F462809

General Info

Members Datasets Scaffolds Average Seq Length
553 247 553 70

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10107612|rootH1_101076122
Length 76
Sequence MTHLSIYNYVTLISMLLMTILILVQTRGASLGAGLGGAGEINTERRGTDKTIYQLTIIMAVVFAGSLILGVVIPNK

Samples

Sample ID Description Type Environment
1 2088090001 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
81 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
173 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
226 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
229 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
230 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
233 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
234 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
235 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
236 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
237 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
241 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
242 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
243 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
244 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
245 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
246 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
247 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.92
Nodule 0
Rhizoplane 1.81
Rhizosphere 83.18
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNB_F6ESG4R02F26E1 2088090001 Bacteria 532
2 JGI24736J21556_1012325 3300001904 Unclassified 1384
3 JGI24740J21852_10048734 3300001979 Unclassified 1229
4 rootH1_10107612 3300003316 Bacteria 1366
5 rootH1_10148481 3300003316 Unclassified 1739
6 rootH2_10249488 3300003320 Bacteria 6149
7 rootL2_10317277 3300003322 Bacteria 1198
8 rootL2_10384956 3300003322 Unclassified 1471
9 JGI25405J52794_10017988 3300003911 Bacteria 1408
10 Ga0065704_10264973 3300005289 Bacteria 956
11 Ga0070658_10000012 3300005327 Bacteria 277871
12 Ga0070658_10000015 3300005327 Bacteria 230579
13 Ga0070658_10270031 3300005327 Bacteria 1446
14 Ga0070658_10393817 3300005327 Unclassified 1189
15 Ga0070658_11521127 3300005327 Bacteria 580
16 Ga0070676_10033662 3300005328 Bacteria 2940
17 Ga0070683_100000444 3300005329 Bacteria 28787
18 Ga0070683_100301894 3300005329 Bacteria 1523
19 Ga0070683_101014207 3300005329 Bacteria 797
20 Ga0070690_100001909 3300005330 Bacteria 11070
21 Ga0070670_100038066 3300005331 Bacteria 4136
22 Ga0070670_100936792 3300005331 Bacteria 786
23 Ga0070670_101507263 3300005331 Unclassified 617
24 Ga0068869_101043054 3300005334 Bacteria 713
25 Ga0068869_101086492 3300005334 Unclassified 699
26 Ga0070666_10069396 3300005335 Bacteria 2396
27 Ga0070666_10950615 3300005335 Unclassified 636
28 Ga0070666_11336704 3300005335 Unclassified 535
29 Ga0070680_100017205 3300005336 Bacteria 5697
30 Ga0070680_100458794 3300005336 Unclassified 1088
31 Ga0070682_100000762 3300005337 Bacteria 19113
32 Ga0068868_101889479 3300005338 Unclassified 565
33 Ga0068868_101910028 3300005338 Unclassified 562
34 Ga0070660_100000249 3300005339 Bacteria 35440
35 Ga0070660_100000880 3300005339 Bacteria 20072
36 Ga0070660_101376390 3300005339 Bacteria 599
37 Ga0070689_101246870 3300005340 Unclassified 668
38 Ga0070691_10277022 3300005341 Unclassified 909
39 Ga0070687_100063289 3300005343 Bacteria 1961
40 Ga0070661_101374659 3300005344 Bacteria 593
41 Ga0070661_101663279 3300005344 Bacteria 540
42 Ga0070668_100203913 3300005347 Unclassified 1624
43 Ga0070668_100380397 3300005347 Unclassified 1201
44 Ga0070669_100837190 3300005353 Unclassified 783
45 Ga0070669_101383326 3300005353 Bacteria 610
46 Ga0070675_100907712 3300005354 Unclassified 807
47 Ga0070671_100000001 3300005355 Bacteria 1228151
48 Ga0070671_100361018 3300005355 Bacteria 1240
49 Ga0070671_101586016 3300005355 Bacteria 580
50 Ga0070674_100012866 3300005356 Bacteria 5152
51 Ga0070673_100000192 3300005364 Bacteria 30116
52 Ga0070688_101167883 3300005365 Unclassified 617
53 Ga0070659_100001735 3300005366 Bacteria 15663
54 Ga0070659_100271080 3300005366 Bacteria 1410
55 Ga0070659_100454414 3300005366 Bacteria 1087
56 Ga0070659_100645333 3300005366 Bacteria 912
57 Ga0070667_100000001 3300005367 Bacteria 1108638
58 Ga0070667_100028262 3300005367 Bacteria 4668
59 Ga0070667_100073489 3300005367 Bacteria 2915
60 Ga0070714_100103038 3300005435 Bacteria 2517
61 Ga0070663_100286648 3300005455 Bacteria 1314
62 Ga0070678_100000895 3300005456 Bacteria 15332
63 Ga0070678_100015910 3300005456 Unclassified 4794
64 Ga0070681_10124354 3300005458 Bacteria 2512
65 Ga0070681_10435031 3300005458 Unclassified 1224
66 Ga0070681_10796107 3300005458 Unclassified 862
67 Ga0070681_10921580 3300005458 Bacteria 792
68 Ga0070685_10000179 3300005466 Bacteria 42215
69 Ga0070685_10002933 3300005466 Bacteria 8718
70 Ga0070679_100000459 3300005530 Bacteria 34603
71 Ga0070679_100004837 3300005530 Bacteria 12426
72 Ga0070679_100005663 3300005530 Bacteria 11579
73 Ga0070679_100038416 3300005530 Bacteria 4760
74 Ga0070679_100067526 3300005530 Bacteria 3566
75 Ga0070679_100088365 3300005530 Bacteria 3086
76 Ga0070679_100126308 3300005530 Bacteria 2540
77 Ga0070679_100428429 3300005530 Unclassified 1268
78 Ga0070679_100544426 3300005530 Unclassified 1104
79 Ga0070679_101954574 3300005530 Unclassified 535
80 Ga0070684_100000546 3300005535 Bacteria 25878
81 Ga0070684_100342636 3300005535 Bacteria 1374
82 Ga0070684_100805093 3300005535 Bacteria 878
83 Ga0068853_100352086 3300005539 Bacteria 1370
84 Ga0068853_101475627 3300005539 Unclassified 658
85 Ga0070672_100008381 3300005543 Bacteria 7066
86 Ga0070686_100038466 3300005544 Unclassified 2974
87 Ga0070686_100577054 3300005544 Unclassified 883
88 Ga0070695_101132497 3300005545 Unclassified 641
89 Ga0070665_100315115 3300005548 Bacteria 1568
90 Ga0070665_100630106 3300005548 Bacteria 1085
91 Ga0068855_100000001 3300005563 Bacteria 818777
92 Ga0068855_100000136 3300005563 Bacteria 93608
93 Ga0068855_100001829 3300005563 Bacteria 26537
94 Ga0068855_100054461 3300005563 Bacteria 4701
95 Ga0068855_100097167 3300005563 Unclassified 3393
96 Ga0068855_100222625 3300005563 Bacteria 2115
97 Ga0068855_100637409 3300005563 Bacteria 1146
98 Ga0068855_100683989 3300005563 Bacteria 1099
99 Ga0068855_100709060 3300005563 Bacteria 1076
100 Ga0068855_100737561 3300005563 Bacteria 1051
101 Ga0068855_101034466 3300005563 Unclassified 861
102 Ga0068855_101202126 3300005563 Bacteria 788
103 Ga0068855_101443898 3300005563 Unclassified 708
104 Ga0068855_101500214 3300005563 Bacteria 692
105 Ga0068857_100000002 3300005577 Bacteria 241401
106 Ga0068857_100018186 3300005577 Bacteria 6165
107 Ga0068857_100021950 3300005577 Bacteria 5618
108 Ga0068857_100097385 3300005577 Bacteria 2637
109 Ga0068857_100154521 3300005577 Unclassified 2080
110 Ga0068856_100000445 3300005614 Bacteria 45664
111 Ga0068856_100005058 3300005614 Bacteria 13053
112 Ga0068852_100759088 3300005616 Unclassified 982
113 Ga0068859_100379353 3300005617 Bacteria 1509
114 Ga0068859_100635644 3300005617 Unclassified 1160
115 Ga0068851_10819207 3300005834 Unclassified 579
116 Ga0068863_100014451 3300005841 Bacteria 7605
117 Ga0068863_101008476 3300005841 Unclassified 835
118 Ga0068863_101370844 3300005841 Unclassified 715
119 Ga0068858_100527299 3300005842 Bacteria 1142
120 Ga0068860_100001264 3300005843 Bacteria 27609
121 Ga0068860_100032886 3300005843 Bacteria 4981
122 Ga0068862_100024657 3300005844 Bacteria 5048
123 Ga0081455_10000008 3300005937 Bacteria 256558
124 Ga0081539_10007087 3300005985 Bacteria 10366
125 Ga0081539_10051652 3300005985 Unclassified 2314
126 Ga0070717_10036201 3300006028 Bacteria 4001
127 Ga0075365_10003756 3300006038 Bacteria 7899
128 Ga0075368_10000061 3300006042 Bacteria 26210
129 Ga0075363_100000048 3300006048 Bacteria 23141
130 Ga0075363_100335704 3300006048 Unclassified 881
131 Ga0075364_10011031 3300006051 Bacteria 5482
132 Ga0075364_10074457 3300006051 Bacteria 2239
133 Ga0075364_10404295 3300006051 Bacteria 932
134 Ga0075367_10012978 3300006178 Bacteria 4464
135 Ga0075369_10000001 3300006186 Bacteria 299616
136 Ga0075369_10080952 3300006186 Bacteria 1440
137 Ga0075366_10000175 3300006195 Bacteria 27796
138 Ga0075366_10000379 3300006195 Bacteria 20641
139 Ga0075366_10620813 3300006195 Bacteria 670
140 Ga0097621_100000275 3300006237 Bacteria 34774
141 Ga0097621_100307575 3300006237 Unclassified 1401
142 Ga0075370_10029555 3300006353 Bacteria 3053
143 Ga0068871_100000038 3300006358 Bacteria 69723
144 Ga0075428_101863206 3300006844 Bacteria 625
145 Ga0097620_100379340 3300006931 Bacteria 1509
146 Ga0097620_100635662 3300006931 Unclassified 1160
147 Ga0105240_10000003 3300009093 Bacteria 1183681
148 Ga0105240_10009099 3300009093 Bacteria 14100
149 Ga0105240_10638756 3300009093 Unclassified 1168
150 Ga0105240_10975957 3300009093 Bacteria 907
151 Ga0105240_12089183 3300009093 Unclassified 588
152 Ga0111539_10001052 3300009094 Bacteria 36319
153 Ga0105245_10000001 3300009098 Bacteria 939270
154 Ga0105245_10000044 3300009098 Bacteria 135878
155 Ga0105245_10000050 3300009098 Bacteria 128014
156 Ga0105245_10016449 3300009098 Bacteria 6452
157 Ga0105245_10333970 3300009098 Bacteria 1497
158 Ga0105245_10738194 3300009098 Unclassified 1020
159 Ga0105243_10000001 3300009148 Bacteria 1156578
160 Ga0105243_10006553 3300009148 Bacteria 8993
161 Ga0105243_10635712 3300009148 Bacteria 1032
162 Ga0105241_10000003 3300009174 Bacteria 839043
163 Ga0105241_10002756 3300009174 Bacteria 13166
164 Ga0105241_10011505 3300009174 Bacteria 6486
165 Ga0105241_10497333 3300009174 Bacteria 1086
166 Ga0105241_11516997 3300009174 Unclassified 645
167 Ga0105241_12232976 3300009174 Unclassified 543
168 Ga0105242_10000011 3300009176 Bacteria 149791
169 Ga0105242_10222747 3300009176 Bacteria 1687
170 Ga0105248_10106219 3300009177 Bacteria 3166
171 Ga0105248_10189139 3300009177 Unclassified 2320
172 Ga0105248_10463865 3300009177 Bacteria 1428
173 Ga0105248_11887189 3300009177 Bacteria 678
174 Ga0105248_12812264 3300009177 Unclassified 555
175 Ga0105237_10005423 3300009545 Bacteria 14402
176 Ga0105237_10089883 3300009545 Bacteria 3060
177 Ga0105238_10000721 3300009551 Bacteria 34481
178 Ga0105238_10874968 3300009551 Unclassified 916
179 Ga0105238_11139472 3300009551 Bacteria 803
180 Ga0105238_11618234 3300009551 Unclassified 678
181 Ga0105238_11874358 3300009551 Bacteria 632
182 Ga0105238_12023876 3300009551 Bacteria 610
183 Ga0105238_12383693 3300009551 Unclassified 565
184 Ga0105249_10002064 3300009553 Bacteria 17404
185 Ga0105249_12886510 3300009553 Bacteria 552
186 Ga0105033_100929 3300009986 Bacteria 2323
187 Ga0105030_108759 3300009987 Bacteria 862
188 Ga0105239_10091108 3300010375 Unclassified 3364
189 Ga0105239_10093094 3300010375 Bacteria 3327
190 Ga0105239_10347625 3300010375 Bacteria 1674
191 Ga0105239_10380811 3300010375 Bacteria 1595
192 Ga0105239_10596606 3300010375 Bacteria 1260
193 Ga0157373_10000061 3300013100 Bacteria 95718
194 Ga0157373_10607636 3300013100 Bacteria 796
195 Ga0157371_10000105 3300013102 Bacteria 126728
196 Ga0157370_10111292 3300013104 Unclassified 2560
197 Ga0157370_10135866 3300013104 Bacteria 2292
198 Ga0157370_10494931 3300013104 Bacteria 1123
199 Ga0157369_10000505 3300013105 Bacteria 51370
200 Ga0157369_10297635 3300013105 Bacteria 1679
201 Ga0157369_10319152 3300013105 Unclassified 1615
202 Ga0157374_10000058 3300013296 Bacteria 116810
203 Ga0157374_10000115 3300013296 Bacteria 73739
204 Ga0157374_10003275 3300013296 Bacteria 13603
205 Ga0157374_10029826 3300013296 Bacteria 4947
206 Ga0157374_10186481 3300013296 Bacteria 2028
207 Ga0157374_10550511 3300013296 Bacteria 1161
208 Ga0157374_10609145 3300013296 Bacteria 1102
209 Ga0157374_10873081 3300013296 Unclassified 917
210 Ga0157374_12072708 3300013296 Bacteria 595
211 Ga0157378_10466535 3300013297 Bacteria 1256
212 Ga0157378_10827488 3300013297 Bacteria 953
213 Ga0157372_10000090 3300013307 Bacteria 93559
214 Ga0157372_10143548 3300013307 Bacteria 2753
215 Ga0157372_10317240 3300013307 Unclassified 1815
216 Ga0157372_10877820 3300013307 Bacteria 1041
217 Ga0157372_12570032 3300013307 Unclassified 584
218 Ga0157372_12807035 3300013307 Unclassified 558
219 Ga0163163_10004291 3300014325 Bacteria 12145
220 Ga0163163_11195908 3300014325 Bacteria 823
221 Ga0157380_13082708 3300014326 Unclassified 531
222 Ga0157377_10432098 3300014745 Bacteria 905
223 Ga0157377_10533947 3300014745 Bacteria 826
224 Ga0157379_11835854 3300014968 Bacteria 596
225 Ga0157376_10000007 3300014969 Bacteria 368004
226 Ga0163161_10980290 3300017792 Bacteria 720
227 Ga0207697_10356839 3300025315 Unclassified 649
228 Ga0207680_11205655 3300025903 Unclassified 540
229 Ga0207647_10001224 3300025904 Bacteria 19752
230 Ga0207705_10000011 3300025909 Bacteria 517768
231 Ga0207705_10000038 3300025909 Bacteria 193812
232 Ga0207705_10006447 3300025909 Bacteria 8691
233 Ga0207705_10024904 3300025909 Bacteria 4271
234 Ga0207705_10315848 3300025909 Unclassified 1200
235 Ga0207705_10573717 3300025909 Bacteria 877
236 Ga0207654_10000002 3300025911 Bacteria 1460142
237 Ga0207654_10001391 3300025911 Bacteria 12817
238 Ga0207654_10017729 3300025911 Bacteria 3727
239 Ga0207654_10574849 3300025911 Bacteria 802
240 Ga0207707_10100299 3300025912 Bacteria 2530
241 Ga0207707_10691338 3300025912 Unclassified 857
242 Ga0207707_11167553 3300025912 Unclassified 624
243 Ga0207695_10000005 3300025913 Bacteria 1196715
244 Ga0207695_10010293 3300025913 Bacteria 11451
245 Ga0207695_10234193 3300025913 Bacteria 1739
246 Ga0207695_10277251 3300025913 Bacteria 1571
247 Ga0207695_10601919 3300025913 Unclassified 980
248 Ga0207671_10112276 3300025914 Bacteria 2075
249 Ga0207671_10290268 3300025914 Bacteria 1291
250 Ga0207671_11071430 3300025914 Bacteria 634
251 Ga0207660_10038002 3300025917 Bacteria 3358
252 Ga0207660_10913786 3300025917 Unclassified 716
253 Ga0207662_10120627 3300025918 Bacteria 1644
254 Ga0207657_10012859 3300025919 Bacteria 8233
255 Ga0207657_10015575 3300025919 Bacteria 7360
256 Ga0207657_10967695 3300025919 Bacteria 654
257 Ga0207649_10304143 3300025920 Bacteria 1167
258 Ga0207652_10003452 3300025921 Bacteria 13036
259 Ga0207652_10005649 3300025921 Bacteria 10147
260 Ga0207652_10095506 3300025921 Bacteria 2619
261 Ga0207652_10318350 3300025921 Bacteria 1404
262 Ga0207652_10363174 3300025921 Bacteria 1307
263 Ga0207652_10445118 3300025921 Bacteria 1168
264 Ga0207652_10944598 3300025921 Unclassified 760
265 Ga0207652_11330181 3300025921 Unclassified 621
266 Ga0207681_10778623 3300025923 Unclassified 798
267 Ga0207694_10006064 3300025924 Bacteria 9246
268 Ga0207694_11655053 3300025924 Unclassified 539
269 Ga0207650_10155866 3300025925 Unclassified 1806
270 Ga0207650_11764367 3300025925 Unclassified 524
271 Ga0207687_10000001 3300025927 Bacteria 1130810
272 Ga0207687_10000004 3300025927 Bacteria 841177
273 Ga0207687_10000033 3300025927 Bacteria 135886
274 Ga0207687_10000375 3300025927 Bacteria 29944
275 Ga0207687_10011398 3300025927 Bacteria 5811
276 Ga0207687_10130511 3300025927 Unclassified 1893
277 Ga0207687_11458830 3300025927 Unclassified 588
278 Ga0207687_11583586 3300025927 Unclassified 562
279 Ga0207664_10098662 3300025929 Bacteria 2409
280 Ga0207644_10000001 3300025931 Bacteria 1243214
281 Ga0207644_10368928 3300025931 Unclassified 1169
282 Ga0207690_10000469 3300025932 Bacteria 25898
283 Ga0207690_10256272 3300025932 Bacteria 1354
284 Ga0207686_10000001 3300025934 Bacteria 1169580
285 Ga0207686_10008752 3300025934 Bacteria 5468
286 Ga0207686_10197664 3300025934 Bacteria 1438
287 Ga0207709_10000002 3300025935 Bacteria 1171536
288 Ga0207709_10014221 3300025935 Bacteria 4391
289 Ga0207709_10384050 3300025935 Bacteria 1069
290 Ga0207670_10717089 3300025936 Unclassified 829
291 Ga0207669_10009623 3300025937 Bacteria 4617
292 Ga0207669_10012427 3300025937 Bacteria 4186
293 Ga0207691_10077344 3300025940 Bacteria 2998
294 Ga0207711_10173480 3300025941 Unclassified 1958
295 Ga0207711_10578889 3300025941 Bacteria 1047
296 Ga0207711_11015912 3300025941 Bacteria 769
297 Ga0207711_11492936 3300025941 Unclassified 619
298 Ga0207689_10102483 3300025942 Bacteria 2351
299 Ga0207689_11285155 3300025942 Bacteria 615
300 Ga0207661_10000544 3300025944 Bacteria 24114
301 Ga0207661_10246665 3300025944 Bacteria 1586
302 Ga0207661_11571406 3300025944 Bacteria 602
303 Ga0207667_10000003 3300025949 Bacteria 822935
304 Ga0207667_10000060 3300025949 Bacteria 192320
305 Ga0207667_10034128 3300025949 Bacteria 5466
306 Ga0207667_10055275 3300025949 Bacteria 4174
307 Ga0207667_10141832 3300025949 Bacteria 2474
308 Ga0207667_11171607 3300025949 Bacteria 749
309 Ga0207667_11705237 3300025949 Unclassified 596
310 Ga0207651_10000546 3300025960 Bacteria 15744
311 Ga0207712_10001438 3300025961 Bacteria 16253
312 Ga0207712_11350430 3300025961 Unclassified 637
313 Ga0207668_11548649 3300025972 Unclassified 598
314 Ga0207658_10000003 3300025986 Bacteria 1151934
315 Ga0207658_10009634 3300025986 Bacteria 6555
316 Ga0207658_10027146 3300025986 Bacteria 4021
317 Ga0207658_11527439 3300025986 Bacteria 611
318 Ga0207639_10285943 3300026041 Bacteria 1452
319 Ga0207639_11081114 3300026041 Unclassified 752
320 Ga0207678_10392626 3300026067 Bacteria 1200
321 Ga0207702_10001979 3300026078 Bacteria 19915
322 Ga0207702_10013253 3300026078 Bacteria 6857
323 Ga0207702_10381789 3300026078 Bacteria 1355
324 Ga0207641_10107119 3300026088 Unclassified 2472
325 Ga0207641_10650747 3300026088 Bacteria 1035
326 Ga0207641_11060282 3300026088 Unclassified 808
327 Ga0207674_10000001 3300026116 Bacteria 616581
328 Ga0207674_10186785 3300026116 Bacteria 2023
329 Ga0207674_10480426 3300026116 Bacteria 1201
330 Ga0207674_11200976 3300026116 Unclassified 728
331 Ga0207683_10002815 3300026121 Bacteria 15194
332 Ga0207683_10010914 3300026121 Bacteria 7748
333 Ga0207698_10690249 3300026142 Unclassified 1015
334 Ga0209998_10068440 3300027717 Unclassified 846
335 Ga0209813_10000001 3300027866 Bacteria 280406
336 Ga0268266_10002852 3300028379 Bacteria 18007
337 Ga0268266_10516898 3300028379 Bacteria 1141
338 Ga0268265_10028375 3300028380 Bacteria 4006
339 Ga0268264_10003540 3300028381 Bacteria 13444
340 Ga0268264_10064411 3300028381 Unclassified 3085
341 Ga0265337_1000558 3300028556 Bacteria 19595
342 Ga0265337_1003836 3300028556 Bacteria 6387
343 Ga0265337_1064185 3300028556 Bacteria 1014
344 Ga0265326_10004953 3300028558 Bacteria 4219
345 Ga0265326_10177104 3300028558 Bacteria 611
346 Ga0265319_1001066 3300028563 Bacteria 17117
347 Ga0265319_1003528 3300028563 Bacteria 8118
348 Ga0265319_1064558 3300028563 Bacteria 1182
349 Ga0265334_10001298 3300028573 Bacteria 12060
350 Ga0265334_10008717 3300028573 Bacteria 4306
351 Ga0265334_10019774 3300028573 Bacteria 2765
352 Ga0265334_10099761 3300028573 Unclassified 1052
353 Ga0265318_10008410 3300028577 Unclassified 4597
354 Ga0265323_10003586 3300028653 Bacteria 6817
355 Ga0265322_10001650 3300028654 Bacteria 7115
356 Ga0265336_10002591 3300028666 Bacteria 7392
357 Ga0265338_10000217 3300028800 Bacteria 106453
358 Ga0265338_10000313 3300028800 Bacteria 87846
359 Ga0265338_10002134 3300028800 Bacteria 30383
360 Ga0265338_10002339 3300028800 Bacteria 28646
361 Ga0265338_10002608 3300028800 Bacteria 26653
362 Ga0265338_10005339 3300028800 Bacteria 16808
363 Ga0265338_10008101 3300028800 Bacteria 12841
364 Ga0265338_10015920 3300028800 Bacteria 8228
365 Ga0265338_10060642 3300028800 Archaea 3322
366 Ga0265338_10130767 3300028800 Bacteria 1982
367 Ga0265338_10850919 3300028800 Archaea 623
368 Ga0265324_10008047 3300029957 Bacteria 4224
369 Ga0265324_10326779 3300029957 Unclassified 522
370 Ga0265330_10008028 3300031235 Bacteria 5108
371 Ga0265332_10072211 3300031238 Unclassified 1469
372 Ga0265328_10002143 3300031239 Bacteria 8907
373 Ga0265320_10007604 3300031240 Bacteria 6714
374 Ga0265320_10103373 3300031240 Unclassified 1310
375 Ga0265320_10454493 3300031240 Unclassified 565
376 Ga0265325_10081012 3300031241 Unclassified 1613
377 Ga0265329_10009872 3300031242 Unclassified 3534
378 Ga0265340_10000915 3300031247 Bacteria 16743
379 Ga0265340_10010097 3300031247 Bacteria 5057
380 Ga0265339_10009617 3300031249 Bacteria 6055
381 Ga0265331_10007742 3300031250 Bacteria 6172
382 Ga0265331_10140034 3300031250 Bacteria 1101
383 Ga0265331_10165330 3300031250 Bacteria 1002
384 Ga0265327_10000025 3300031251 Bacteria 380054
385 Ga0265327_10001026 3300031251 Bacteria 39389
386 Ga0265327_10067188 3300031251 Archaea 1806
387 Ga0265327_10108050 3300031251 Bacteria 1333
388 Ga0265327_10180627 3300031251 Unclassified 965
389 Ga0265316_10049173 3300031344 Archaea 3322
390 Ga0265316_10074657 3300031344 Bacteria 2609
391 Ga0265316_10963792 3300031344 Unclassified 594
392 Ga0265313_10010889 3300031595 Bacteria 5704
393 Ga0265313_10045444 3300031595 Unclassified 2138
394 Ga0265314_10305639 3300031711 Archaea 890
395 Ga0265314_10351202 3300031711 Unclassified 811
396 Ga0265314_10486169 3300031711 Bacteria 652
397 Ga0265342_10556200 3300031712 Unclassified 581
398 Ga0307411_12097110 3300032005 Unclassified 529
399 Ga0373952_0104384 3300035092 Bacteria 751
400 Ga0395899_0030864 3300037312 Unclassified 4028
401 Ga0395899_0034514 3300037312 Bacteria 3800
402 Ga0395899_0269309 3300037312 Bacteria 1162
403 Ga0395899_0637406 3300037312 Unclassified 675
404 Ga0395900_0002337 3300037418 Bacteria 20997
405 Ga0395900_0003752 3300037418 Bacteria 16320
406 Ga0395900_0004799 3300037418 Bacteria 14243
407 Ga0395900_0132848 3300037418 Bacteria 2550
408 Ga0395900_0222137 3300037418 Bacteria 1903
409 Ga0395900_0454742 3300037418 Unclassified 1236
410 Ga0395900_0645857 3300037418 Unclassified 995
411 Ga0395900_0927357 3300037418 Bacteria 793
412 Ga0395900_1333229 3300037418 Bacteria 631
413 Ga0395898_0003233 3300037466 Bacteria 18304
414 Ga0395898_0020497 3300037466 Bacteria 6715
415 Ga0395898_0127662 3300037466 Bacteria 2436
416 Ga0395898_0303385 3300037466 Bacteria 1523
417 Ga0395898_0543814 3300037466 Bacteria 1103
418 Ga0395898_0737286 3300037466 Bacteria 927
419 Ga0395905_0002235 3300037471 Bacteria 21825
420 Ga0395905_0004073 3300037471 Bacteria 15320
421 Ga0395905_0063653 3300037471 Bacteria 3451
422 Ga0395905_0077344 3300037471 Bacteria 3118
423 Ga0395905_0388491 3300037471 Unclassified 1290
424 Ga0395905_0487073 3300037471 Bacteria 1133
425 Ga0395905_1009875 3300037471 Unclassified 735
426 Ga0395901_0012638 3300038443 Bacteria 8567
427 Ga0395901_0037796 3300038443 Bacteria 4993
428 Ga0395901_0037932 3300038443 Bacteria 4983
429 Ga0395901_0061745 3300038443 Bacteria 3899
430 Ga0395901_0343868 3300038443 Bacteria 1541
431 Ga0395901_0551324 3300038443 Unclassified 1168
432 Ga0395901_0552170 3300038443 Bacteria 1167
433 Ga0451798_0547688 3300041458 Unclassified 566
434 Ga0451804_0662213 3300041463 Bacteria 959
435 Ga0451577_1007404 3300042876 Bacteria 748
436 Ga0466967_0203229 3300045976 Bacteria 1877
437 Ga0466967_0341628 3300045976 Unclassified 1448
438 Ga0495609_0073467 3300046538 Bacteria 1500
439 Ga0495588_0000236 3300046674 Bacteria 48183
440 Ga0495671_0136834 3300046692 Bacteria 1194
441 Ga0495672_0000010 3300047320 Bacteria 545038
442 Ga0495672_0139251 3300047320 Bacteria 1269
443 Ga0495672_0367527 3300047320 Unclassified 664
444 Ga0495614_0214111 3300048089 Unclassified 874
445 Ga0496101_0382223 3300048904 Bacteria 1108
446 Ga0496104_1034241 3300048907 Bacteria 725
447 Ga0496104_1047866 3300048907 Bacteria 719
448 Ga0496105_0090024 3300048908 Bacteria 2535
449 Ga0496105_0465784 3300048908 Unclassified 996
450 Ga0496108_1239074 3300048911 Bacteria 629
451 Ga0496109_0076587 3300048912 Unclassified 3077
452 Ga0496112_0179603 3300048915 Unclassified 2080
453 Ga0496126_0197099 3300048929 Unclassified 1703
454 Ga0495678_174733 3300049459 Bacteria 677
455 Ga0501031_0000319 3300049568 Bacteria 27520
456 Ga0501032_0005885 3300049569 Bacteria 9068
457 Ga0501032_0122799 3300049569 Bacteria 1716
458 Ga0501033_0025669 3300049570 Unclassified 4439
459 Ga0501034_0001225 3300049571 Bacteria 35077
460 Ga0501036_0030723 3300049572 Bacteria 4537
461 Ga0501036_0037028 3300049572 Unclassified 4127
462 Ga0501037_0000031 3300049573 Bacteria 133137
463 Ga0501037_0043928 3300049573 Unclassified 3284
464 Ga0501037_0185494 3300049573 Unclassified 1474
465 Ga0501038_0037593 3300049574 Bacteria 4244
466 Ga0501038_0157081 3300049574 Bacteria 1851
467 Ga0501039_0257404 3300049575 Bacteria 1372
468 Ga0501042_0107412 3300049578 Bacteria 2009
469 Ga0501043_0000366 3300049579 Bacteria 40919
470 Ga0501043_0199336 3300049579 Bacteria 1554
471 Ga0501046_0000819 3300049580 Bacteria 30340
472 Ga0501047_0000032 3300049581 Bacteria 208294
473 Ga0501047_0000057 3300049581 Bacteria 140059
474 Ga0501048_0000013 3300049582 Bacteria 76554
475 Ga0501048_0016686 3300049582 Bacteria 5414
476 Ga0501069_0061787 3300049585 Bacteria 2092
477 Ga0501070_0015061 3300049586 Bacteria 6508
478 Ga0501070_0188060 3300049586 Bacteria 1698
479 Ga0501070_0233774 3300049586 Bacteria 1506
480 Ga0501073_0750538 3300049589 Bacteria 673
481 Ga0501234_000812 3300049707 Bacteria 4900
482 Ga0501083_0022968 3300049744 Bacteria 4329
483 Ga0501083_0033657 3300049744 Bacteria 3508
484 Ga0501083_0075289 3300049744 Bacteria 2242
485 Ga0501276_028753 3300049773 Bacteria 571
486 Ga0501035_0000005 3300049822 Bacteria 392980
487 Ga0501035_0011740 3300049822 Bacteria 8113
488 Ga0501044_0049040 3300049823 Bacteria 4358
489 Ga0501044_0110088 3300049823 Bacteria 2763
490 Ga0501045_0538966 3300049824 Unclassified 866
491 nmdc:mga03683_49_c1 3300050489 Bacteria 11796
492 nmdc:mga03n38_312183_c1 3300050490 Unclassified 847
493 nmdc:mga03n38_78_c1 3300050490 Bacteria 20635
494 nmdc:mga00v17_43362_c1 3300050491 Bacteria 2709
495 nmdc:mga00v17_483531_c1 3300050491 Unclassified 803
496 nmdc:mga00v17_65661_c1 3300050491 Bacteria 2239
497 nmdc:mga0yw44_1143_c2 3300050492 Bacteria 8343
498 nmdc:mga0yw44_162346_c1 3300050492 Bacteria 1463
499 nmdc:mga0k408_183_c2 3300050493 Bacteria 27809
500 nmdc:mga0k408_2341_c1 3300050493 Bacteria 10083
501 nmdc:mga06z11_15_c1 3300050494 Bacteria 82672
502 nmdc:mga06z11_161732_c1 3300050494 Unclassified 1280
503 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
504 nmdc:mga07m45_126191_c1 3300050496 Bacteria 1480
505 nmdc:mga07m45_256655_c1 3300050496 Unclassified 1017
506 nmdc:mga07m45_553691_c1 3300050496 Unclassified 665
507 nmdc:mga08y16_388_c1 3300050511 Bacteria 40225
508 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
509 nmdc:mga0sz30_72053_c1 3300050516 Bacteria 1488
510 Ga0500610_0000006 3300053079 Bacteria 134304
511 Ga0500610_0005196 3300053079 Bacteria 5301
512 Ga0500610_0299925 3300053079 Bacteria 709
513 Ga0500643_000043 3300053087 Bacteria 157905
514 Ga0500643_000148 3300053087 Bacteria 71560
515 Ga0500643_008683 3300053087 Bacteria 3968
516 Ga0500644_0000646 3300053088 Bacteria 12916
517 Ga0500644_0020807 3300053088 Bacteria 1956
518 Ga0500644_0052537 3300053088 Bacteria 1403
519 Ga0500644_0282078 3300053088 Unclassified 707
520 Ga0500646_0025526 3300053090 Bacteria 1596
521 Ga0500647_0300729 3300053091 Unclassified 686
522 Ga0500583_0000219 3300053092 Bacteria 21312
523 Ga0500583_0001709 3300053092 Bacteria 6417
524 Ga0500583_0002071 3300053092 Bacteria 5939
525 Ga0500651_0000050 3300053093 Bacteria 78674
526 Ga0500651_0003130 3300053093 Bacteria 8969
527 Ga0500651_0113418 3300053093 Bacteria 1652
528 Ga0500650_0000001 3300053098 Bacteria 818797
529 Ga0500555_000002 3300053103 Bacteria 1314346
530 Ga0500556_0002599 3300053104 Bacteria 5688
531 Ga0500562_006240 3300053108 Bacteria 3007
532 Ga0500562_009059 3300053108 Bacteria 2516
533 Ga0500593_000001 3300053117 Bacteria 784404
534 Ga0500594_0000001 3300053118 Bacteria 1178472
535 Ga0500594_0000082 3300053118 Bacteria 28953
536 Ga0500614_000001 3300053123 Bacteria 1274484
537 Ga0500614_002701 3300053123 Bacteria 3924
538 Ga0500628_000042 3300053129 Bacteria 46597
539 Ga0500628_012797 3300053129 Bacteria 1552
540 Ga0500642_0005452 3300053130 Bacteria 4103
541 Ga0500652_000022 3300053131 Bacteria 118313
542 Ga0500655_002749 3300053133 Bacteria 3188
543 Ga0500568_0007346 3300053139 Bacteria 5416
544 Ga0500568_0040568 3300053139 Unclassified 1873
545 Ga0500577_0000521 3300053142 Bacteria 9975
546 Ga0500579_000688 3300053143 Bacteria 19490
547 Ga0500589_000028 3300053147 Bacteria 63762
548 Ga0500589_053376 3300053147 Bacteria 1871
549 Ga0500604_0117250 3300053151 Bacteria 888
550 Ga0500633_0005267 3300053160 Bacteria 3054
551 Ga0500649_000011 3300053722 Bacteria 87970
552 Ga0500611_002366 3300053727 Bacteria 2245
553 Ga0500599_027423 3300053736 Unclassified 834

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_11139472 Ga0105238_111394722 59
2 3300009987 Ga0105030_108759 Ga0105030_1087592 61
3 3300005353 Ga0070669_101383326 Ga0070669_1013833262 62
4 3300014325 Ga0163163_10004291 Ga0163163_1000429115 62
5 3300014968 Ga0157379_11835854 Ga0157379_118358542 62
6 3300025986 Ga0207658_11527439 Ga0207658_115274391 62
7 3300049586 Ga0501070_0188060 Ga0501070_0188060_807_1019 62
8 3300003316 rootH1_10148481 rootH1_101484812 63
9 3300005530 Ga0070679_100428429 Ga0070679_1004284292 63
10 3300005535 Ga0070684_100342636 Ga0070684_1003426362 63
11 3300005563 Ga0068855_100001829 Ga0068855_10000182923 63
12 3300005577 Ga0068857_100018186 Ga0068857_1000181866 63
13 3300009174 Ga0105241_10497333 Ga0105241_104973333 63
14 3300009545 Ga0105237_10089883 Ga0105237_100898833 63
15 3300009551 Ga0105238_10000721 Ga0105238_1000072111 63
16 3300009551 Ga0105238_11874358 Ga0105238_118743582 63
17 3300013104 Ga0157370_10111292 Ga0157370_101112923 63
18 3300025911 Ga0207654_10574849 Ga0207654_105748492 63
19 3300025914 Ga0207671_10290268 Ga0207671_102902682 63
20 3300025921 Ga0207652_11330181 Ga0207652_113301812 63
21 3300025924 Ga0207694_10006064 Ga0207694_1000606413 63
22 3300025949 Ga0207667_10034128 Ga0207667_100341287 63
23 3300028800 Ga0265338_10000313 Ga0265338_1000031363 63
24 3300028800 Ga0265338_10005339 Ga0265338_100053397 63
25 3300046674 Ga0495588_0000236 Ga0495588_0000236_17170_17385 63
26 3300049773 Ga0501276_028753 Ga0501276_028753_214_429 63
27 3300053079 Ga0500610_0299925 Ga0500610_0299925_437_628 63
28 3300053088 Ga0500644_0020807 Ga0500644_0020807_87_278 63
29 3300053090 Ga0500646_0025526 Ga0500646_0025526_936_1127 63
30 3300053092 Ga0500583_0002071 Ga0500583_0002071_1262_1453 63
31 3300053098 Ga0500650_0000001 Ga0500650_0000001_577580_577771 63
32 3300053108 Ga0500562_009059 Ga0500562_009059_539_730 63
33 3300053118 Ga0500594_0000001 Ga0500594_0000001_61144_61335 63
34 3300053123 Ga0500614_000001 Ga0500614_000001_521750_521965 63
35 3300053133 Ga0500655_002749 Ga0500655_002749_1010_1201 63
36 3300053142 Ga0500577_0000521 Ga0500577_0000521_5855_6046 63
37 3300053143 Ga0500579_000688 Ga0500579_000688_2873_3064 63
38 3300053151 Ga0500604_0117250 Ga0500604_0117250_265_480 63
39 3300053160 Ga0500633_0005267 Ga0500633_0005267_1851_2042 63
40 3300053722 Ga0500649_000011 Ga0500649_000011_10376_10591 63
41 3300041458 Ga0451798_0547688 Ga0451798_0547688_43_258 64
42 3300010375 Ga0105239_10091108 Ga0105239_100911082 65
43 3300025914 Ga0207671_11071430 Ga0207671_110714301 65
44 3300009177 Ga0105248_10463865 Ga0105248_104638652 68
45 3300005329 Ga0070683_100301894 Ga0070683_1003018942 69
46 3300005335 Ga0070666_11336704 Ga0070666_113367042 69
47 3300005347 Ga0070668_100203913 Ga0070668_1002039132 69
48 3300005347 Ga0070668_100380397 Ga0070668_1003803972 69
49 3300005367 Ga0070667_100073489 Ga0070667_1000734893 69
50 3300005544 Ga0070686_100577054 Ga0070686_1005770542 69
51 3300005841 Ga0068863_101370844 Ga0068863_1013708442 69
52 3300005843 Ga0068860_100032886 Ga0068860_1000328864 69
53 3300005844 Ga0068862_100024657 Ga0068862_1000246572 69
54 3300009177 Ga0105248_10189139 Ga0105248_101891392 69
55 3300009553 Ga0105249_10002064 Ga0105249_1000206411 69
56 3300025941 Ga0207711_10578889 Ga0207711_105788893 69
57 3300025944 Ga0207661_10246665 Ga0207661_102466652 69
58 3300025961 Ga0207712_10001438 Ga0207712_100014384 69
59 3300025972 Ga0207668_11548649 Ga0207668_115486492 69
60 3300025986 Ga0207658_10027146 Ga0207658_100271463 69
61 3300026088 Ga0207641_10650747 Ga0207641_106507472 69
62 3300028380 Ga0268265_10028375 Ga0268265_100283755 69
63 3300028381 Ga0268264_10064411 Ga0268264_100644112 69
64 3300001904 JGI24736J21556_1012325 JGI24736J21556_10123253 70
65 3300005327 Ga0070658_10000012 Ga0070658_10000012162 70
66 3300005327 Ga0070658_10270031 Ga0070658_102700311 70
67 3300005327 Ga0070658_10393817 Ga0070658_103938172 70
68 3300005327 Ga0070658_11521127 Ga0070658_115211272 70
69 3300005328 Ga0070676_10033662 Ga0070676_100336622 70
70 3300005331 Ga0070670_100038066 Ga0070670_1000380662 70
71 3300005331 Ga0070670_101507263 Ga0070670_1015072632 70
72 3300005334 Ga0068869_101043054 Ga0068869_1010430541 70
73 3300005335 Ga0070666_10069396 Ga0070666_100693963 70
74 3300005335 Ga0070666_10950615 Ga0070666_109506152 70
75 3300005339 Ga0070660_100000249 Ga0070660_1000002495 70
76 3300005339 Ga0070660_101376390 Ga0070660_1013763902 70
77 3300005341 Ga0070691_10277022 Ga0070691_102770222 70
78 3300005344 Ga0070661_101663279 Ga0070661_1016632791 70
79 3300005353 Ga0070669_100837190 Ga0070669_1008371901 70
80 3300005354 Ga0070675_100907712 Ga0070675_1009077122 70
81 3300005355 Ga0070671_100000001 Ga0070671_100000001681 70
82 3300005355 Ga0070671_101586016 Ga0070671_1015860161 70
83 3300005364 Ga0070673_100000192 Ga0070673_10000019234 70
84 3300005366 Ga0070659_100001735 Ga0070659_10000173513 70
85 3300005366 Ga0070659_100271080 Ga0070659_1002710802 70
86 3300005366 Ga0070659_100645333 Ga0070659_1006453331 70
87 3300005367 Ga0070667_100000001 Ga0070667_100000001584 70
88 3300005456 Ga0070678_100000895 Ga0070678_10000089510 70
89 3300005458 Ga0070681_10124354 Ga0070681_101243542 70
90 3300005458 Ga0070681_10796107 Ga0070681_107961072 70
91 3300005458 Ga0070681_10921580 Ga0070681_109215802 70
92 3300005466 Ga0070685_10000179 Ga0070685_100001794 70
93 3300005530 Ga0070679_100005663 Ga0070679_10000566310 70
94 3300005530 Ga0070679_100038416 Ga0070679_1000384164 70
95 3300005530 Ga0070679_100544426 Ga0070679_1005444261 70
96 3300005530 Ga0070679_101954574 Ga0070679_1019545741 70
97 3300005539 Ga0068853_100352086 Ga0068853_1003520862 70
98 3300005543 Ga0070672_100008381 Ga0070672_1000083818 70
99 3300005548 Ga0070665_100315115 Ga0070665_1003151153 70
100 3300005548 Ga0070665_100630106 Ga0070665_1006301063 70
101 3300005563 Ga0068855_100000001 Ga0068855_100000001110 70
102 3300005563 Ga0068855_100000136 Ga0068855_10000013634 70
103 3300005563 Ga0068855_100054461 Ga0068855_1000544615 70
104 3300005563 Ga0068855_100097167 Ga0068855_1000971672 70
105 3300005563 Ga0068855_100222625 Ga0068855_1002226252 70
106 3300005563 Ga0068855_100637409 Ga0068855_1006374092 70
107 3300005563 Ga0068855_100709060 Ga0068855_1007090602 70
108 3300005563 Ga0068855_100737561 Ga0068855_1007375612 70
109 3300005563 Ga0068855_101202126 Ga0068855_1012021262 70
110 3300005563 Ga0068855_101443898 Ga0068855_1014438982 70
111 3300005563 Ga0068855_101500214 Ga0068855_1015002142 70
112 3300005577 Ga0068857_100000002 Ga0068857_100000002239 70
113 3300005577 Ga0068857_100021950 Ga0068857_1000219506 70
114 3300005577 Ga0068857_100097385 Ga0068857_1000973853 70
115 3300005577 Ga0068857_100154521 Ga0068857_1001545211 70
116 3300005614 Ga0068856_100005058 Ga0068856_1000050588 70
117 3300005834 Ga0068851_10819207 Ga0068851_108192072 70
118 3300005841 Ga0068863_100014451 Ga0068863_10001445111 70
119 3300005841 Ga0068863_101008476 Ga0068863_1010084762 70
120 3300005842 Ga0068858_100527299 Ga0068858_1005272993 70
121 3300005843 Ga0068860_100001264 Ga0068860_10000126416 70
122 3300005985 Ga0081539_10051652 Ga0081539_100516522 70
123 3300006028 Ga0070717_10036201 Ga0070717_100362016 70
124 3300006038 Ga0075365_10003756 Ga0075365_100037568 70
125 3300006051 Ga0075364_10011031 Ga0075364_100110316 70
126 3300006186 Ga0075369_10080952 Ga0075369_100809523 70
127 3300009093 Ga0105240_10000003 Ga0105240_10000003924 70
128 3300009098 Ga0105245_10000050 Ga0105245_1000005063 70
129 3300009098 Ga0105245_10016449 Ga0105245_100164495 70
130 3300009098 Ga0105245_10738194 Ga0105245_107381942 70
131 3300009148 Ga0105243_10000001 Ga0105243_10000001367 70
132 3300009148 Ga0105243_10635712 Ga0105243_106357122 70
133 3300009174 Ga0105241_10000003 Ga0105241_10000003403 70
134 3300009174 Ga0105241_11516997 Ga0105241_115169972 70
135 3300009174 Ga0105241_12232976 Ga0105241_122329762 70
136 3300009176 Ga0105242_10000011 Ga0105242_1000001184 70
137 3300009176 Ga0105242_10222747 Ga0105242_102227472 70
138 3300009177 Ga0105248_11887189 Ga0105248_118871892 70
139 3300009177 Ga0105248_12812264 Ga0105248_128122641 70
140 3300009545 Ga0105237_10005423 Ga0105237_1000542311 70
141 3300009551 Ga0105238_11618234 Ga0105238_116182342 70
142 3300009551 Ga0105238_12023876 Ga0105238_120238762 70
143 3300009551 Ga0105238_12383693 Ga0105238_123836932 70
144 3300009553 Ga0105249_12886510 Ga0105249_128865101 70
145 3300010375 Ga0105239_10093094 Ga0105239_100930942 70
146 3300010375 Ga0105239_10380811 Ga0105239_103808113 70
147 3300010375 Ga0105239_10596606 Ga0105239_105966061 70
148 3300013100 Ga0157373_10607636 Ga0157373_106076362 70
149 3300013105 Ga0157369_10000505 Ga0157369_100005055 70
150 3300013105 Ga0157369_10297635 Ga0157369_102976352 70
151 3300013296 Ga0157374_10000115 Ga0157374_1000011527 70
152 3300013296 Ga0157374_10003275 Ga0157374_100032759 70
153 3300013296 Ga0157374_10029826 Ga0157374_100298264 70
154 3300013296 Ga0157374_10550511 Ga0157374_105505112 70
155 3300013296 Ga0157374_10609145 Ga0157374_106091452 70
156 3300013296 Ga0157374_12072708 Ga0157374_120727082 70
157 3300013297 Ga0157378_10466535 Ga0157378_104665352 70
158 3300013297 Ga0157378_10827488 Ga0157378_108274882 70
159 3300013307 Ga0157372_10000090 Ga0157372_1000009017 70
160 3300013307 Ga0157372_10143548 Ga0157372_101435483 70
161 3300013307 Ga0157372_10877820 Ga0157372_108778203 70
162 3300013307 Ga0157372_12570032 Ga0157372_125700322 70
163 3300014325 Ga0163163_11195908 Ga0163163_111959082 70
164 3300014326 Ga0157380_13082708 Ga0157380_130827082 70
165 3300014969 Ga0157376_10000007 Ga0157376_10000007386 70
166 3300017792 Ga0163161_10980290 Ga0163161_109802902 70
167 3300025315 Ga0207697_10356839 Ga0207697_103568392 70
168 3300025903 Ga0207680_11205655 Ga0207680_112056552 70
169 3300025904 Ga0207647_10001224 Ga0207647_1000122410 70
170 3300025909 Ga0207705_10000038 Ga0207705_10000038129 70
171 3300025909 Ga0207705_10006447 Ga0207705_100064475 70
172 3300025909 Ga0207705_10315848 Ga0207705_103158482 70
173 3300025909 Ga0207705_10573717 Ga0207705_105737172 70
174 3300025911 Ga0207654_10000002 Ga0207654_10000002804 70
175 3300025912 Ga0207707_10100299 Ga0207707_101002993 70
176 3300025912 Ga0207707_10691338 Ga0207707_106913382 70
177 3300025913 Ga0207695_10000005 Ga0207695_10000005934 70
178 3300025913 Ga0207695_10234193 Ga0207695_102341932 70
179 3300025914 Ga0207671_10112276 Ga0207671_101122761 70
180 3300025919 Ga0207657_10015575 Ga0207657_100155755 70
181 3300025921 Ga0207652_10005649 Ga0207652_100056499 70
182 3300025921 Ga0207652_10445118 Ga0207652_104451184 70
183 3300025923 Ga0207681_10778623 Ga0207681_107786232 70
184 3300025925 Ga0207650_10155866 Ga0207650_101558662 70
185 3300025925 Ga0207650_11764367 Ga0207650_117643671 70
186 3300025927 Ga0207687_10000375 Ga0207687_1000037511 70
187 3300025927 Ga0207687_10011398 Ga0207687_100113983 70
188 3300025927 Ga0207687_10130511 Ga0207687_101305113 70
189 3300025927 Ga0207687_11583586 Ga0207687_115835862 70
190 3300025931 Ga0207644_10000001 Ga0207644_10000001755 70
191 3300025932 Ga0207690_10000469 Ga0207690_100004698 70
192 3300025932 Ga0207690_10256272 Ga0207690_102562723 70
193 3300025934 Ga0207686_10000001 Ga0207686_10000001775 70
194 3300025934 Ga0207686_10197664 Ga0207686_101976642 70
195 3300025935 Ga0207709_10000002 Ga0207709_10000002893 70
196 3300025935 Ga0207709_10384050 Ga0207709_103840502 70
197 3300025937 Ga0207669_10012427 Ga0207669_100124273 70
198 3300025940 Ga0207691_10077344 Ga0207691_100773444 70
199 3300025941 Ga0207711_11015912 Ga0207711_110159122 70
200 3300025942 Ga0207689_11285155 Ga0207689_112851552 70
201 3300025949 Ga0207667_10000003 Ga0207667_10000003104 70
202 3300025949 Ga0207667_10000060 Ga0207667_1000006090 70
203 3300025949 Ga0207667_10055275 Ga0207667_100552754 70
204 3300025949 Ga0207667_10141832 Ga0207667_101418322 70
205 3300025949 Ga0207667_11171607 Ga0207667_111716072 70
206 3300025960 Ga0207651_10000546 Ga0207651_100005467 70
207 3300025986 Ga0207658_10000003 Ga0207658_10000003797 70
208 3300026041 Ga0207639_10285943 Ga0207639_102859433 70
209 3300026078 Ga0207702_10013253 Ga0207702_100132538 70
210 3300026078 Ga0207702_10381789 Ga0207702_103817893 70
211 3300026088 Ga0207641_10107119 Ga0207641_101071193 70
212 3300026088 Ga0207641_11060282 Ga0207641_110602822 70
213 3300026116 Ga0207674_10000001 Ga0207674_10000001662 70
214 3300026116 Ga0207674_10186785 Ga0207674_101867851 70
215 3300026116 Ga0207674_11200976 Ga0207674_112009762 70
216 3300026121 Ga0207683_10002815 Ga0207683_100028156 70
217 3300027717 Ga0209998_10068440 Ga0209998_100684401 70
218 3300028379 Ga0268266_10516898 Ga0268266_105168981 70
219 3300028381 Ga0268264_10003540 Ga0268264_100035407 70
220 3300028556 Ga0265337_1064185 Ga0265337_10641852 70
221 3300028558 Ga0265326_10177104 Ga0265326_101771042 70
222 3300028573 Ga0265334_10001298 Ga0265334_100012985 70
223 3300028800 Ga0265338_10000217 Ga0265338_1000021754 70
224 3300028800 Ga0265338_10002339 Ga0265338_100023394 70
225 3300028800 Ga0265338_10008101 Ga0265338_100081017 70
226 3300028800 Ga0265338_10130767 Ga0265338_101307673 70
227 3300031247 Ga0265340_10000915 Ga0265340_100009158 70
228 3300031711 Ga0265314_10486169 Ga0265314_104861692 70
229 3300037418 Ga0395900_0454742 Ga0395900_0454742_845_1057 70
230 3300037418 Ga0395900_1333229 Ga0395900_1333229_43_255 70
231 3300037466 Ga0395898_0737286 Ga0395898_0737286_80_292 70
232 3300037471 Ga0395905_0002235 Ga0395905_0002235_19058_19270 70
233 3300038443 Ga0395901_0012638 Ga0395901_0012638_3687_3899 70
234 3300038443 Ga0395901_0037796 Ga0395901_0037796_3442_3654 70
235 3300041463 Ga0451804_0662213 Ga0451804_0662213_287_499 70
236 3300042876 Ga0451577_1007404 Ga0451577_1007404_28_243 70
237 3300045976 Ga0466967_0203229 Ga0466967_0203229_1403_1615 70
238 3300045976 Ga0466967_0341628 Ga0466967_0341628_522_734 70
239 3300047320 Ga0495672_0000010 Ga0495672_0000010_511720_511932 70
240 3300048904 Ga0496101_0382223 Ga0496101_0382223_658_870 70
241 3300048907 Ga0496104_1034241 Ga0496104_1034241_362_574 70
242 3300048907 Ga0496104_1047866 Ga0496104_1047866_241_459 70
243 3300048908 Ga0496105_0465784 Ga0496105_0465784_641_853 70
244 3300048911 Ga0496108_1239074 Ga0496108_1239074_251_469 70
245 3300048912 Ga0496109_0076587 Ga0496109_0076587_2276_2494 70
246 3300048915 Ga0496112_0179603 Ga0496112_0179603_793_1011 70
247 3300049586 Ga0501070_0233774 Ga0501070_0233774_668_880 70
248 3300049589 Ga0501073_0750538 Ga0501073_0750538_393_605 70
249 3300050491 nmdc:mga00v17_43362_c1 nmdc:mga00v17_43362_c1_1037_1249 70
250 3300050492 nmdc:mga0yw44_1143_c2 nmdc:mga0yw44_1143_c2_2750_2962 70
251 3300050492 nmdc:mga0yw44_162346_c1 nmdc:mga0yw44_162346_c1_1123_1335 70
252 3300050516 nmdc:mga0sz30_72053_c1 nmdc:mga0sz30_72053_c1_660_872 70
253 3300053087 Ga0500643_000043 Ga0500643_000043_37732_37944 70
254 3300053087 Ga0500643_000148 Ga0500643_000148_45546_45758 70
255 3300053088 Ga0500644_0282078 Ga0500644_0282078_316_528 70
256 3300053091 Ga0500647_0300729 Ga0500647_0300729_83_295 70
257 3300053092 Ga0500583_0001709 Ga0500583_0001709_4418_4630 70
258 3300053093 Ga0500651_0000050 Ga0500651_0000050_47289_47501 70
259 3300053093 Ga0500651_0003130 Ga0500651_0003130_3148_3360 70
260 3300053123 Ga0500614_002701 Ga0500614_002701_2532_2744 70
261 3300053139 Ga0500568_0007346 Ga0500568_0007346_363_575 70
262 3300053139 Ga0500568_0040568 Ga0500568_0040568_425_637 70
263 3300053147 Ga0500589_053376 Ga0500589_053376_1397_1609 70
264 3300053727 Ga0500611_002366 Ga0500611_002366_371_583 70
265 2088090001 CNB_F6ESG4R02F26E1 CNB_01220220 71
266 3300001979 JGI24740J21852_10048734 JGI24740J21852_100487343 71
267 3300003316 rootH1_10107612 rootH1_101076122 71
268 3300003320 rootH2_10249488 rootH2_102494886 71
269 3300003322 rootL2_10317277 rootL2_103172772 71
270 3300003322 rootL2_10384956 rootL2_103849563 71
271 3300003911 JGI25405J52794_10017988 JGI25405J52794_100179881 71
272 3300005289 Ga0065704_10264973 Ga0065704_102649731 71
273 3300005327 Ga0070658_10000015 Ga0070658_10000015226 71
274 3300005329 Ga0070683_100000444 Ga0070683_10000044417 71
275 3300005329 Ga0070683_101014207 Ga0070683_1010142072 71
276 3300005330 Ga0070690_100001909 Ga0070690_1000019096 71
277 3300005331 Ga0070670_100936792 Ga0070670_1009367922 71
278 3300005334 Ga0068869_101086492 Ga0068869_1010864922 71
279 3300005336 Ga0070680_100017205 Ga0070680_1000172055 71
280 3300005336 Ga0070680_100458794 Ga0070680_1004587942 71
281 3300005337 Ga0070682_100000762 Ga0070682_1000007628 71
282 3300005338 Ga0068868_101889479 Ga0068868_1018894792 71
283 3300005338 Ga0068868_101910028 Ga0068868_1019100282 71
284 3300005339 Ga0070660_100000880 Ga0070660_10000088013 71
285 3300005340 Ga0070689_101246870 Ga0070689_1012468702 71
286 3300005343 Ga0070687_100063289 Ga0070687_1000632891 71
287 3300005344 Ga0070661_101374659 Ga0070661_1013746592 71
288 3300005355 Ga0070671_100361018 Ga0070671_1003610181 71
289 3300005356 Ga0070674_100012866 Ga0070674_1000128665 71
290 3300005365 Ga0070688_101167883 Ga0070688_1011678832 71
291 3300005366 Ga0070659_100454414 Ga0070659_1004544142 71
292 3300005367 Ga0070667_100028262 Ga0070667_1000282622 71
293 3300005435 Ga0070714_100103038 Ga0070714_1001030383 71
294 3300005455 Ga0070663_100286648 Ga0070663_1002866482 71
295 3300005456 Ga0070678_100015910 Ga0070678_1000159102 71
296 3300005458 Ga0070681_10435031 Ga0070681_104350312 71
297 3300005466 Ga0070685_10002933 Ga0070685_100029337 71
298 3300005530 Ga0070679_100000459 Ga0070679_1000004593 71
299 3300005530 Ga0070679_100004837 Ga0070679_1000048378 71
300 3300005530 Ga0070679_100067526 Ga0070679_1000675262 71
301 3300005530 Ga0070679_100088365 Ga0070679_1000883653 71
302 3300005530 Ga0070679_100126308 Ga0070679_1001263083 71
303 3300005535 Ga0070684_100000546 Ga0070684_1000005469 71
304 3300005535 Ga0070684_100805093 Ga0070684_1008050931 71
305 3300005539 Ga0068853_101475627 Ga0068853_1014756272 71
306 3300005544 Ga0070686_100038466 Ga0070686_1000384663 71
307 3300005545 Ga0070695_101132497 Ga0070695_1011324972 71
308 3300005563 Ga0068855_100683989 Ga0068855_1006839893 71
309 3300005563 Ga0068855_101034466 Ga0068855_1010344663 71
310 3300005614 Ga0068856_100000445 Ga0068856_1000004453 71
311 3300005616 Ga0068852_100759088 Ga0068852_1007590882 71
312 3300005617 Ga0068859_100379353 Ga0068859_1003793532 71
313 3300005617 Ga0068859_100635644 Ga0068859_1006356443 71
314 3300005937 Ga0081455_10000008 Ga0081455_1000000844 71
315 3300005985 Ga0081539_10007087 Ga0081539_100070875 71
316 3300006042 Ga0075368_10000061 Ga0075368_100000616 71
317 3300006048 Ga0075363_100000048 Ga0075363_10000004826 71
318 3300006048 Ga0075363_100335704 Ga0075363_1003357042 71
319 3300006051 Ga0075364_10074457 Ga0075364_100744573 71
320 3300006051 Ga0075364_10404295 Ga0075364_104042952 71
321 3300006178 Ga0075367_10012978 Ga0075367_100129783 71
322 3300006186 Ga0075369_10000001 Ga0075369_1000000161 71
323 3300006195 Ga0075366_10000175 Ga0075366_1000017519 71
324 3300006195 Ga0075366_10000379 Ga0075366_1000037915 71
325 3300006195 Ga0075366_10620813 Ga0075366_106208131 71
326 3300006237 Ga0097621_100000275 Ga0097621_1000002756 71
327 3300006237 Ga0097621_100307575 Ga0097621_1003075752 71
328 3300006353 Ga0075370_10029555 Ga0075370_100295553 71
329 3300006358 Ga0068871_100000038 Ga0068871_10000003836 71
330 3300006844 Ga0075428_101863206 Ga0075428_1018632062 71
331 3300006931 Ga0097620_100379340 Ga0097620_1003793402 71
332 3300006931 Ga0097620_100635662 Ga0097620_1006356623 71
333 3300009093 Ga0105240_10009099 Ga0105240_100090995 71
334 3300009093 Ga0105240_10638756 Ga0105240_106387562 71
335 3300009093 Ga0105240_10975957 Ga0105240_109759572 71
336 3300009093 Ga0105240_12089183 Ga0105240_120891831 71
337 3300009094 Ga0111539_10001052 Ga0111539_1000105224 71
338 3300009098 Ga0105245_10000001 Ga0105245_10000001547 71
339 3300009098 Ga0105245_10000044 Ga0105245_1000004434 71
340 3300009098 Ga0105245_10333970 Ga0105245_103339702 71
341 3300009148 Ga0105243_10006553 Ga0105243_100065532 71
342 3300009174 Ga0105241_10002756 Ga0105241_100027563 71
343 3300009174 Ga0105241_10011505 Ga0105241_100115057 71
344 3300009177 Ga0105248_10106219 Ga0105248_101062193 71
345 3300009551 Ga0105238_10874968 Ga0105238_108749682 71
346 3300009986 Ga0105033_100929 Ga0105033_1009292 71
347 3300010375 Ga0105239_10347625 Ga0105239_103476252 71
348 3300013100 Ga0157373_10000061 Ga0157373_100000613 71
349 3300013102 Ga0157371_10000105 Ga0157371_1000010526 71
350 3300013104 Ga0157370_10135866 Ga0157370_101358662 71
351 3300013104 Ga0157370_10494931 Ga0157370_104949312 71
352 3300013105 Ga0157369_10319152 Ga0157369_103191523 71
353 3300013296 Ga0157374_10000058 Ga0157374_1000005887 71
354 3300013296 Ga0157374_10186481 Ga0157374_101864812 71
355 3300013296 Ga0157374_10873081 Ga0157374_108730812 71
356 3300013307 Ga0157372_10317240 Ga0157372_103172403 71
357 3300013307 Ga0157372_12807035 Ga0157372_128070352 71
358 3300014745 Ga0157377_10432098 Ga0157377_104320982 71
359 3300014745 Ga0157377_10533947 Ga0157377_105339472 71
360 3300025909 Ga0207705_10000011 Ga0207705_10000011119 71
361 3300025909 Ga0207705_10024904 Ga0207705_100249046 71
362 3300025911 Ga0207654_10001391 Ga0207654_1000139115 71
363 3300025911 Ga0207654_10017729 Ga0207654_100177294 71
364 3300025912 Ga0207707_11167553 Ga0207707_111675532 71
365 3300025913 Ga0207695_10010293 Ga0207695_100102939 71
366 3300025913 Ga0207695_10277251 Ga0207695_102772512 71
367 3300025913 Ga0207695_10601919 Ga0207695_106019192 71
368 3300025917 Ga0207660_10038002 Ga0207660_100380023 71
369 3300025917 Ga0207660_10913786 Ga0207660_109137862 71
370 3300025918 Ga0207662_10120627 Ga0207662_101206273 71
371 3300025919 Ga0207657_10012859 Ga0207657_100128592 71
372 3300025919 Ga0207657_10967695 Ga0207657_109676952 71
373 3300025920 Ga0207649_10304143 Ga0207649_103041433 71
374 3300025921 Ga0207652_10003452 Ga0207652_1000345211 71
375 3300025921 Ga0207652_10095506 Ga0207652_100955063 71
376 3300025921 Ga0207652_10318350 Ga0207652_103183502 71
377 3300025921 Ga0207652_10363174 Ga0207652_103631742 71
378 3300025921 Ga0207652_10944598 Ga0207652_109445982 71
379 3300025924 Ga0207694_11655053 Ga0207694_116550531 71
380 3300025927 Ga0207687_10000001 Ga0207687_10000001109 71
381 3300025927 Ga0207687_10000004 Ga0207687_10000004724 71
382 3300025927 Ga0207687_10000033 Ga0207687_1000003333 71
383 3300025927 Ga0207687_11458830 Ga0207687_114588302 71
384 3300025929 Ga0207664_10098662 Ga0207664_100986623 71
385 3300025931 Ga0207644_10368928 Ga0207644_103689281 71
386 3300025934 Ga0207686_10008752 Ga0207686_100087524 71
387 3300025935 Ga0207709_10014221 Ga0207709_100142212 71
388 3300025936 Ga0207670_10717089 Ga0207670_107170893 71
389 3300025937 Ga0207669_10009623 Ga0207669_100096231 71
390 3300025941 Ga0207711_10173480 Ga0207711_101734802 71
391 3300025941 Ga0207711_11492936 Ga0207711_114929362 71
392 3300025942 Ga0207689_10102483 Ga0207689_101024832 71
393 3300025944 Ga0207661_10000544 Ga0207661_100005447 71
394 3300025944 Ga0207661_11571406 Ga0207661_115714062 71
395 3300025949 Ga0207667_11705237 Ga0207667_117052372 71
396 3300025961 Ga0207712_11350430 Ga0207712_113504302 71
397 3300025986 Ga0207658_10009634 Ga0207658_100096343 71
398 3300026041 Ga0207639_11081114 Ga0207639_110811142 71
399 3300026067 Ga0207678_10392626 Ga0207678_103926262 71
400 3300026078 Ga0207702_10001979 Ga0207702_100019793 71
401 3300026116 Ga0207674_10480426 Ga0207674_104804262 71
402 3300026121 Ga0207683_10010914 Ga0207683_100109146 71
403 3300026142 Ga0207698_10690249 Ga0207698_106902492 71
404 3300027866 Ga0209813_10000001 Ga0209813_10000001224 71
405 3300028379 Ga0268266_10002852 Ga0268266_1000285210 71
406 3300028556 Ga0265337_1000558 Ga0265337_100055813 71
407 3300028556 Ga0265337_1003836 Ga0265337_10038367 71
408 3300028558 Ga0265326_10004953 Ga0265326_100049537 71
409 3300028563 Ga0265319_1001066 Ga0265319_10010667 71
410 3300028563 Ga0265319_1003528 Ga0265319_10035283 71
411 3300028563 Ga0265319_1064558 Ga0265319_10645582 71
412 3300028573 Ga0265334_10008717 Ga0265334_100087177 71
413 3300028573 Ga0265334_10019774 Ga0265334_100197742 71
414 3300028573 Ga0265334_10099761 Ga0265334_100997613 71
415 3300028577 Ga0265318_10008410 Ga0265318_100084102 71
416 3300028653 Ga0265323_10003586 Ga0265323_100035868 71
417 3300028654 Ga0265322_10001650 Ga0265322_100016503 71
418 3300028666 Ga0265336_10002591 Ga0265336_100025917 71
419 3300028800 Ga0265338_10002134 Ga0265338_1000213421 71
420 3300028800 Ga0265338_10002608 Ga0265338_1000260819 71
421 3300028800 Ga0265338_10015920 Ga0265338_100159204 71
422 3300028800 Ga0265338_10060642 Ga0265338_100606422 71
423 3300028800 Ga0265338_10850919 Ga0265338_108509191 71
424 3300029957 Ga0265324_10008047 Ga0265324_100080477 71
425 3300029957 Ga0265324_10326779 Ga0265324_103267792 71
426 3300031235 Ga0265330_10008028 Ga0265330_100080283 71
427 3300031238 Ga0265332_10072211 Ga0265332_100722113 71
428 3300031239 Ga0265328_10002143 Ga0265328_100021436 71
429 3300031240 Ga0265320_10007604 Ga0265320_100076043 71
430 3300031240 Ga0265320_10103373 Ga0265320_101033731 71
431 3300031240 Ga0265320_10454493 Ga0265320_104544932 71
432 3300031241 Ga0265325_10081012 Ga0265325_100810121 71
433 3300031242 Ga0265329_10009872 Ga0265329_100098725 71
434 3300031247 Ga0265340_10010097 Ga0265340_100100975 71
435 3300031249 Ga0265339_10009617 Ga0265339_100096179 71
436 3300031250 Ga0265331_10007742 Ga0265331_1000774213 71
437 3300031250 Ga0265331_10140034 Ga0265331_101400341 71
438 3300031250 Ga0265331_10165330 Ga0265331_101653302 71
439 3300031251 Ga0265327_10000025 Ga0265327_10000025378 71
440 3300031251 Ga0265327_10001026 Ga0265327_1000102636 71
441 3300031251 Ga0265327_10067188 Ga0265327_100671882 71
442 3300031251 Ga0265327_10108050 Ga0265327_101080502 71
443 3300031251 Ga0265327_10180627 Ga0265327_101806272 71
444 3300031344 Ga0265316_10049173 Ga0265316_100491732 71
445 3300031344 Ga0265316_10074657 Ga0265316_100746572 71
446 3300031344 Ga0265316_10963792 Ga0265316_109637922 71
447 3300031595 Ga0265313_10010889 Ga0265313_1001088912 71
448 3300031595 Ga0265313_10045444 Ga0265313_100454441 71
449 3300031711 Ga0265314_10305639 Ga0265314_103056392 71
450 3300031711 Ga0265314_10351202 Ga0265314_103512022 71
451 3300031712 Ga0265342_10556200 Ga0265342_105562002 71
452 3300032005 Ga0307411_12097110 Ga0307411_120971102 71
453 3300035092 Ga0373952_0104384 Ga0373952_0104384_222_437 71
454 3300037312 Ga0395899_0030864 Ga0395899_0030864_1917_2132 71
455 3300037312 Ga0395899_0034514 Ga0395899_0034514_234_449 71
456 3300037312 Ga0395899_0269309 Ga0395899_0269309_726_941 71
457 3300037312 Ga0395899_0637406 Ga0395899_0637406_80_295 71
458 3300037418 Ga0395900_0002337 Ga0395900_0002337_16538_16753 71
459 3300037418 Ga0395900_0003752 Ga0395900_0003752_15661_15876 71
460 3300037418 Ga0395900_0004799 Ga0395900_0004799_10781_10996 71
461 3300037418 Ga0395900_0132848 Ga0395900_0132848_1668_1883 71
462 3300037418 Ga0395900_0222137 Ga0395900_0222137_1425_1640 71
463 3300037418 Ga0395900_0645857 Ga0395900_0645857_109_324 71
464 3300037418 Ga0395900_0927357 Ga0395900_0927357_27_242 71
465 3300037466 Ga0395898_0003233 Ga0395898_0003233_10482_10697 71
466 3300037466 Ga0395898_0020497 Ga0395898_0020497_3959_4174 71
467 3300037466 Ga0395898_0127662 Ga0395898_0127662_2176_2391 71
468 3300037466 Ga0395898_0303385 Ga0395898_0303385_967_1182 71
469 3300037466 Ga0395898_0543814 Ga0395898_0543814_226_441 71
470 3300037471 Ga0395905_0004073 Ga0395905_0004073_2954_3169 71
471 3300037471 Ga0395905_0063653 Ga0395905_0063653_2680_2895 71
472 3300037471 Ga0395905_0077344 Ga0395905_0077344_566_781 71
473 3300037471 Ga0395905_0388491 Ga0395905_0388491_883_1098 71
474 3300037471 Ga0395905_0487073 Ga0395905_0487073_132_347 71
475 3300037471 Ga0395905_1009875 Ga0395905_1009875_140_355 71
476 3300038443 Ga0395901_0037932 Ga0395901_0037932_3543_3758 71
477 3300038443 Ga0395901_0061745 Ga0395901_0061745_537_752 71
478 3300038443 Ga0395901_0343868 Ga0395901_0343868_819_1034 71
479 3300038443 Ga0395901_0551324 Ga0395901_0551324_17_232 71
480 3300038443 Ga0395901_0552170 Ga0395901_0552170_37_252 71
481 3300046538 Ga0495609_0073467 Ga0495609_0073467_309_539 71
482 3300046692 Ga0495671_0136834 Ga0495671_0136834_771_995 71
483 3300047320 Ga0495672_0139251 Ga0495672_0139251_745_975 71
484 3300047320 Ga0495672_0367527 Ga0495672_0367527_384_605 71
485 3300048089 Ga0495614_0214111 Ga0495614_0214111_77_292 71
486 3300048908 Ga0496105_0090024 Ga0496105_0090024_1478_1696 71
487 3300048929 Ga0496126_0197099 Ga0496126_0197099_703_918 71
488 3300049459 Ga0495678_174733 Ga0495678_174733_186_410 71
489 3300049568 Ga0501031_0000319 Ga0501031_0000319_14059_14283 71
490 3300049569 Ga0501032_0005885 Ga0501032_0005885_5049_5273 71
491 3300049569 Ga0501032_0122799 Ga0501032_0122799_57_272 71
492 3300049570 Ga0501033_0025669 Ga0501033_0025669_3289_3504 71
493 3300049571 Ga0501034_0001225 Ga0501034_0001225_10709_10924 71
494 3300049572 Ga0501036_0030723 Ga0501036_0030723_1744_1968 71
495 3300049572 Ga0501036_0037028 Ga0501036_0037028_1634_1849 71
496 3300049573 Ga0501037_0000031 Ga0501037_0000031_85480_85704 71
497 3300049573 Ga0501037_0043928 Ga0501037_0043928_555_770 71
498 3300049573 Ga0501037_0185494 Ga0501037_0185494_1166_1381 71
499 3300049574 Ga0501038_0037593 Ga0501038_0037593_3787_4011 71
500 3300049574 Ga0501038_0157081 Ga0501038_0157081_441_656 71
501 3300049575 Ga0501039_0257404 Ga0501039_0257404_845_1069 71
502 3300049578 Ga0501042_0107412 Ga0501042_0107412_1532_1756 71
503 3300049579 Ga0501043_0000366 Ga0501043_0000366_40245_40469 71
504 3300049579 Ga0501043_0199336 Ga0501043_0199336_568_783 71
505 3300049580 Ga0501046_0000819 Ga0501046_0000819_4284_4508 71
506 3300049581 Ga0501047_0000032 Ga0501047_0000032_64719_64943 71
507 3300049581 Ga0501047_0000057 Ga0501047_0000057_14722_14937 71
508 3300049582 Ga0501048_0000013 Ga0501048_0000013_72306_72530 71
509 3300049582 Ga0501048_0016686 Ga0501048_0016686_2658_2873 71
510 3300049585 Ga0501069_0061787 Ga0501069_0061787_307_531 71
511 3300049586 Ga0501070_0015061 Ga0501070_0015061_5774_5998 71
512 3300049707 Ga0501234_000812 Ga0501234_000812_4195_4410 71
513 3300049744 Ga0501083_0022968 Ga0501083_0022968_1461_1685 71
514 3300049744 Ga0501083_0033657 Ga0501083_0033657_359_574 71
515 3300049744 Ga0501083_0075289 Ga0501083_0075289_1702_1917 71
516 3300049822 Ga0501035_0000005 Ga0501035_0000005_371165_371380 71
517 3300049822 Ga0501035_0011740 Ga0501035_0011740_2345_2569 71
518 3300049823 Ga0501044_0049040 Ga0501044_0049040_2100_2324 71
519 3300049823 Ga0501044_0110088 Ga0501044_0110088_529_744 71
520 3300049824 Ga0501045_0538966 Ga0501045_0538966_205_429 71
521 3300050489 nmdc:mga03683_49_c1 nmdc:mga03683_49_c1_6057_6272 71
522 3300050490 nmdc:mga03n38_312183_c1 nmdc:mga03n38_312183_c1_406_627 71
523 3300050490 nmdc:mga03n38_78_c1 nmdc:mga03n38_78_c1_19010_19225 71
524 3300050491 nmdc:mga00v17_483531_c1 nmdc:mga00v17_483531_c1_128_343 71
525 3300050491 nmdc:mga00v17_65661_c1 nmdc:mga00v17_65661_c1_570_785 71
526 3300050493 nmdc:mga0k408_183_c2 nmdc:mga0k408_183_c2_9596_9814 71
527 3300050493 nmdc:mga0k408_2341_c1 nmdc:mga0k408_2341_c1_9178_9393 71
528 3300050494 nmdc:mga06z11_15_c1 nmdc:mga06z11_15_c1_58884_59099 71
529 3300050494 nmdc:mga06z11_161732_c1 nmdc:mga06z11_161732_c1_46_270 71
530 3300050495 nmdc:mga04h51_1_c1 nmdc:mga04h51_1_c1_207346_207561 71
531 3300050496 nmdc:mga07m45_126191_c1 nmdc:mga07m45_126191_c1_506_721 71
532 3300050496 nmdc:mga07m45_256655_c1 nmdc:mga07m45_256655_c1_728_952 71
533 3300050496 nmdc:mga07m45_553691_c1 nmdc:mga07m45_553691_c1_134_349 71
534 3300050511 nmdc:mga08y16_388_c1 nmdc:mga08y16_388_c1_18964_19179 71
535 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_28044_28268 71
536 3300053079 Ga0500610_0000006 Ga0500610_0000006_25856_26083 71
537 3300053079 Ga0500610_0005196 Ga0500610_0005196_4025_4249 71
538 3300053087 Ga0500643_008683 Ga0500643_008683_3000_3227 71
539 3300053088 Ga0500644_0000646 Ga0500644_0000646_7464_7691 71
540 3300053088 Ga0500644_0052537 Ga0500644_0052537_244_474 71
541 3300053092 Ga0500583_0000219 Ga0500583_0000219_1407_1631 71
542 3300053093 Ga0500651_0113418 Ga0500651_0113418_669_893 71
543 3300053103 Ga0500555_000002 Ga0500555_000002_747670_747897 71
544 3300053104 Ga0500556_0002599 Ga0500556_0002599_2804_3019 71
545 3300053108 Ga0500562_006240 Ga0500562_006240_2640_2867 71
546 3300053117 Ga0500593_000001 Ga0500593_000001_712024_712239 71
547 3300053118 Ga0500594_0000082 Ga0500594_0000082_26245_26475 71
548 3300053129 Ga0500628_000042 Ga0500628_000042_44185_44415 71
549 3300053129 Ga0500628_012797 Ga0500628_012797_282_497 71
550 3300053130 Ga0500642_0005452 Ga0500642_0005452_1088_1312 71
551 3300053131 Ga0500652_000022 Ga0500652_000022_89288_89515 71
552 3300053147 Ga0500589_000028 Ga0500589_000028_2117_2341 71
553 3300053736 Ga0500599_027423 Ga0500599_027423_149_370 71

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03840

SecG

Preprotein translocase SecG subunit

6

73

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8szb-assembly1.cif.gz_A cryo-em structure of ninj2 filament at 3.07 angstrom resolution 0.8491 4 71
8sza-assembly1.cif.gz_B cryo-em structure of ninj1 filament at 2.75 angstrom resolution 0.8129 3 71
7pjs-assembly1.cif.gz_Y structure of the 70s ribosome with trnas in the classical pre-translocation state and apramycin (c) 0.7926 8 63
7uvx-assembly1.cif.gz_X a. baumannii 70s ribosome-streptothricin-f complex 0.754 8 62
7uvv-assembly1.cif.gz_X a. baumannii ribosome-streptothricin-f complex: 70s with p-site trna 0.7372 11 63
ID Description Score Start End Superfamily
af_A0A1D6JY39_152_277_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8501 4 65 1.20.5.110
1vf7M03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8464 2 65 1.10.287.470
1vf7E03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8431 2 65 1.10.287.470
1vf7C03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8406 2 65 1.10.287.470
1vf7B03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8404 2 65 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A2T0N6R3-F1-model_v4 Excreted virulence factor EspC (Type VII ESX diderm) 0.4398 4 63
AF-A0A858X862-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.4364 4 63 GO:0005886
GO:0015562
GO:1990281
AF-A0A424HCH2-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.4258 4 63 GO:0015562
GO:1990281
AF-A0A2V9YYA0-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.4238 4 71 GO:0015562
GO:0030313
GO:1990281
AF-A0A2V9YYA0-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.4014 4 71 GO:0015562
GO:0030313
GO:1990281

Feature Viewer

pLDDT pTM Quality
83.82 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map