004547 3300006358 Bacteria 9672
158 Ga0068871_100015732 3300006358 Bacteria 5674
159 Ga0068871_100082538 3300006358 Bacteria 2665
160 Ga0068871_100246275 3300006358 Bacteria 1556
161 Ga0068871_100528064 3300006358 Bacteria 1066
162 Ga0068871_102091182 3300006358 Bacteria 539
163 Ga0075428_100206418 3300006844 Bacteria 2123
164 Ga0075428_101354536 3300006844 Bacteria 747
165 Ga0075433_10007762 3300006852 Bacteria 8523
166 Ga0075433_10048453 3300006852 Bacteria 3694
167 Ga0075433_11657064 3300006852 Unclassified 551
168 Ga0075434_100063686 3300006871 Bacteria 3670
169 Ga0075434_100281293 3300006871 Bacteria 1683
170 Ga0075434_100338747 3300006871 Bacteria 1525
171 Ga0075434_100789751 3300006871 Bacteria 966
172 Ga0075434_101457449 3300006871 Bacteria 694
173 Ga0075429_100044625 3300006880 Bacteria 3855
174 Ga0068865_100011512 3300006881 Bacteria 5543
175 Ga0068865_100305675 3300006881 Bacteria 1274
176 Ga0075436_100032804 3300006914 Bacteria 3579
177 Ga0075436_100344774 3300006914 Bacteria 1073
178 Ga0097620_100118068 3300006931 Unclassified 2718
179 Ga0097620_100120139 3300006931 Bacteria 2694
180 Ga0097620_100302936 3300006931 Bacteria 1692
181 Ga0097620_100551969 3300006931 Bacteria 1246
182 Ga0075435_100091589 3300007076 Bacteria 2509
183 Ga0075435_100160363 3300007076 Bacteria 1894
184 Ga0075435_100821111 3300007076 Bacteria 810
185 Ga0075435_101312477 3300007076 Unclassified 634
186 Ga0105240_10175286 3300009093 Bacteria 2535
187 Ga0111539_10002220 3300009094 Bacteria 25940
188 Ga0111539_10210476 3300009094 Bacteria 2266
189 Ga0111539_10478716 3300009094 Bacteria 1450
190 Ga0111539_10597815 3300009094 Bacteria 1285
191 Ga0105245_10513213 3300009098 Bacteria 1216
192 Ga0105245_10700034 3300009098 Bacteria 1046
193 Ga0105245_10935323 3300009098 Bacteria 909
194 Ga0105245_11037904 3300009098 Bacteria 865
195 Ga0105247_10006319 3300009101 Bacteria 7345
196 Ga0105247_10028671 3300009101 Bacteria 3369
197 Ga0105247_10049216 3300009101 Bacteria 2591
198 Ga0105247_10155884 3300009101 Bacteria 1508
199 Ga0105247_10212071 3300009101 Bacteria 1307
200 Ga0114129_10004086 3300009147 Bacteria 20621
201 Ga0114129_10011201 3300009147 Bacteria 12784
202 Ga0114129_10101703 3300009147 Bacteria 3976
203 Ga0114129_10502271 3300009147 Bacteria 1584
204 Ga0114129_10717335 3300009147 Bacteria 1283
205 Ga0114129_10817650 3300009147 Bacteria 1187
206 Ga0114129_10846430 3300009147 Bacteria 1163
207 Ga0105243_10393036 3300009148 Bacteria 1286
208 Ga0105242_10143596 3300009176 Bacteria 2074
209 Ga0105242_12281772 3300009176 Unclassified 587
210 Ga0105242_12298418 3300009176 Bacteria 585
211 Ga0105248_10002172 3300009177 Bacteria 21714
212 Ga0105248_10026358 3300009177 Bacteria 6465
213 Ga0105248_10026854 3300009177 Bacteria 6403
214 Ga0105248_10133997 3300009177 Bacteria 2795
215 Ga0105248_10207165 3300009177 Bacteria 2209
216 Ga0105248_10285506 3300009177 Bacteria 1858
217 Ga0105248_10346206 3300009177 Bacteria 1673
218 Ga0105248_11027277 3300009177 Bacteria 931
219 Ga0105248_11945712 3300009177 Unclassified 668
220 Ga0105238_10331623 3300009551 Bacteria 1508
221 Ga0105238_10340531 3300009551 Bacteria 1488
222 Ga0105238_10891276 3300009551 Bacteria 908
223 Ga0105249_10000828 3300009553 Bacteria 27861
224 Ga0105246_10143870 3300011119 Bacteria 1797
225 Ga0157346_1006523 3300012480 Bacteria 755
226 Ga0157337_1021404 3300012483 Bacteria 600
227 Ga0157370_10209227 3300013104 Bacteria 1808
228 Ga0157369_10949906 3300013105 Bacteria 881
229 Ga0157378_11046649 3300013297 Bacteria 852
230 Ga0163162_10006203 3300013306 Bacteria 11580
231 Ga0163162_10193677 3300013306 Bacteria 2161
232 Ga0163162_11363688 3300013306 Bacteria 806
233 Ga0157375_10011898 3300013308 Bacteria 7698
234 Ga0157375_10021964 3300013308 Bacteria 5866
235 Ga0157375_10411201 3300013308 Bacteria 1519
236 Ga0157375_11412239 3300013308 Bacteria 820
237 Ga0157375_11443852 3300013308 Bacteria 811
238 Ga0157375_12435403 3300013308 Bacteria 625
239 Ga0157375_12662775 3300013308 Bacteria 598
240 Ga0163163_10072868 3300014325 Bacteria 3424
241 Ga0163163_10085069 3300014325 Bacteria 3170
242 Ga0163163_10505364 3300014325 Bacteria 1271
243 Ga0163163_10967707 3300014325 Bacteria 914
244 Ga0163163_11147888 3300014325 Bacteria 840
245 Ga0163163_12731398 3300014325 Unclassified 551
246 Ga0157380_10027633 3300014326 Bacteria 4316
247 Ga0157380_10449776 3300014326 Bacteria 1237
248 Ga0157377_10000331 3300014745 Bacteria 21206
249 Ga0157377_11121845 3300014745 Unclassified 604
250 Ga0157379_10002568 3300014968 Bacteria 15239
251 Ga0157379_10008620 3300014968 Bacteria 8875
252 Ga0157379_10023460 3300014968 Bacteria 5476
253 Ga0157379_10104470 3300014968 Bacteria 2542
254 Ga0157379_10121832 3300014968 Bacteria 2346
255 Ga0157379_10789075 3300014968 Bacteria 896
256 Ga0157379_11104095 3300014968 Bacteria 760
257 Ga0157376_10034907 3300014969 Bacteria 4064
258 Ga0157376_10117954 3300014969 Bacteria 2347
259 Ga0157376_10237795 3300014969 Bacteria 1695
260 Ga0157376_10394091 3300014969 Bacteria 1337
261 Ga0157376_10575870 3300014969 Bacteria 1117
262 Ga0163161_10007583 3300017792 Bacteria 7502
263 Ga0163161_10724440 3300017792 Bacteria 830
264 Ga0207673_1004608 3300025290 Bacteria 1655
265 Ga0207697_10001730 3300025315 Bacteria 11735
266 Ga0207682_10010907 3300025893 Bacteria 3556
267 Ga0207642_10441590 3300025899 Bacteria 786
268 Ga0207710_10008291 3300025900 Bacteria 4386
269 Ga0207710_10034865 3300025900 Bacteria 2213
270 Ga0207688_10000665 3300025901 Bacteria 16968
271 Ga0207688_10337841 3300025901 Bacteria 926
272 Ga0207680_10008800 3300025903 Bacteria 4975
273 Ga0207680_10055163 3300025903 Bacteria 2394
274 Ga0207680_10281433 3300025903 Bacteria 1155
275 Ga0207647_10237212 3300025904 Bacteria 1048
276 Ga0207685_10316377 3300025905 Bacteria 777
277 Ga0207685_10428791 3300025905 Unclassified 683
278 Ga0207699_10076147 3300025906 Bacteria 2066
279 Ga0207645_10000277 3300025907 Bacteria 42576
280 Ga0207645_10198731 3300025907 Bacteria 1319
281 Ga0207643_10000129 3300025908 Bacteria 51178
282 Ga0207643_10188525 3300025908 Bacteria 1251
283 Ga0207705_10047753 3300025909 Bacteria 3078
284 Ga0207684_11157501 3300025910 Bacteria 642
285 Ga0207707_10138553 3300025912 Bacteria 2127
286 Ga0207707_10200428 3300025912 Bacteria 1740
287 Ga0207707_10539720 3300025912 Bacteria 992
288 Ga0207695_10145674 3300025913 Bacteria 2313
289 Ga0207693_10360081 3300025915 Bacteria 1138
290 Ga0207662_10001289 3300025918 Bacteria 12062
291 Ga0207662_10103102 3300025918 Bacteria 1770
292 Ga0207662_11075520 3300025918 Bacteria 572
293 Ga0207657_10006096 3300025919 Bacteria 12536
294 Ga0207649_10047428 3300025920 Bacteria 2644
295 Ga0207652_10077619 3300025921 Bacteria 2898
296 Ga0207652_10179357 3300025921 Bacteria 1903
297 Ga0207652_10953459 3300025921 Bacteria 756
298 Ga0207646_10339903 3300025922 Bacteria 1356
299 Ga0207646_10603831 3300025922 Bacteria 985
300 Ga0207646_10607570 3300025922 Bacteria 981
301 Ga0207646_11257169 3300025922 Bacteria 648
302 Ga0207681_10223654 3300025923 Bacteria 1457
303 Ga0207694_10280845 3300025924 Bacteria 1368
304 Ga0207650_10265351 3300025925 Bacteria 1394
305 Ga0207659_10006951 3300025926 Bacteria 6952
306 Ga0207687_10323039 3300025927 Bacteria 1250
307 Ga0207687_10434014 3300025927 Bacteria 1086
308 Ga0207664_10027770 3300025929 Bacteria 4295
309 Ga0207644_10226379 3300025931 Bacteria 1484
310 Ga0207644_10484148 3300025931 Bacteria 1019
311 Ga0207644_10675197 3300025931 Bacteria 861
312 Ga0207644_10874312 3300025931 Bacteria 753
313 Ga0207644_11549694 3300025931 Unclassified 556
314 Ga0207706_10001724 3300025933 Bacteria 21557
315 Ga0207686_10196021 3300025934 Bacteria 1443
316 Ga0207686_10229557 3300025934 Bacteria 1345
317 Ga0207709_10466667 3300025935 Bacteria 979
318 Ga0207670_10258704 3300025936 Bacteria 1348
319 Ga0207670_11747646 3300025936 Bacteria 529
320 Ga0207669_10122108 3300025937 Bacteria 1771
321 Ga0207704_10029755 3300025938 Bacteria 3051
322 Ga0207704_11608815 3300025938 Unclassified 558
323 Ga0207665_10136662 3300025939 Bacteria 1745
324 Ga0207691_10002311 3300025940 Bacteria 18682
325 Ga0207691_10536293 3300025940 Bacteria 993
326 Ga0207691_10903622 3300025940 Bacteria 739
327 Ga0207711_10006268 3300025941 Bacteria 10036
328 Ga0207711_10011151 3300025941 Bacteria 7469
329 Ga0207711_10026659 3300025941 Bacteria 4850
330 Ga0207711_10497400 3300025941 Bacteria 1136
331 Ga0207711_11698895 3300025941 Unclassified 575
332 Ga0207689_10007515 3300025942 Bacteria 9556
333 Ga0207689_10185369 3300025942 Bacteria 1716
334 Ga0207689_10380226 3300025942 Bacteria 1176
335 Ga0207689_10756033 3300025942 Unclassified 820
336 Ga0207689_10918827 3300025942 Bacteria 738
337 Ga0207661_10104972 3300025944 Bacteria 2380
338 Ga0207679_10032729 3300025945 Bacteria 3654
339 Ga0207679_10115269 3300025945 Bacteria 2128
340 Ga0207679_10237207 3300025945 Bacteria 1543
341 Ga0207667_10091323 3300025949 Bacteria 3146
342 Ga0207667_10118454 3300025949 Bacteria 2729
343 Ga0207667_10212992 3300025949 Bacteria 1980
344 Ga0207667_10608410 3300025949 Bacteria 1101
345 Ga0207651_10441791 3300025960 Bacteria 1114
346 Ga0207651_11203959 3300025960 Bacteria 680
347 Ga0207712_10037235 3300025961 Bacteria 3318
348 Ga0207668_10038161 3300025972 Bacteria 3221
349 Ga0207668_10375574 3300025972 Bacteria 1195
350 Ga0207640_10137347 3300025981 Bacteria 1777
351 Ga0207640_10384944 3300025981 Bacteria 1138
352 Ga0207658_10034306 3300025986 Bacteria 3626
353 Ga0207658_10845139 3300025986 Unclassified 832
354 Ga0207677_10026396 3300026023 Bacteria 3642
355 Ga0207677_10042177 3300026023 Bacteria 3024
356 Ga0207677_10448900 3300026023 Bacteria 1104
357 Ga0207703_10011918 3300026035 Bacteria 6770
358 Ga0207703_10024349 3300026035 Bacteria 4763
359 Ga0207703_10030563 3300026035 Bacteria 4258
360 Ga0207703_10127312 3300026035 Bacteria 2195
361 Ga0207703_10145949 3300026035 Bacteria 2058
362 Ga0207703_10448402 3300026035 Bacteria 1205
363 Ga0207703_10754729 3300026035 Bacteria 927
364 Ga0207703_10832599 3300026035 Bacteria 882
365 Ga0207708_10004662 3300026075 Bacteria 10090
366 Ga0207708_10479939 3300026075 Bacteria 1039
367 Ga0207708_11283613 3300026075 Bacteria 641
368 Ga0207702_10008196 3300026078 Bacteria 8832
369 Ga0207702_10840333 3300026078 Bacteria 909
370 Ga0207641_10000955 3300026088 Bacteria 29716
371 Ga0207641_10098340 3300026088 Bacteria 2573
372 Ga0207641_10113767 3300026088 Bacteria 2403
373 Ga0207641_10364544 3300026088 Bacteria 1380
374 Ga0207648_10074933 3300026089 Bacteria 2950
375 Ga0207648_10202798 3300026089 Bacteria 1759
376 Ga0207676_10024488 3300026095 Bacteria 4466
377 Ga0207676_10348879 3300026095 Bacteria 1368
378 Ga0207676_10562521 3300026095 Unclassified 1091
379 Ga0207676_11891145 3300026095 Bacteria 595
380 Ga0207675_100014148 3300026118 Bacteria 7440
381 Ga0207683_10010855 3300026121 Bacteria 7768
382 Ga0207683_10084754 3300026121 Bacteria 2817
383 Ga0207683_10172440 3300026121 Bacteria 1960
384 Ga0207698_10335688 3300026142 Bacteria 1421
385 Ga0207698_10357415 3300026142 Bacteria 1382
386 Ga0207698_10401104 3300026142 Bacteria 1311
387 Ga0207698_10591536 3300026142 Bacteria 1093
388 Ga0207698_12072042 3300026142 Bacteria 583
389 Ga0209983_1035387 3300027665 Bacteria 1071
390 Ga0209974_10287105 3300027876 Bacteria 627
391 Ga0207428_10003472 3300027907 Bacteria 15299
392 Ga0207428_10032836 3300027907 Bacteria 4268
393 Ga0207428_10257404 3300027907 Bacteria 1300
394 Ga0268266_10048604 3300028379 Bacteria 3637
395 Ga0268266_10093501 3300028379 Bacteria 2638
396 Ga0268266_10492084 3300028379 Bacteria 1170
397 Ga0268266_10611219 3300028379 Bacteria 1047
398 Ga0268265_10002223 3300028380 Bacteria 14919
399 Ga0268265_10167610 3300028380 Bacteria 1873
400 Ga0268264_10239234 3300028381 Unclassified 1681
401 Ga0268264_10240731 3300028381 Bacteria 1676
402 Ga0268264_10539869 3300028381 Bacteria 1142
403 Ga0265332_10172515 3300031238 Bacteria 902
404 Ga0307509_10522577 3300031507 Bacteria 868
405 Ga0307412_10367385 3300031911 Bacteria 1161
406 Ga0373958_0010695 3300034819 Bacteria 1536
407 Ga0373938_0025398 3300034957 Bacteria 1233
408 Ga0373934_0049802 3300035086 Bacteria 1659
409 Ga0373940_0167814 3300035088 Unclassified 708
410 Ga0373949_0117351 3300035090 Unclassified 744
411 Ga0373951_0120192 3300035091 Bacteria 714
412 Ga0373951_0228068 3300035091 Unclassified 552
413 Ga0373952_0024169 3300035092 Bacteria 1303
414 Ga0373923_0104241 3300035111 Bacteria 1254
415 Ga0373923_0159168 3300035111 Bacteria 1030
416 Ga0373932_0015319 3300035112 Bacteria 1942
417 Ga0373936_0112089 3300035113 Bacteria 1159
418 Ga0373936_0446290 3300035113 Bacteria 598
419 Ga0373939_0162623 3300035114 Bacteria 821
420 Ga0373956_0097452 3300035119 Bacteria 1361
421 Ga0373956_0203224 3300035119 Bacteria 939
422 Ga0373957_0054913 3300035120 Bacteria 1531
423 Ga0373957_0100741 3300035120 Bacteria 1156
424 Ga0373957_0203723 3300035120 Bacteria 825
425 Ga0373960_0050093 3300035121 Bacteria 1237
426 Ga0373946_0240162 3300035171 Bacteria 881
427 Ga0373955_0215636 3300035172 Bacteria 1145
428 Ga0373924_0088008 3300035410 Bacteria 1326
429 Ga0373931_0053685 3300035691 Bacteria 2151
430 Ga0373931_0141730 3300035691 Bacteria 1393
431 Ga0373935_0181431 3300035692 Bacteria 1446
432 Ga0373927_0332369 3300035695 Bacteria 1001
433 Ga0373933_0346973 3300035724 Bacteria 964
434 Ga0373947_0222700 3300035725 Bacteria 1241
435 Ga0373937_0289603 3300036401 Bacteria 1547
436 Ga0373937_0399296 3300036401 Bacteria 1304
437 Ga0373937_2065755 3300036401 Unclassified 516
438 Ga0373925_0662575 3300037068 Bacteria 860
439 Ga0373925_1063585 3300037068 Bacteria 666
440 Ga0451849_1196865 3300041505 Unclassified 561
441 Ga0439464_0064957 3300042439 Bacteria 1073
442 Ga0451577_0020551 3300042876 Bacteria 6056
443 Ga0439440_0069650 3300042993 Unclassified 913
444 Ga0466963_0078322 3300044694 Bacteria 2234
445 Ga0451576_0607439 3300045051 Bacteria 1149
446 Ga0466958_0849659 3300045836 Bacteria 595
447 Ga0466967_0439193 3300045976 Bacteria 1274
448 Ga0466967_1341772 3300045976 Bacteria 712
449 Ga0495592_0257854 3300046454 Bacteria 1150
450 Ga0495603_0761793 3300046455 Bacteria 553
451 Ga0495582_0209840 3300046473 Bacteria 1113
452 Ga0495639_0194009 3300046475 Bacteria 992
453 Ga0495639_0446490 3300046475 Bacteria 657
454 Ga0495584_0287189 3300046491 Bacteria 836
455 Ga0495628_0610749 3300046516 Bacteria 778
456 Ga0495645_0002325 3300046543 Bacteria 12895
457 Ga0495667_0333118 3300046559 Bacteria 960
458 Ga0495656_0130893 3300046615 Unclassified 1194
459 Ga0495668_0312512 3300046616 Bacteria 862
460 Ga0495657_0649940 3300046675 Unclassified 608
461 Ga0495658_0176958 3300046683 Bacteria 1322
462 Ga0495669_0574345 3300046684 Bacteria 548
463 Ga0495613_0664153 3300046689 Bacteria 689
464 Ga0495581_0139914 3300047315 Bacteria 1412
465 Ga0495636_0514070 3300047318 Unclassified 580
466 Ga0495674_0080618 3300047319 Bacteria 2793
467 Ga0495674_0196736 3300047319 Bacteria 1674
468 Ga0495684_0191417 3300047471 Bacteria 1512
469 Ga0496100_0001496 3300048903 Bacteria 11450
470 Ga0496100_0513977 3300048903 Bacteria 924
471 Ga0496101_0000830 3300048904 Bacteria 18197
472 Ga0496102_0055442 3300048905 Bacteria 3614
473 Ga0496102_0252039 3300048905 Bacteria 1665
474 Ga0496104_0010482 3300048907 Bacteria 8280
475 Ga0496104_0138434 3300048907 Bacteria 2339
476 Ga0496105_0030341 3300048908 Bacteria 4430
477 Ga0496105_0363438 3300048908 Bacteria 1154
478 Ga0496105_0463968 3300048908 Bacteria 998
479 Ga0496105_1211010 3300048908 Unclassified 555
480 Ga0496106_0079657 3300048909 Bacteria 2515
481 Ga0496107_0323556 3300048910 Bacteria 1147
482 Ga0496108_0021565 3300048911 Bacteria 5292
483 Ga0496108_0133569 3300048911 Bacteria 2133
484 Ga0496108_0566167 3300048911 Bacteria 991
485 Ga0496108_0852603 3300048911 Bacteria 784
486 Ga0496109_0505871 3300048912 Bacteria 1140
487 Ga0496110_0350846 3300048913 Bacteria 1344
488 Ga0496110_0408587 3300048913 Bacteria 1238
489 Ga0496110_0570336 3300048913 Bacteria 1028
490 Ga0496110_0716439 3300048913 Bacteria 903
491 Ga0496111_0681687 3300048914 Unclassified 748
492 Ga0496112_0007942 3300048915 Bacteria 9460
493 Ga0496112_0417501 3300048915 Bacteria 1281
494 Ga0496112_0825403 3300048915 Bacteria 851
495 Ga0496112_1160020 3300048915 Bacteria 690
496 Ga0496113_0032239 3300048916 Bacteria 3808
497 Ga0496114_0001212 3300048917 Bacteria 19503
498 Ga0496114_0083151 3300048917 Bacteria 2708
499 Ga0496114_0210557 3300048917 Bacteria 1705
500 Ga0496114_0226940 3300048917 Bacteria 1640
501 Ga0496114_0654270 3300048917 Bacteria 924
502 Ga0496114_1271314 3300048917 Unclassified 622
503 Ga0495682_0129184 3300049460 Bacteria 904
504 Ga0501034_1220255 3300049571 Bacteria 630
505 Ga0501040_1393894 3300049576 Unclassified 509
506 Ga0501043_0408279 3300049579 Bacteria 1025
507 Ga0501047_0147723 3300049581 Bacteria 2227
508 Ga0501067_0347065 3300049583 Bacteria 827
509 Ga0501072_0782444 3300049588 Bacteria 748
510 Ga0501073_0189963 3300049589 Bacteria 1421
511 Ga0501073_1276841 3300049589 Bacteria 503
512 Ga0501075_0363061 3300049591 Bacteria 1104
513 Ga0501077_0070704 3300049593 Bacteria 2212
514 Ga0501081_1065519 3300049743 Bacteria 611
515 Ga0501081_1288839 3300049743 Bacteria 554
516 Ga0501083_1036691 3300049744 Unclassified 534
517 Ga0501044_0113890 3300049823 Bacteria 2711
518 nmdc:mga05p37_1026629_c1 3300050507 Bacteria 873
519 nmdc:mga05p37_170578_c1 3300050507 Bacteria 2088
520 nmdc:mga05p37_2445_c1 3300050507 Bacteria 21611
521 nmdc:mga05p37_492589_c1 3300050507 Bacteria 1409
522 nmdc:mga05p37_7856_c1 3300050507 Bacteria 12591
523 nmdc:mga05p37_993282_c1 3300050507 Unclassified 893
524 nmdc:mga09592_1290580_c1 3300050508 Bacteria 600
525 nmdc:mga09592_134967_c1 3300050508 Bacteria 2125
526 nmdc:mga09592_252_c1 3300050508 Bacteria 39064
527 nmdc:mga09592_475228_c1 3300050508 Bacteria 1077
528 nmdc:mga09592_58882_c1 3300050508 Bacteria 3248
529 nmdc:mga0qj67_645_c1 3300050509 Bacteria 24012
530 nmdc:mga06r32_504_c1 3300050510 Bacteria 33617
531 nmdc:mga08y16_1003121_c1 3300050511 Bacteria 815
532 nmdc:mga08y16_176486_c1 3300050511 Bacteria 2219
533 nmdc:mga08y16_1764907_c1 3300050511 Unclassified 573
534 nmdc:mga08y16_59749_c1 3300050511 Bacteria 3982
535 nmdc:mga08y16_724681_c1 3300050511 Bacteria 992
536 nmdc:mga0n895_1369403_c1 3300050512 Bacteria 677
537 nmdc:mga0n895_1515_c1 3300050512 Bacteria 17423
538 nmdc:mga0n895_269430_c1 3300050512 Bacteria 1727
539 nmdc:mga0n895_296283_c1 3300050512 Bacteria 1640
540 nmdc:mga0rr50_523610_c1 3300050513 Bacteria 1009
541 nmdc:mga0rr50_84673_c1 3300050513 Bacteria 2455
542 nmdc:mga08x19_153025_c1 3300050514 Bacteria 1563
543 nmdc:mga0a205_287906_c1 3300050515 Bacteria 1518
544 nmdc:mga0a205_513881_c1 3300050515 Bacteria 1054
545 nmdc:mga0a205_613_c1 3300050515 Bacteria 28395
546 nmdc:mga0a205_8884_c1 3300050515 Bacteria 9155
547 Ga0495601_0119219 3300053077 Bacteria 1713
548 Ga0495601_0267321 3300053077 Bacteria 1116
549 Ga0495619_0061168 3300053085 Bacteria 2505
550 Ga0495619_0144047 3300053085 Bacteria 1642
551 Ga0500651_0256161 3300053093 Bacteria 1016
552 Ga0501084_0823722 3300054114 Bacteria 781
553 Ga0501082_1153239 3300060353 Bacteria 677
554 Ga0070658_10038229
555 MBSR1b_contig_7242444
556 JGI24746J21847_1002002
557 Ga0065704_10010453
558 Ga0065704_10113837
559 Ga0065704_10150954
560 Ga0065712_10074095
561 Ga0065712_10437086
562 Ga0065715_10091879
563 Ga0065715_10133885
564 Ga0065715_10472943
565 Ga0065707_10112266
566 Ga0065707_10367540
567 Ga0070676_10023288
568 Ga0070683_100615218
569 Ga0070690_100001753
570 Ga0070690_100345500
571 Ga0070670_100700542
572 Ga0070677_10007125
573 Ga0068869_100236227
574 Ga0068869_100478291
575 Ga0068869_101053283
576 Ga0068869_101070274
577 Ga0070666_10006400
578 Ga0070682_101770979
579 Ga0068868_100236693
580 Ga0068868_100317411
581 Ga0070689_100019341
582 Ga0070687_100002640
583 Ga0070687_100038243
584 Ga0070661_100012460
585 Ga0070668_100047434
586 Ga0070668_100092920
587 Ga0070669_100026526
588 Ga0070669_100031389
589 Ga0070675_100109832
590 Ga0070675_101383980
591 Ga0070671_100021204
592 Ga0070671_100388368
593 Ga0070671_101741382
594 Ga0070674_100280003
595 Ga0070673_100010889
596 Ga0070673_100943396
597 Ga0070688_100037527
598 Ga0070667_100148419
599 Ga0070667_100578007
600 Ga0070709_10259220
601 Ga0070714_100003070
602 Ga0070713_100107478
603 Ga0070701_10008398
604 Ga0070700_100011510
605 Ga0070700_100718682
606 Ga0070694_101670494
607 Ga0070708_100119660
608 Ga0070708_100346979
609 Ga0070708_100951662
610 Ga0070708_101061667
611 Ga0070708_101421226
612 Ga0070663_100035344
613 Ga0070678_100016006
614 Ga0070678_100909555
615 Ga0070678_101433976
616 Ga0070681_10133031
617 Ga0070681_10356122
618 Ga0070681_11286411
619 Ga0068867_100023577
620 Ga0068867_100416757
621 Ga0068867_100503147
622 Ga0070685_10033701
623 Ga0070685_10149558
624 Ga0070707_100454094
625 Ga0070707_100454934
626 Ga0070699_100013629
627 Ga0070679_100068341
628 Ga0070679_100071942
629 Ga0070679_101269918
630 Ga0070684_101225625
631 Ga0070684_102149278
632 Ga0070697_100211627
633 Ga0070672_100066736
634 Ga0070672_100203789
635 Ga0070672_100476114
636 Ga0070672_100566141
637 Ga0070686_100002460
638 Ga0070686_100317773
639 Ga0070686_100759046
640 Ga0070665_100063249
641 Ga0070665_100082906
642 Ga0070665_100086416
643 Ga0070665_100340394
644 Ga0070704_100539432
645 Ga0070704_100952878
646 Ga0068855_100092401
647 Ga0068855_100385535
648 Ga0068855_100535012
649 Ga0068855_100758897
650 Ga0068855_102131470
651 Ga0070664_100003952
652 Ga0070664_100285535
653 Ga0070664_101560826
654 Ga0068857_100232619
655 Ga0068854_100038489
656 Ga0068854_101068076
657 Ga0068856_100063822
658 Ga0068856_101475190
659 Ga0070702_100021674
660 Ga0070702_100140613
661 Ga0068852_100036602
662 Ga0068852_100307675
663 Ga0068852_100680632
664 Ga0068852_101057798
665 Ga0068859_100118080
666 Ga0068859_100120138
667 Ga0068859_100302935
668 Ga0068859_100551949
669 Ga0068864_100028406
670 Ga0068864_100164354
671 Ga0068864_100718455
672 Ga0068864_100820521
673 Ga0068864_100889254
674 Ga0068864_101118968
675 Ga0068866_10212645
676 Ga0068866_10649968
677 Ga0068861_100002126
678 Ga0068870_10001197
679 Ga0068870_10123362
680 Ga0068863_100010742
681 Ga0068863_100061146
682 Ga0068863_100180486
683 Ga0068863_100352374
684 Ga0068863_100353426
685 Ga0068863_102019930
686 Ga0068858_100020774
687 Ga0068858_100021973
688 Ga0068858_100073792
689 Ga0068858_100320120
690 Ga0068858_100472426
691 Ga0068858_100660828
692 Ga0068858_100805213
693 Ga0068860_100011326
694 Ga0068860_100126978
695 Ga0068860_100283082
696 Ga0068860_100379268
697 Ga0068862_100003536
698 Ga0068862_100606479
699 Ga0081455_10147321
700 Ga0081455_10983304
701 Ga0075432_10152392
702 Ga0070715_10019060
703 Ga0070715_10525292
704 Ga0070712_100629786
705 Ga0097621_100021199
706 Ga0097621_100029672
707 Ga0097621_100105972
708 Ga0097621_100709709
709 Ga0097621_101160476
710 Ga0068871_100004547
711 Ga0068871_100015732
712 Ga0068871_100082538
713 Ga0068871_100246275
714 Ga0068871_100528064
715 Ga0068871_102091182
716 Ga0075428_100206418
717 Ga0075428_101354536
718 Ga0075433_10007762
719 Ga0075433_10048453
720 Ga0075433_11657064
721 Ga0075434_100063686
722 Ga0075434_100281293
723 Ga0075434_100338747
724 Ga0075434_100789751
725 Ga0075434_101457449
726 Ga0075429_100044625
727 Ga0068865_100011512
728 Ga0068865_100305675
729 Ga0075436_100032804
730 Ga0075436_100344774
731 Ga0097620_100118068
732 Ga0097620_100120139
733 Ga0097620_100302936
734 Ga0097620_100551969
735 Ga0075435_100091589
736 Ga0075435_100160363
737 Ga0075435_100821111
738 Ga0075435_101312477
739 Ga0105240_10175286
740 Ga0111539_10002220
741 Ga0111539_10210476
742 Ga0111539_10478716
743 Ga0111539_10597815
744 Ga0105245_10513213
745 Ga0105245_10700034
746 Ga0105245_10935323
747 Ga0105245_11037904
748 Ga0105247_10006319
749 Ga0105247_10028671
750 Ga0105247_10049216
751 Ga0105247_10155884
752 Ga0105247_10212071
753 Ga0114129_10004086
754 Ga0114129_10011201
755 Ga0114129_10101703
756 Ga0114129_10502271
757 Ga0114129_10717335
758 Ga0114129_10817650
759 Ga0114129_10846430
760 Ga0105243_10393036
761 Ga0105242_10143596
762 Ga0105242_12281772
763 Ga0105242_12298418
764 Ga0105248_10002172
765 Ga0105248_10026358
766 Ga0105248_10026854
767 Ga0105248_10133997
768 Ga0105248_10207165
769 Ga0105248_10285506
770 Ga0105248_10346206
771 Ga0105248_11027277
772 Ga0105248_11945712
773 Ga0105238_10331623
774 Ga0105238_10340531
775 Ga0105238_10891276
776 Ga0105249_10000828
777 Ga0105246_10143870
778 Ga0157346_1006523
779 Ga0157337_1021404
780 Ga0157370_10209227
781 Ga0157369_10949906
782 Ga0157378_11046649
783 Ga0163162_10006203
784 Ga0163162_10193677
785 Ga0163162_11363688
786 Ga0157375_10011898
787 Ga0157375_10021964
788 Ga0157375_10411201
789 Ga0157375_11412239
790 Ga0157375_11443852
791 Ga0157375_12435403
792 Ga0157375_12662775
793 Ga0163163_10072868
794 Ga0163163_10085069
795 Ga0163163_10505364
796 Ga0163163_10967707
797 Ga0163163_11147888
798 Ga0163163_12731398
799 Ga0157380_10027633
800 Ga0157380_10449776
801 Ga0157377_10000331
802 Ga0157377_11121845
803 Ga0157379_10002568
804 Ga0157379_10008620
805 Ga0157379_10023460
806 Ga0157379_10104470
807 Ga0157379_10121832
808 Ga0157379_10789075
809 Ga0157379_11104095
810 Ga0157376_10034907
811 Ga0157376_10117954
812 Ga0157376_10237795
813 Ga0157376_10394091
814 Ga0157376_10575870
815 Ga0163161_10007583
816 Ga0163161_10724440
817 Ga0207673_1004608
818 Ga0207697_10001730
819 Ga0207682_10010907
820 Ga0207642_10441590
821 Ga0207710_10008291
822 Ga0207710_10034865
823 Ga0207688_10000665
824 Ga0207688_10337841
825 Ga0207680_10008800
826 Ga0207680_10055163
827 Ga0207680_10281433
828 Ga0207647_10237212
829 Ga0207685_10316377
830 Ga0207685_10428791
831 Ga0207699_10076147
832 Ga0207645_10000277
833 Ga0207645_10198731
834 Ga0207643_10000129
835 Ga0207643_10188525
836 Ga0207705_10047753
837 Ga0207684_11157501
838 Ga0207707_10138553
839 Ga0207707_10200428
840 Ga0207707_10539720
841 Ga0207695_10145674
842 Ga0207693_10360081
843 Ga0207662_10001289
844 Ga0207662_10103102
845 Ga0207662_11075520
846 Ga0207657_10006096
847 Ga0207649_10047428
848 Ga0207652_10077619
849 Ga0207652_10179357
850 Ga0207652_10953459
851 Ga0207646_10339903
852 Ga0207646_10603831
853 Ga0207646_10607570
854 Ga0207646_11257169
855 Ga0207681_10223654
856 Ga0207694_10280845
857 Ga0207650_10265351
858 Ga0207659_10006951
859 Ga0207687_10323039
860 Ga0207687_10434014
861 Ga0207664_10027770
862 Ga0207644_10226379
863 Ga0207644_10484148
864 Ga0207644_10675197
865 Ga0207644_10874312
866 Ga0207644_11549694
867 Ga0207706_10001724
868 Ga0207686_10196021
869 Ga0207686_10229557
870 Ga0207709_10466667
871 Ga0207670_10258704
872 Ga0207670_11747646
873 Ga0207669_10122108
874 Ga0207704_10029755
875 Ga0207704_11608815
876 Ga0207665_10136662
877 Ga0207691_10002311
878 Ga0207691_10536293
879 Ga0207691_10903622
880 Ga0207711_10006268
881 Ga0207711_10011151
882 Ga0207711_10026659
883 Ga0207711_10497400
884 Ga0207711_11698895
885 Ga0207689_10007515
886 Ga0207689_10185369
887 Ga0207689_10380226
888 Ga0207689_10756033
889 Ga0207689_10918827
890 Ga0207661_10104972
891 Ga0207679_10032729
892 Ga0207679_10115269
893 Ga0207679_10237207
894 Ga0207667_10091323
895 Ga0207667_10118454
896 Ga0207667_10212992
897 Ga0207667_10608410
898 Ga0207651_10441791
899 Ga0207651_11203959
900 Ga0207712_10037235
901 Ga0207668_10038161
902 Ga0207668_10375574
903 Ga0207640_10137347
904 Ga0207640_10384944
905 Ga0207658_10034306
906 Ga0207658_10845139
907 Ga0207677_10026396
908 Ga0207677_10042177
909 Ga0207677_10448900
910 Ga0207703_10011918
911 Ga0207703_10024349
912 Ga0207703_10030563
913 Ga0207703_10127312
914 Ga0207703_10145949
915 Ga0207703_10448402
916 Ga0207703_10754729
917 Ga0207703_10832599
918 Ga0207708_10004662
919 Ga0207708_10479939
920 Ga0207708_11283613
921 Ga0207702_10008196
922 Ga0207702_10840333
923 Ga0207641_10000955
924 Ga0207641_10098340
925 Ga0207641_10113767
926 Ga0207641_10364544
927 Ga0207648_10074933
928 Ga0207648_10202798
929 Ga0207676_10024488
930 Ga0207676_10348879
931 Ga0207676_10562521
932 Ga0207676_11891145
933 Ga0207675_100014148
934 Ga0207683_10010855
935 Ga0207683_10084754
936 Ga0207683_10172440
937 Ga0207698_10335688
938 Ga0207698_10357415
939 Ga0207698_10401104
940 Ga0207698_10591536
941 Ga0207698_12072042
942 Ga0209983_1035387
943 Ga0209974_10287105
944 Ga0207428_10003472
945 Ga0207428_10032836
946 Ga0207428_10257404
947 Ga0268266_10048604
948 Ga0268266_10093501
949 Ga0268266_10492084
950 Ga0268266_10611219
951 Ga0268265_10002223
952 Ga0268265_10167610
953 Ga0268264_10239234
954 Ga0268264_10240731
955 Ga0268264_10539869
956 Ga0265332_10172515
957 Ga0307509_10522577
958 Ga0307412_10367385
959 Ga0373958_0010695
960 Ga0373938_0025398
961 Ga0373934_0049802
962 Ga0373940_0167814
963 Ga0373949_0117351
964 Ga0373951_0120192
965 Ga0373951_0228068
966 Ga0373952_0024169
967 Ga0373923_0104241
968 Ga0373923_0159168
969 Ga0373932_0015319
970 Ga0373936_0112089
971 Ga0373936_0446290
972 Ga0373939_0162623
973 Ga0373956_0097452
974 Ga0373956_0203224
975 Ga0373957_0054913
976 Ga0373957_0100741
977 Ga0373957_0203723
978 Ga0373960_0050093
979 Ga0373946_0240162
980 Ga0373955_0215636
981 Ga0373924_0088008
982 Ga0373931_0053685
983 Ga0373931_0141730
984 Ga0373935_0181431
985 Ga0373927_0332369
986 Ga0373933_0346973
987 Ga0373947_0222700
988 Ga0373937_0289603
989 Ga0373937_0399296
990 Ga0373937_2065755
991 Ga0373925_0662575
992 Ga0373925_1063585
993 Ga0451849_1196865
994 Ga0439464_0064957
995 Ga0451577_0020551
996 Ga0439440_0069650
997 Ga0466963_0078322
998 Ga0451576_0607439
999 Ga0466958_0849659
1000 Ga0466967_0439193
1001 Ga0466967_1341772
1002 Ga0495592_0257854
1003 Ga0495603_0761793
1004 Ga0495582_0209840
1005 Ga0495639_0194009
1006 Ga0495639_0446490
1007 Ga0495584_0287189
1008 Ga0495628_0610749
1009 Ga0495645_0002325
1010 Ga0495667_0333118
1011 Ga0495656_0130893
1012 Ga0495668_0312512
1013 Ga0495657_0649940
1014 Ga0495658_0176958
1015 Ga0495669_0574345
1016 Ga0495613_0664153
1017 Ga0495581_0139914
1018 Ga0495636_0514070
1019 Ga0495674_0080618
1020 Ga0495674_0196736
1021 Ga0495684_0191417
1022 Ga0496100_0001496
1023 Ga0496100_0513977
1024 Ga0496101_0000830
1025 Ga0496102_0055442
1026 Ga0496102_0252039
1027 Ga0496104_0010482
1028 Ga0496104_0138434
1029 Ga0496105_0030341
1030 Ga0496105_0363438
1031 Ga0496105_0463968
1032 Ga0496105_1211010
1033 Ga0496106_0079657
1034 Ga0496107_0323556
1035 Ga0496108_0021565
1036 Ga0496108_0133569
1037 Ga0496108_0566167
1038 Ga0496108_0852603
1039 Ga0496109_0505871
1040 Ga0496110_0350846
1041 Ga0496110_0408587
1042 Ga0496110_0570336
1043 Ga0496110_0716439
1044 Ga0496111_0681687
1045 Ga0496112_0007942
1046 Ga0496112_0417501
1047 Ga0496112_0825403
1048 Ga0496112_1160020
1049 Ga0496113_0032239
1050 Ga0496114_0001212
1051 Ga0496114_0083151
1052 Ga0496114_0210557
1053 Ga0496114_0226940
1054 Ga0496114_0654270
1055 Ga0496114_1271314
1056 Ga0495682_0129184
1057 Ga0501034_1220255
1058 Ga0501040_1393894
1059 Ga0501043_0408279
1060 Ga0501047_0147723
1061 Ga0501067_0347065
1062 Ga0501072_0782444
1063 Ga0501073_0189963
1064 Ga0501073_1276841
1065 Ga0501075_0363061
1066 Ga0501077_0070704
1067 Ga0501081_1065519
1068 Ga0501081_1288839
1069 Ga0501083_1036691
1070 Ga0501044_0113890
1071 nmdc:mga05p37_1026629_c1
1072 nmdc:mga05p37_170578_c1
1073 nmdc:mga05p37_2445_c1
1074 nmdc:mga05p37_492589_c1
1075 nmdc:mga05p37_7856_c1
1076 nmdc:mga05p37_993282_c1
1077 nmdc:mga09592_1290580_c1
1078 nmdc:mga09592_134967_c1
1079 nmdc:mga09592_252_c1
1080 nmdc:mga09592_475228_c1
1081 nmdc:mga09592_58882_c1
1082 nmdc:mga0qj67_645_c1
1083 nmdc:mga06r32_504_c1
1084 nmdc:mga08y16_1003121_c1
1085 nmdc:mga08y16_176486_c1
1086 nmdc:mga08y16_1764907_c1
1087 nmdc:mga08y16_59749_c1
1088 nmdc:mga08y16_724681_c1
1089 nmdc:mga0n895_1369403_c1
1090 nmdc:mga0n895_1515_c1
1091 nmdc:mga0n895_269430_c1
1092 nmdc:mga0n895_296283_c1
1093 nmdc:mga0rr50_523610_c1
1094 nmdc:mga0rr50_84673_c1
1095 nmdc:mga08x19_153025_c1
1096 nmdc:mga0a205_287906_c1
1097 nmdc:mga0a205_513881_c1
1098 nmdc:mga0a205_613_c1
1099 nmdc:mga0a205_8884_c1
1100 Ga0495601_0119219
1101 Ga0495601_0267321
1102 Ga0495619_0061168
1103 Ga0495619_0144047
1104 Ga0500651_0256161
1105 Ga0501084_0823722
1106 Ga0501082_1153239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

95

140

0.98

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

13

91

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4asu-assembly1.cif.gz_H f1-atpase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the empty site 0.9297 10 83
3oee-assembly1.cif.gz_H structure of four mutant forms of yeast f1 atpase: alpha-f405s 0.9163 9 81
5ik2-assembly1.cif.gz_H caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.9139 7 104
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9102 7 104
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9098 7 85
ID Description Score Start End Superfamily
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9645 5 87 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9629 6 87 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9553 6 87 2.60.15.10
af_A4I651_36_136_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9473 3 87 2.60.15.10
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9448 5 87 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A7T9CZ97-F1-model_v4 deleted 0.9893 6 83
AF-A0A5N9H7U0-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9852 6 83 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A6DUD6-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9852 6 83 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A7X7NG92-F1-model_v4 ATP synthase F1 subunit epsilon 0.9849 6 84 GO:0012505
GO:0045261
GO:0046933
AF-A0A7W1YRX4-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9845 5 83 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933

Map