F462809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 247 | 553 | 70 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10107612|rootH1_101076122 |
| Length | 76 |
| Sequence | MTHLSIYNYVTLISMLLMTILILVQTRGASLGAGLGGAGEINTERRGTDKTIYQLTIIMAVVFAGSLILGVVIPNK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090001 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 81 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 174 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 206 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 208 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 212 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 213 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 215 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 216 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 217 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 218 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 219 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 221 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 222 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 223 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 224 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 225 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 226 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 227 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 228 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 229 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 230 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 231 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 232 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 233 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 234 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 235 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 236 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 237 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 238 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 239 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 240 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 241 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 242 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 243 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 244 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 245 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 246 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 247 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.92 |
| Nodule | 0 |
| Rhizoplane | 1.81 |
| Rhizosphere | 83.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNB_F6ESG4R02F26E1 | 2088090001 | Bacteria | 532 |
| 2 | JGI24736J21556_1012325 | 3300001904 | Unclassified | 1384 |
| 3 | JGI24740J21852_10048734 | 3300001979 | Unclassified | 1229 |
| 4 | rootH1_10107612 | 3300003316 | Bacteria | 1366 |
| 5 | rootH1_10148481 | 3300003316 | Unclassified | 1739 |
| 6 | rootH2_10249488 | 3300003320 | Bacteria | 6149 |
| 7 | rootL2_10317277 | 3300003322 | Bacteria | 1198 |
| 8 | rootL2_10384956 | 3300003322 | Unclassified | 1471 |
| 9 | JGI25405J52794_10017988 | 3300003911 | Bacteria | 1408 |
| 10 | Ga0065704_10264973 | 3300005289 | Bacteria | 956 |
| 11 | Ga0070658_10000012 | 3300005327 | Bacteria | 277871 |
| 12 | Ga0070658_10000015 | 3300005327 | Bacteria | 230579 |
| 13 | Ga0070658_10270031 | 3300005327 | Bacteria | 1446 |
| 14 | Ga0070658_10393817 | 3300005327 | Unclassified | 1189 |
| 15 | Ga0070658_11521127 | 3300005327 | Bacteria | 580 |
| 16 | Ga0070676_10033662 | 3300005328 | Bacteria | 2940 |
| 17 | Ga0070683_100000444 | 3300005329 | Bacteria | 28787 |
| 18 | Ga0070683_100301894 | 3300005329 | Bacteria | 1523 |
| 19 | Ga0070683_101014207 | 3300005329 | Bacteria | 797 |
| 20 | Ga0070690_100001909 | 3300005330 | Bacteria | 11070 |
| 21 | Ga0070670_100038066 | 3300005331 | Bacteria | 4136 |
| 22 | Ga0070670_100936792 | 3300005331 | Bacteria | 786 |
| 23 | Ga0070670_101507263 | 3300005331 | Unclassified | 617 |
| 24 | Ga0068869_101043054 | 3300005334 | Bacteria | 713 |
| 25 | Ga0068869_101086492 | 3300005334 | Unclassified | 699 |
| 26 | Ga0070666_10069396 | 3300005335 | Bacteria | 2396 |
| 27 | Ga0070666_10950615 | 3300005335 | Unclassified | 636 |
| 28 | Ga0070666_11336704 | 3300005335 | Unclassified | 535 |
| 29 | Ga0070680_100017205 | 3300005336 | Bacteria | 5697 |
| 30 | Ga0070680_100458794 | 3300005336 | Unclassified | 1088 |
| 31 | Ga0070682_100000762 | 3300005337 | Bacteria | 19113 |
| 32 | Ga0068868_101889479 | 3300005338 | Unclassified | 565 |
| 33 | Ga0068868_101910028 | 3300005338 | Unclassified | 562 |
| 34 | Ga0070660_100000249 | 3300005339 | Bacteria | 35440 |
| 35 | Ga0070660_100000880 | 3300005339 | Bacteria | 20072 |
| 36 | Ga0070660_101376390 | 3300005339 | Bacteria | 599 |
| 37 | Ga0070689_101246870 | 3300005340 | Unclassified | 668 |
| 38 | Ga0070691_10277022 | 3300005341 | Unclassified | 909 |
| 39 | Ga0070687_100063289 | 3300005343 | Bacteria | 1961 |
| 40 | Ga0070661_101374659 | 3300005344 | Bacteria | 593 |
| 41 | Ga0070661_101663279 | 3300005344 | Bacteria | 540 |
| 42 | Ga0070668_100203913 | 3300005347 | Unclassified | 1624 |
| 43 | Ga0070668_100380397 | 3300005347 | Unclassified | 1201 |
| 44 | Ga0070669_100837190 | 3300005353 | Unclassified | 783 |
| 45 | Ga0070669_101383326 | 3300005353 | Bacteria | 610 |
| 46 | Ga0070675_100907712 | 3300005354 | Unclassified | 807 |
| 47 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 48 | Ga0070671_100361018 | 3300005355 | Bacteria | 1240 |
| 49 | Ga0070671_101586016 | 3300005355 | Bacteria | 580 |
| 50 | Ga0070674_100012866 | 3300005356 | Bacteria | 5152 |
| 51 | Ga0070673_100000192 | 3300005364 | Bacteria | 30116 |
| 52 | Ga0070688_101167883 | 3300005365 | Unclassified | 617 |
| 53 | Ga0070659_100001735 | 3300005366 | Bacteria | 15663 |
| 54 | Ga0070659_100271080 | 3300005366 | Bacteria | 1410 |
| 55 | Ga0070659_100454414 | 3300005366 | Bacteria | 1087 |
| 56 | Ga0070659_100645333 | 3300005366 | Bacteria | 912 |
| 57 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 58 | Ga0070667_100028262 | 3300005367 | Bacteria | 4668 |
| 59 | Ga0070667_100073489 | 3300005367 | Bacteria | 2915 |
| 60 | Ga0070714_100103038 | 3300005435 | Bacteria | 2517 |
| 61 | Ga0070663_100286648 | 3300005455 | Bacteria | 1314 |
| 62 | Ga0070678_100000895 | 3300005456 | Bacteria | 15332 |
| 63 | Ga0070678_100015910 | 3300005456 | Unclassified | 4794 |
| 64 | Ga0070681_10124354 | 3300005458 | Bacteria | 2512 |
| 65 | Ga0070681_10435031 | 3300005458 | Unclassified | 1224 |
| 66 | Ga0070681_10796107 | 3300005458 | Unclassified | 862 |
| 67 | Ga0070681_10921580 | 3300005458 | Bacteria | 792 |
| 68 | Ga0070685_10000179 | 3300005466 | Bacteria | 42215 |
| 69 | Ga0070685_10002933 | 3300005466 | Bacteria | 8718 |
| 70 | Ga0070679_100000459 | 3300005530 | Bacteria | 34603 |
| 71 | Ga0070679_100004837 | 3300005530 | Bacteria | 12426 |
| 72 | Ga0070679_100005663 | 3300005530 | Bacteria | 11579 |
| 73 | Ga0070679_100038416 | 3300005530 | Bacteria | 4760 |
| 74 | Ga0070679_100067526 | 3300005530 | Bacteria | 3566 |
| 75 | Ga0070679_100088365 | 3300005530 | Bacteria | 3086 |
| 76 | Ga0070679_100126308 | 3300005530 | Bacteria | 2540 |
| 77 | Ga0070679_100428429 | 3300005530 | Unclassified | 1268 |
| 78 | Ga0070679_100544426 | 3300005530 | Unclassified | 1104 |
| 79 | Ga0070679_101954574 | 3300005530 | Unclassified | 535 |
| 80 | Ga0070684_100000546 | 3300005535 | Bacteria | 25878 |
| 81 | Ga0070684_100342636 | 3300005535 | Bacteria | 1374 |
| 82 | Ga0070684_100805093 | 3300005535 | Bacteria | 878 |
| 83 | Ga0068853_100352086 | 3300005539 | Bacteria | 1370 |
| 84 | Ga0068853_101475627 | 3300005539 | Unclassified | 658 |
| 85 | Ga0070672_100008381 | 3300005543 | Bacteria | 7066 |
| 86 | Ga0070686_100038466 | 3300005544 | Unclassified | 2974 |
| 87 | Ga0070686_100577054 | 3300005544 | Unclassified | 883 |
| 88 | Ga0070695_101132497 | 3300005545 | Unclassified | 641 |
| 89 | Ga0070665_100315115 | 3300005548 | Bacteria | 1568 |
| 90 | Ga0070665_100630106 | 3300005548 | Bacteria | 1085 |
| 91 | Ga0068855_100000001 | 3300005563 | Bacteria | 818777 |
| 92 | Ga0068855_100000136 | 3300005563 | Bacteria | 93608 |
| 93 | Ga0068855_100001829 | 3300005563 | Bacteria | 26537 |
| 94 | Ga0068855_100054461 | 3300005563 | Bacteria | 4701 |
| 95 | Ga0068855_100097167 | 3300005563 | Unclassified | 3393 |
| 96 | Ga0068855_100222625 | 3300005563 | Bacteria | 2115 |
| 97 | Ga0068855_100637409 | 3300005563 | Bacteria | 1146 |
| 98 | Ga0068855_100683989 | 3300005563 | Bacteria | 1099 |
| 99 | Ga0068855_100709060 | 3300005563 | Bacteria | 1076 |
| 100 | Ga0068855_100737561 | 3300005563 | Bacteria | 1051 |
| 101 | Ga0068855_101034466 | 3300005563 | Unclassified | 861 |
| 102 | Ga0068855_101202126 | 3300005563 | Bacteria | 788 |
| 103 | Ga0068855_101443898 | 3300005563 | Unclassified | 708 |
| 104 | Ga0068855_101500214 | 3300005563 | Bacteria | 692 |
| 105 | Ga0068857_100000002 | 3300005577 | Bacteria | 241401 |
| 106 | Ga0068857_100018186 | 3300005577 | Bacteria | 6165 |
| 107 | Ga0068857_100021950 | 3300005577 | Bacteria | 5618 |
| 108 | Ga0068857_100097385 | 3300005577 | Bacteria | 2637 |
| 109 | Ga0068857_100154521 | 3300005577 | Unclassified | 2080 |
| 110 | Ga0068856_100000445 | 3300005614 | Bacteria | 45664 |
| 111 | Ga0068856_100005058 | 3300005614 | Bacteria | 13053 |
| 112 | Ga0068852_100759088 | 3300005616 | Unclassified | 982 |
| 113 | Ga0068859_100379353 | 3300005617 | Bacteria | 1509 |
| 114 | Ga0068859_100635644 | 3300005617 | Unclassified | 1160 |
| 115 | Ga0068851_10819207 | 3300005834 | Unclassified | 579 |
| 116 | Ga0068863_100014451 | 3300005841 | Bacteria | 7605 |
| 117 | Ga0068863_101008476 | 3300005841 | Unclassified | 835 |
| 118 | Ga0068863_101370844 | 3300005841 | Unclassified | 715 |
| 119 | Ga0068858_100527299 | 3300005842 | Bacteria | 1142 |
| 120 | Ga0068860_100001264 | 3300005843 | Bacteria | 27609 |
| 121 | Ga0068860_100032886 | 3300005843 | Bacteria | 4981 |
| 122 | Ga0068862_100024657 | 3300005844 | Bacteria | 5048 |
| 123 | Ga0081455_10000008 | 3300005937 | Bacteria | 256558 |
| 124 | Ga0081539_10007087 | 3300005985 | Bacteria | 10366 |
| 125 | Ga0081539_10051652 | 3300005985 | Unclassified | 2314 |
| 126 | Ga0070717_10036201 | 3300006028 | Bacteria | 4001 |
| 127 | Ga0075365_10003756 | 3300006038 | Bacteria | 7899 |
| 128 | Ga0075368_10000061 | 3300006042 | Bacteria | 26210 |
| 129 | Ga0075363_100000048 | 3300006048 | Bacteria | 23141 |
| 130 | Ga0075363_100335704 | 3300006048 | Unclassified | 881 |
| 131 | Ga0075364_10011031 | 3300006051 | Bacteria | 5482 |
| 132 | Ga0075364_10074457 | 3300006051 | Bacteria | 2239 |
| 133 | Ga0075364_10404295 | 3300006051 | Bacteria | 932 |
| 134 | Ga0075367_10012978 | 3300006178 | Bacteria | 4464 |
| 135 | Ga0075369_10000001 | 3300006186 | Bacteria | 299616 |
| 136 | Ga0075369_10080952 | 3300006186 | Bacteria | 1440 |
| 137 | Ga0075366_10000175 | 3300006195 | Bacteria | 27796 |
| 138 | Ga0075366_10000379 | 3300006195 | Bacteria | 20641 |
| 139 | Ga0075366_10620813 | 3300006195 | Bacteria | 670 |
| 140 | Ga0097621_100000275 | 3300006237 | Bacteria | 34774 |
| 141 | Ga0097621_100307575 | 3300006237 | Unclassified | 1401 |
| 142 | Ga0075370_10029555 | 3300006353 | Bacteria | 3053 |
| 143 | Ga0068871_100000038 | 3300006358 | Bacteria | 69723 |
| 144 | Ga0075428_101863206 | 3300006844 | Bacteria | 625 |
| 145 | Ga0097620_100379340 | 3300006931 | Bacteria | 1509 |
| 146 | Ga0097620_100635662 | 3300006931 | Unclassified | 1160 |
| 147 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 148 | Ga0105240_10009099 | 3300009093 | Bacteria | 14100 |
| 149 | Ga0105240_10638756 | 3300009093 | Unclassified | 1168 |
| 150 | Ga0105240_10975957 | 3300009093 | Bacteria | 907 |
| 151 | Ga0105240_12089183 | 3300009093 | Unclassified | 588 |
| 152 | Ga0111539_10001052 | 3300009094 | Bacteria | 36319 |
| 153 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 154 | Ga0105245_10000044 | 3300009098 | Bacteria | 135878 |
| 155 | Ga0105245_10000050 | 3300009098 | Bacteria | 128014 |
| 156 | Ga0105245_10016449 | 3300009098 | Bacteria | 6452 |
| 157 | Ga0105245_10333970 | 3300009098 | Bacteria | 1497 |
| 158 | Ga0105245_10738194 | 3300009098 | Unclassified | 1020 |
| 159 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 160 | Ga0105243_10006553 | 3300009148 | Bacteria | 8993 |
| 161 | Ga0105243_10635712 | 3300009148 | Bacteria | 1032 |
| 162 | Ga0105241_10000003 | 3300009174 | Bacteria | 839043 |
| 163 | Ga0105241_10002756 | 3300009174 | Bacteria | 13166 |
| 164 | Ga0105241_10011505 | 3300009174 | Bacteria | 6486 |
| 165 | Ga0105241_10497333 | 3300009174 | Bacteria | 1086 |
| 166 | Ga0105241_11516997 | 3300009174 | Unclassified | 645 |
| 167 | Ga0105241_12232976 | 3300009174 | Unclassified | 543 |
| 168 | Ga0105242_10000011 | 3300009176 | Bacteria | 149791 |
| 169 | Ga0105242_10222747 | 3300009176 | Bacteria | 1687 |
| 170 | Ga0105248_10106219 | 3300009177 | Bacteria | 3166 |
| 171 | Ga0105248_10189139 | 3300009177 | Unclassified | 2320 |
| 172 | Ga0105248_10463865 | 3300009177 | Bacteria | 1428 |
| 173 | Ga0105248_11887189 | 3300009177 | Bacteria | 678 |
| 174 | Ga0105248_12812264 | 3300009177 | Unclassified | 555 |
| 175 | Ga0105237_10005423 | 3300009545 | Bacteria | 14402 |
| 176 | Ga0105237_10089883 | 3300009545 | Bacteria | 3060 |
| 177 | Ga0105238_10000721 | 3300009551 | Bacteria | 34481 |
| 178 | Ga0105238_10874968 | 3300009551 | Unclassified | 916 |
| 179 | Ga0105238_11139472 | 3300009551 | Bacteria | 803 |
| 180 | Ga0105238_11618234 | 3300009551 | Unclassified | 678 |
| 181 | Ga0105238_11874358 | 3300009551 | Bacteria | 632 |
| 182 | Ga0105238_12023876 | 3300009551 | Bacteria | 610 |
| 183 | Ga0105238_12383693 | 3300009551 | Unclassified | 565 |
| 184 | Ga0105249_10002064 | 3300009553 | Bacteria | 17404 |
| 185 | Ga0105249_12886510 | 3300009553 | Bacteria | 552 |
| 186 | Ga0105033_100929 | 3300009986 | Bacteria | 2323 |
| 187 | Ga0105030_108759 | 3300009987 | Bacteria | 862 |
| 188 | Ga0105239_10091108 | 3300010375 | Unclassified | 3364 |
| 189 | Ga0105239_10093094 | 3300010375 | Bacteria | 3327 |
| 190 | Ga0105239_10347625 | 3300010375 | Bacteria | 1674 |
| 191 | Ga0105239_10380811 | 3300010375 | Bacteria | 1595 |
| 192 | Ga0105239_10596606 | 3300010375 | Bacteria | 1260 |
| 193 | Ga0157373_10000061 | 3300013100 | Bacteria | 95718 |
| 194 | Ga0157373_10607636 | 3300013100 | Bacteria | 796 |
| 195 | Ga0157371_10000105 | 3300013102 | Bacteria | 126728 |
| 196 | Ga0157370_10111292 | 3300013104 | Unclassified | 2560 |
| 197 | Ga0157370_10135866 | 3300013104 | Bacteria | 2292 |
| 198 | Ga0157370_10494931 | 3300013104 | Bacteria | 1123 |
| 199 | Ga0157369_10000505 | 3300013105 | Bacteria | 51370 |
| 200 | Ga0157369_10297635 | 3300013105 | Bacteria | 1679 |
| 201 | Ga0157369_10319152 | 3300013105 | Unclassified | 1615 |
| 202 | Ga0157374_10000058 | 3300013296 | Bacteria | 116810 |
| 203 | Ga0157374_10000115 | 3300013296 | Bacteria | 73739 |
| 204 | Ga0157374_10003275 | 3300013296 | Bacteria | 13603 |
| 205 | Ga0157374_10029826 | 3300013296 | Bacteria | 4947 |
| 206 | Ga0157374_10186481 | 3300013296 | Bacteria | 2028 |
| 207 | Ga0157374_10550511 | 3300013296 | Bacteria | 1161 |
| 208 | Ga0157374_10609145 | 3300013296 | Bacteria | 1102 |
| 209 | Ga0157374_10873081 | 3300013296 | Unclassified | 917 |
| 210 | Ga0157374_12072708 | 3300013296 | Bacteria | 595 |
| 211 | Ga0157378_10466535 | 3300013297 | Bacteria | 1256 |
| 212 | Ga0157378_10827488 | 3300013297 | Bacteria | 953 |
| 213 | Ga0157372_10000090 | 3300013307 | Bacteria | 93559 |
| 214 | Ga0157372_10143548 | 3300013307 | Bacteria | 2753 |
| 215 | Ga0157372_10317240 | 3300013307 | Unclassified | 1815 |
| 216 | Ga0157372_10877820 | 3300013307 | Bacteria | 1041 |
| 217 | Ga0157372_12570032 | 3300013307 | Unclassified | 584 |
| 218 | Ga0157372_12807035 | 3300013307 | Unclassified | 558 |
| 219 | Ga0163163_10004291 | 3300014325 | Bacteria | 12145 |
| 220 | Ga0163163_11195908 | 3300014325 | Bacteria | 823 |
| 221 | Ga0157380_13082708 | 3300014326 | Unclassified | 531 |
| 222 | Ga0157377_10432098 | 3300014745 | Bacteria | 905 |
| 223 | Ga0157377_10533947 | 3300014745 | Bacteria | 826 |
| 224 | Ga0157379_11835854 | 3300014968 | Bacteria | 596 |
| 225 | Ga0157376_10000007 | 3300014969 | Bacteria | 368004 |
| 226 | Ga0163161_10980290 | 3300017792 | Bacteria | 720 |
| 227 | Ga0207697_10356839 | 3300025315 | Unclassified | 649 |
| 228 | Ga0207680_11205655 | 3300025903 | Unclassified | 540 |
| 229 | Ga0207647_10001224 | 3300025904 | Bacteria | 19752 |
| 230 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 231 | Ga0207705_10000038 | 3300025909 | Bacteria | 193812 |
| 232 | Ga0207705_10006447 | 3300025909 | Bacteria | 8691 |
| 233 | Ga0207705_10024904 | 3300025909 | Bacteria | 4271 |
| 234 | Ga0207705_10315848 | 3300025909 | Unclassified | 1200 |
| 235 | Ga0207705_10573717 | 3300025909 | Bacteria | 877 |
| 236 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 237 | Ga0207654_10001391 | 3300025911 | Bacteria | 12817 |
| 238 | Ga0207654_10017729 | 3300025911 | Bacteria | 3727 |
| 239 | Ga0207654_10574849 | 3300025911 | Bacteria | 802 |
| 240 | Ga0207707_10100299 | 3300025912 | Bacteria | 2530 |
| 241 | Ga0207707_10691338 | 3300025912 | Unclassified | 857 |
| 242 | Ga0207707_11167553 | 3300025912 | Unclassified | 624 |
| 243 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 244 | Ga0207695_10010293 | 3300025913 | Bacteria | 11451 |
| 245 | Ga0207695_10234193 | 3300025913 | Bacteria | 1739 |
| 246 | Ga0207695_10277251 | 3300025913 | Bacteria | 1571 |
| 247 | Ga0207695_10601919 | 3300025913 | Unclassified | 980 |
| 248 | Ga0207671_10112276 | 3300025914 | Bacteria | 2075 |
| 249 | Ga0207671_10290268 | 3300025914 | Bacteria | 1291 |
| 250 | Ga0207671_11071430 | 3300025914 | Bacteria | 634 |
| 251 | Ga0207660_10038002 | 3300025917 | Bacteria | 3358 |
| 252 | Ga0207660_10913786 | 3300025917 | Unclassified | 716 |
| 253 | Ga0207662_10120627 | 3300025918 | Bacteria | 1644 |
| 254 | Ga0207657_10012859 | 3300025919 | Bacteria | 8233 |
| 255 | Ga0207657_10015575 | 3300025919 | Bacteria | 7360 |
| 256 | Ga0207657_10967695 | 3300025919 | Bacteria | 654 |
| 257 | Ga0207649_10304143 | 3300025920 | Bacteria | 1167 |
| 258 | Ga0207652_10003452 | 3300025921 | Bacteria | 13036 |
| 259 | Ga0207652_10005649 | 3300025921 | Bacteria | 10147 |
| 260 | Ga0207652_10095506 | 3300025921 | Bacteria | 2619 |
| 261 | Ga0207652_10318350 | 3300025921 | Bacteria | 1404 |
| 262 | Ga0207652_10363174 | 3300025921 | Bacteria | 1307 |
| 263 | Ga0207652_10445118 | 3300025921 | Bacteria | 1168 |
| 264 | Ga0207652_10944598 | 3300025921 | Unclassified | 760 |
| 265 | Ga0207652_11330181 | 3300025921 | Unclassified | 621 |
| 266 | Ga0207681_10778623 | 3300025923 | Unclassified | 798 |
| 267 | Ga0207694_10006064 | 3300025924 | Bacteria | 9246 |
| 268 | Ga0207694_11655053 | 3300025924 | Unclassified | 539 |
| 269 | Ga0207650_10155866 | 3300025925 | Unclassified | 1806 |
| 270 | Ga0207650_11764367 | 3300025925 | Unclassified | 524 |
| 271 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 272 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 273 | Ga0207687_10000033 | 3300025927 | Bacteria | 135886 |
| 274 | Ga0207687_10000375 | 3300025927 | Bacteria | 29944 |
| 275 | Ga0207687_10011398 | 3300025927 | Bacteria | 5811 |
| 276 | Ga0207687_10130511 | 3300025927 | Unclassified | 1893 |
| 277 | Ga0207687_11458830 | 3300025927 | Unclassified | 588 |
| 278 | Ga0207687_11583586 | 3300025927 | Unclassified | 562 |
| 279 | Ga0207664_10098662 | 3300025929 | Bacteria | 2409 |
| 280 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 281 | Ga0207644_10368928 | 3300025931 | Unclassified | 1169 |
| 282 | Ga0207690_10000469 | 3300025932 | Bacteria | 25898 |
| 283 | Ga0207690_10256272 | 3300025932 | Bacteria | 1354 |
| 284 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 285 | Ga0207686_10008752 | 3300025934 | Bacteria | 5468 |
| 286 | Ga0207686_10197664 | 3300025934 | Bacteria | 1438 |
| 287 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 288 | Ga0207709_10014221 | 3300025935 | Bacteria | 4391 |
| 289 | Ga0207709_10384050 | 3300025935 | Bacteria | 1069 |
| 290 | Ga0207670_10717089 | 3300025936 | Unclassified | 829 |
| 291 | Ga0207669_10009623 | 3300025937 | Bacteria | 4617 |
| 292 | Ga0207669_10012427 | 3300025937 | Bacteria | 4186 |
| 293 | Ga0207691_10077344 | 3300025940 | Bacteria | 2998 |
| 294 | Ga0207711_10173480 | 3300025941 | Unclassified | 1958 |
| 295 | Ga0207711_10578889 | 3300025941 | Bacteria | 1047 |
| 296 | Ga0207711_11015912 | 3300025941 | Bacteria | 769 |
| 297 | Ga0207711_11492936 | 3300025941 | Unclassified | 619 |
| 298 | Ga0207689_10102483 | 3300025942 | Bacteria | 2351 |
| 299 | Ga0207689_11285155 | 3300025942 | Bacteria | 615 |
| 300 | Ga0207661_10000544 | 3300025944 | Bacteria | 24114 |
| 301 | Ga0207661_10246665 | 3300025944 | Bacteria | 1586 |
| 302 | Ga0207661_11571406 | 3300025944 | Bacteria | 602 |
| 303 | Ga0207667_10000003 | 3300025949 | Bacteria | 822935 |
| 304 | Ga0207667_10000060 | 3300025949 | Bacteria | 192320 |
| 305 | Ga0207667_10034128 | 3300025949 | Bacteria | 5466 |
| 306 | Ga0207667_10055275 | 3300025949 | Bacteria | 4174 |
| 307 | Ga0207667_10141832 | 3300025949 | Bacteria | 2474 |
| 308 | Ga0207667_11171607 | 3300025949 | Bacteria | 749 |
| 309 | Ga0207667_11705237 | 3300025949 | Unclassified | 596 |
| 310 | Ga0207651_10000546 | 3300025960 | Bacteria | 15744 |
| 311 | Ga0207712_10001438 | 3300025961 | Bacteria | 16253 |
| 312 | Ga0207712_11350430 | 3300025961 | Unclassified | 637 |
| 313 | Ga0207668_11548649 | 3300025972 | Unclassified | 598 |
| 314 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 315 | Ga0207658_10009634 | 3300025986 | Bacteria | 6555 |
| 316 | Ga0207658_10027146 | 3300025986 | Bacteria | 4021 |
| 317 | Ga0207658_11527439 | 3300025986 | Bacteria | 611 |
| 318 | Ga0207639_10285943 | 3300026041 | Bacteria | 1452 |
| 319 | Ga0207639_11081114 | 3300026041 | Unclassified | 752 |
| 320 | Ga0207678_10392626 | 3300026067 | Bacteria | 1200 |
| 321 | Ga0207702_10001979 | 3300026078 | Bacteria | 19915 |
| 322 | Ga0207702_10013253 | 3300026078 | Bacteria | 6857 |
| 323 | Ga0207702_10381789 | 3300026078 | Bacteria | 1355 |
| 324 | Ga0207641_10107119 | 3300026088 | Unclassified | 2472 |
| 325 | Ga0207641_10650747 | 3300026088 | Bacteria | 1035 |
| 326 | Ga0207641_11060282 | 3300026088 | Unclassified | 808 |
| 327 | Ga0207674_10000001 | 3300026116 | Bacteria | 616581 |
| 328 | Ga0207674_10186785 | 3300026116 | Bacteria | 2023 |
| 329 | Ga0207674_10480426 | 3300026116 | Bacteria | 1201 |
| 330 | Ga0207674_11200976 | 3300026116 | Unclassified | 728 |
| 331 | Ga0207683_10002815 | 3300026121 | Bacteria | 15194 |
| 332 | Ga0207683_10010914 | 3300026121 | Bacteria | 7748 |
| 333 | Ga0207698_10690249 | 3300026142 | Unclassified | 1015 |
| 334 | Ga0209998_10068440 | 3300027717 | Unclassified | 846 |
| 335 | Ga0209813_10000001 | 3300027866 | Bacteria | 280406 |
| 336 | Ga0268266_10002852 | 3300028379 | Bacteria | 18007 |
| 337 | Ga0268266_10516898 | 3300028379 | Bacteria | 1141 |
| 338 | Ga0268265_10028375 | 3300028380 | Bacteria | 4006 |
| 339 | Ga0268264_10003540 | 3300028381 | Bacteria | 13444 |
| 340 | Ga0268264_10064411 | 3300028381 | Unclassified | 3085 |
| 341 | Ga0265337_1000558 | 3300028556 | Bacteria | 19595 |
| 342 | Ga0265337_1003836 | 3300028556 | Bacteria | 6387 |
| 343 | Ga0265337_1064185 | 3300028556 | Bacteria | 1014 |
| 344 | Ga0265326_10004953 | 3300028558 | Bacteria | 4219 |
| 345 | Ga0265326_10177104 | 3300028558 | Bacteria | 611 |
| 346 | Ga0265319_1001066 | 3300028563 | Bacteria | 17117 |
| 347 | Ga0265319_1003528 | 3300028563 | Bacteria | 8118 |
| 348 | Ga0265319_1064558 | 3300028563 | Bacteria | 1182 |
| 349 | Ga0265334_10001298 | 3300028573 | Bacteria | 12060 |
| 350 | Ga0265334_10008717 | 3300028573 | Bacteria | 4306 |
| 351 | Ga0265334_10019774 | 3300028573 | Bacteria | 2765 |
| 352 | Ga0265334_10099761 | 3300028573 | Unclassified | 1052 |
| 353 | Ga0265318_10008410 | 3300028577 | Unclassified | 4597 |
| 354 | Ga0265323_10003586 | 3300028653 | Bacteria | 6817 |
| 355 | Ga0265322_10001650 | 3300028654 | Bacteria | 7115 |
| 356 | Ga0265336_10002591 | 3300028666 | Bacteria | 7392 |
| 357 | Ga0265338_10000217 | 3300028800 | Bacteria | 106453 |
| 358 | Ga0265338_10000313 | 3300028800 | Bacteria | 87846 |
| 359 | Ga0265338_10002134 | 3300028800 | Bacteria | 30383 |
| 360 | Ga0265338_10002339 | 3300028800 | Bacteria | 28646 |
| 361 | Ga0265338_10002608 | 3300028800 | Bacteria | 26653 |
| 362 | Ga0265338_10005339 | 3300028800 | Bacteria | 16808 |
| 363 | Ga0265338_10008101 | 3300028800 | Bacteria | 12841 |
| 364 | Ga0265338_10015920 | 3300028800 | Bacteria | 8228 |
| 365 | Ga0265338_10060642 | 3300028800 | Archaea | 3322 |
| 366 | Ga0265338_10130767 | 3300028800 | Bacteria | 1982 |
| 367 | Ga0265338_10850919 | 3300028800 | Archaea | 623 |
| 368 | Ga0265324_10008047 | 3300029957 | Bacteria | 4224 |
| 369 | Ga0265324_10326779 | 3300029957 | Unclassified | 522 |
| 370 | Ga0265330_10008028 | 3300031235 | Bacteria | 5108 |
| 371 | Ga0265332_10072211 | 3300031238 | Unclassified | 1469 |
| 372 | Ga0265328_10002143 | 3300031239 | Bacteria | 8907 |
| 373 | Ga0265320_10007604 | 3300031240 | Bacteria | 6714 |
| 374 | Ga0265320_10103373 | 3300031240 | Unclassified | 1310 |
| 375 | Ga0265320_10454493 | 3300031240 | Unclassified | 565 |
| 376 | Ga0265325_10081012 | 3300031241 | Unclassified | 1613 |
| 377 | Ga0265329_10009872 | 3300031242 | Unclassified | 3534 |
| 378 | Ga0265340_10000915 | 3300031247 | Bacteria | 16743 |
| 379 | Ga0265340_10010097 | 3300031247 | Bacteria | 5057 |
| 380 | Ga0265339_10009617 | 3300031249 | Bacteria | 6055 |
| 381 | Ga0265331_10007742 | 3300031250 | Bacteria | 6172 |
| 382 | Ga0265331_10140034 | 3300031250 | Bacteria | 1101 |
| 383 | Ga0265331_10165330 | 3300031250 | Bacteria | 1002 |
| 384 | Ga0265327_10000025 | 3300031251 | Bacteria | 380054 |
| 385 | Ga0265327_10001026 | 3300031251 | Bacteria | 39389 |
| 386 | Ga0265327_10067188 | 3300031251 | Archaea | 1806 |
| 387 | Ga0265327_10108050 | 3300031251 | Bacteria | 1333 |
| 388 | Ga0265327_10180627 | 3300031251 | Unclassified | 965 |
| 389 | Ga0265316_10049173 | 3300031344 | Archaea | 3322 |
| 390 | Ga0265316_10074657 | 3300031344 | Bacteria | 2609 |
| 391 | Ga0265316_10963792 | 3300031344 | Unclassified | 594 |
| 392 | Ga0265313_10010889 | 3300031595 | Bacteria | 5704 |
| 393 | Ga0265313_10045444 | 3300031595 | Unclassified | 2138 |
| 394 | Ga0265314_10305639 | 3300031711 | Archaea | 890 |
| 395 | Ga0265314_10351202 | 3300031711 | Unclassified | 811 |
| 396 | Ga0265314_10486169 | 3300031711 | Bacteria | 652 |
| 397 | Ga0265342_10556200 | 3300031712 | Unclassified | 581 |
| 398 | Ga0307411_12097110 | 3300032005 | Unclassified | 529 |
| 399 | Ga0373952_0104384 | 3300035092 | Bacteria | 751 |
| 400 | Ga0395899_0030864 | 3300037312 | Unclassified | 4028 |
| 401 | Ga0395899_0034514 | 3300037312 | Bacteria | 3800 |
| 402 | Ga0395899_0269309 | 3300037312 | Bacteria | 1162 |
| 403 | Ga0395899_0637406 | 3300037312 | Unclassified | 675 |
| 404 | Ga0395900_0002337 | 3300037418 | Bacteria | 20997 |
| 405 | Ga0395900_0003752 | 3300037418 | Bacteria | 16320 |
| 406 | Ga0395900_0004799 | 3300037418 | Bacteria | 14243 |
| 407 | Ga0395900_0132848 | 3300037418 | Bacteria | 2550 |
| 408 | Ga0395900_0222137 | 3300037418 | Bacteria | 1903 |
| 409 | Ga0395900_0454742 | 3300037418 | Unclassified | 1236 |
| 410 | Ga0395900_0645857 | 3300037418 | Unclassified | 995 |
| 411 | Ga0395900_0927357 | 3300037418 | Bacteria | 793 |
| 412 | Ga0395900_1333229 | 3300037418 | Bacteria | 631 |
| 413 | Ga0395898_0003233 | 3300037466 | Bacteria | 18304 |
| 414 | Ga0395898_0020497 | 3300037466 | Bacteria | 6715 |
| 415 | Ga0395898_0127662 | 3300037466 | Bacteria | 2436 |
| 416 | Ga0395898_0303385 | 3300037466 | Bacteria | 1523 |
| 417 | Ga0395898_0543814 | 3300037466 | Bacteria | 1103 |
| 418 | Ga0395898_0737286 | 3300037466 | Bacteria | 927 |
| 419 | Ga0395905_0002235 | 3300037471 | Bacteria | 21825 |
| 420 | Ga0395905_0004073 | 3300037471 | Bacteria | 15320 |
| 421 | Ga0395905_0063653 | 3300037471 | Bacteria | 3451 |
| 422 | Ga0395905_0077344 | 3300037471 | Bacteria | 3118 |
| 423 | Ga0395905_0388491 | 3300037471 | Unclassified | 1290 |
| 424 | Ga0395905_0487073 | 3300037471 | Bacteria | 1133 |
| 425 | Ga0395905_1009875 | 3300037471 | Unclassified | 735 |
| 426 | Ga0395901_0012638 | 3300038443 | Bacteria | 8567 |
| 427 | Ga0395901_0037796 | 3300038443 | Bacteria | 4993 |
| 428 | Ga0395901_0037932 | 3300038443 | Bacteria | 4983 |
| 429 | Ga0395901_0061745 | 3300038443 | Bacteria | 3899 |
| 430 | Ga0395901_0343868 | 3300038443 | Bacteria | 1541 |
| 431 | Ga0395901_0551324 | 3300038443 | Unclassified | 1168 |
| 432 | Ga0395901_0552170 | 3300038443 | Bacteria | 1167 |
| 433 | Ga0451798_0547688 | 3300041458 | Unclassified | 566 |
| 434 | Ga0451804_0662213 | 3300041463 | Bacteria | 959 |
| 435 | Ga0451577_1007404 | 3300042876 | Bacteria | 748 |
| 436 | Ga0466967_0203229 | 3300045976 | Bacteria | 1877 |
| 437 | Ga0466967_0341628 | 3300045976 | Unclassified | 1448 |
| 438 | Ga0495609_0073467 | 3300046538 | Bacteria | 1500 |
| 439 | Ga0495588_0000236 | 3300046674 | Bacteria | 48183 |
| 440 | Ga0495671_0136834 | 3300046692 | Bacteria | 1194 |
| 441 | Ga0495672_0000010 | 3300047320 | Bacteria | 545038 |
| 442 | Ga0495672_0139251 | 3300047320 | Bacteria | 1269 |
| 443 | Ga0495672_0367527 | 3300047320 | Unclassified | 664 |
| 444 | Ga0495614_0214111 | 3300048089 | Unclassified | 874 |
| 445 | Ga0496101_0382223 | 3300048904 | Bacteria | 1108 |
| 446 | Ga0496104_1034241 | 3300048907 | Bacteria | 725 |
| 447 | Ga0496104_1047866 | 3300048907 | Bacteria | 719 |
| 448 | Ga0496105_0090024 | 3300048908 | Bacteria | 2535 |
| 449 | Ga0496105_0465784 | 3300048908 | Unclassified | 996 |
| 450 | Ga0496108_1239074 | 3300048911 | Bacteria | 629 |
| 451 | Ga0496109_0076587 | 3300048912 | Unclassified | 3077 |
| 452 | Ga0496112_0179603 | 3300048915 | Unclassified | 2080 |
| 453 | Ga0496126_0197099 | 3300048929 | Unclassified | 1703 |
| 454 | Ga0495678_174733 | 3300049459 | Bacteria | 677 |
| 455 | Ga0501031_0000319 | 3300049568 | Bacteria | 27520 |
| 456 | Ga0501032_0005885 | 3300049569 | Bacteria | 9068 |
| 457 | Ga0501032_0122799 | 3300049569 | Bacteria | 1716 |
| 458 | Ga0501033_0025669 | 3300049570 | Unclassified | 4439 |
| 459 | Ga0501034_0001225 | 3300049571 | Bacteria | 35077 |
| 460 | Ga0501036_0030723 | 3300049572 | Bacteria | 4537 |
| 461 | Ga0501036_0037028 | 3300049572 | Unclassified | 4127 |
| 462 | Ga0501037_0000031 | 3300049573 | Bacteria | 133137 |
| 463 | Ga0501037_0043928 | 3300049573 | Unclassified | 3284 |
| 464 | Ga0501037_0185494 | 3300049573 | Unclassified | 1474 |
| 465 | Ga0501038_0037593 | 3300049574 | Bacteria | 4244 |
| 466 | Ga0501038_0157081 | 3300049574 | Bacteria | 1851 |
| 467 | Ga0501039_0257404 | 3300049575 | Bacteria | 1372 |
| 468 | Ga0501042_0107412 | 3300049578 | Bacteria | 2009 |
| 469 | Ga0501043_0000366 | 3300049579 | Bacteria | 40919 |
| 470 | Ga0501043_0199336 | 3300049579 | Bacteria | 1554 |
| 471 | Ga0501046_0000819 | 3300049580 | Bacteria | 30340 |
| 472 | Ga0501047_0000032 | 3300049581 | Bacteria | 208294 |
| 473 | Ga0501047_0000057 | 3300049581 | Bacteria | 140059 |
| 474 | Ga0501048_0000013 | 3300049582 | Bacteria | 76554 |
| 475 | Ga0501048_0016686 | 3300049582 | Bacteria | 5414 |
| 476 | Ga0501069_0061787 | 3300049585 | Bacteria | 2092 |
| 477 | Ga0501070_0015061 | 3300049586 | Bacteria | 6508 |
| 478 | Ga0501070_0188060 | 3300049586 | Bacteria | 1698 |
| 479 | Ga0501070_0233774 | 3300049586 | Bacteria | 1506 |
| 480 | Ga0501073_0750538 | 3300049589 | Bacteria | 673 |
| 481 | Ga0501234_000812 | 3300049707 | Bacteria | 4900 |
| 482 | Ga0501083_0022968 | 3300049744 | Bacteria | 4329 |
| 483 | Ga0501083_0033657 | 3300049744 | Bacteria | 3508 |
| 484 | Ga0501083_0075289 | 3300049744 | Bacteria | 2242 |
| 485 | Ga0501276_028753 | 3300049773 | Bacteria | 571 |
| 486 | Ga0501035_0000005 | 3300049822 | Bacteria | 392980 |
| 487 | Ga0501035_0011740 | 3300049822 | Bacteria | 8113 |
| 488 | Ga0501044_0049040 | 3300049823 | Bacteria | 4358 |
| 489 | Ga0501044_0110088 | 3300049823 | Bacteria | 2763 |
| 490 | Ga0501045_0538966 | 3300049824 | Unclassified | 866 |
| 491 | nmdc:mga03683_49_c1 | 3300050489 | Bacteria | 11796 |
| 492 | nmdc:mga03n38_312183_c1 | 3300050490 | Unclassified | 847 |
| 493 | nmdc:mga03n38_78_c1 | 3300050490 | Bacteria | 20635 |
| 494 | nmdc:mga00v17_43362_c1 | 3300050491 | Bacteria | 2709 |
| 495 | nmdc:mga00v17_483531_c1 | 3300050491 | Unclassified | 803 |
| 496 | nmdc:mga00v17_65661_c1 | 3300050491 | Bacteria | 2239 |
| 497 | nmdc:mga0yw44_1143_c2 | 3300050492 | Bacteria | 8343 |
| 498 | nmdc:mga0yw44_162346_c1 | 3300050492 | Bacteria | 1463 |
| 499 | nmdc:mga0k408_183_c2 | 3300050493 | Bacteria | 27809 |
| 500 | nmdc:mga0k408_2341_c1 | 3300050493 | Bacteria | 10083 |
| 501 | nmdc:mga06z11_15_c1 | 3300050494 | Bacteria | 82672 |
| 502 | nmdc:mga06z11_161732_c1 | 3300050494 | Unclassified | 1280 |
| 503 | nmdc:mga04h51_1_c1 | 3300050495 | Bacteria | 273320 |
| 504 | nmdc:mga07m45_126191_c1 | 3300050496 | Bacteria | 1480 |
| 505 | nmdc:mga07m45_256655_c1 | 3300050496 | Unclassified | 1017 |
| 506 | nmdc:mga07m45_553691_c1 | 3300050496 | Unclassified | 665 |
| 507 | nmdc:mga08y16_388_c1 | 3300050511 | Bacteria | 40225 |
| 508 | nmdc:mga0sz30_1_c1 | 3300050516 | Bacteria | 796501 |
| 509 | nmdc:mga0sz30_72053_c1 | 3300050516 | Bacteria | 1488 |
| 510 | Ga0500610_0000006 | 3300053079 | Bacteria | 134304 |
| 511 | Ga0500610_0005196 | 3300053079 | Bacteria | 5301 |
| 512 | Ga0500610_0299925 | 3300053079 | Bacteria | 709 |
| 513 | Ga0500643_000043 | 3300053087 | Bacteria | 157905 |
| 514 | Ga0500643_000148 | 3300053087 | Bacteria | 71560 |
| 515 | Ga0500643_008683 | 3300053087 | Bacteria | 3968 |
| 516 | Ga0500644_0000646 | 3300053088 | Bacteria | 12916 |
| 517 | Ga0500644_0020807 | 3300053088 | Bacteria | 1956 |
| 518 | Ga0500644_0052537 | 3300053088 | Bacteria | 1403 |
| 519 | Ga0500644_0282078 | 3300053088 | Unclassified | 707 |
| 520 | Ga0500646_0025526 | 3300053090 | Bacteria | 1596 |
| 521 | Ga0500647_0300729 | 3300053091 | Unclassified | 686 |
| 522 | Ga0500583_0000219 | 3300053092 | Bacteria | 21312 |
| 523 | Ga0500583_0001709 | 3300053092 | Bacteria | 6417 |
| 524 | Ga0500583_0002071 | 3300053092 | Bacteria | 5939 |
| 525 | Ga0500651_0000050 | 3300053093 | Bacteria | 78674 |
| 526 | Ga0500651_0003130 | 3300053093 | Bacteria | 8969 |
| 527 | Ga0500651_0113418 | 3300053093 | Bacteria | 1652 |
| 528 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 529 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 530 | Ga0500556_0002599 | 3300053104 | Bacteria | 5688 |
| 531 | Ga0500562_006240 | 3300053108 | Bacteria | 3007 |
| 532 | Ga0500562_009059 | 3300053108 | Bacteria | 2516 |
| 533 | Ga0500593_000001 | 3300053117 | Bacteria | 784404 |
| 534 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 535 | Ga0500594_0000082 | 3300053118 | Bacteria | 28953 |
| 536 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 537 | Ga0500614_002701 | 3300053123 | Bacteria | 3924 |
| 538 | Ga0500628_000042 | 3300053129 | Bacteria | 46597 |
| 539 | Ga0500628_012797 | 3300053129 | Bacteria | 1552 |
| 540 | Ga0500642_0005452 | 3300053130 | Bacteria | 4103 |
| 541 | Ga0500652_000022 | 3300053131 | Bacteria | 118313 |
| 542 | Ga0500655_002749 | 3300053133 | Bacteria | 3188 |
| 543 | Ga0500568_0007346 | 3300053139 | Bacteria | 5416 |
| 544 | Ga0500568_0040568 | 3300053139 | Unclassified | 1873 |
| 545 | Ga0500577_0000521 | 3300053142 | Bacteria | 9975 |
| 546 | Ga0500579_000688 | 3300053143 | Bacteria | 19490 |
| 547 | Ga0500589_000028 | 3300053147 | Bacteria | 63762 |
| 548 | Ga0500589_053376 | 3300053147 | Bacteria | 1871 |
| 549 | Ga0500604_0117250 | 3300053151 | Bacteria | 888 |
| 550 | Ga0500633_0005267 | 3300053160 | Bacteria | 3054 |
| 551 | Ga0500649_000011 | 3300053722 | Bacteria | 87970 |
| 552 | Ga0500611_002366 | 3300053727 | Bacteria | 2245 |
| 553 | Ga0500599_027423 | 3300053736 | Unclassified | 834 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_11139472 | Ga0105238_111394722 | 59 |
| 2 | 3300009987 | Ga0105030_108759 | Ga0105030_1087592 | 61 |
| 3 | 3300005353 | Ga0070669_101383326 | Ga0070669_1013833262 | 62 |
| 4 | 3300014325 | Ga0163163_10004291 | Ga0163163_1000429115 | 62 |
| 5 | 3300014968 | Ga0157379_11835854 | Ga0157379_118358542 | 62 |
| 6 | 3300025986 | Ga0207658_11527439 | Ga0207658_115274391 | 62 |
| 7 | 3300049586 | Ga0501070_0188060 | Ga0501070_0188060_807_1019 | 62 |
| 8 | 3300003316 | rootH1_10148481 | rootH1_101484812 | 63 |
| 9 | 3300005530 | Ga0070679_100428429 | Ga0070679_1004284292 | 63 |
| 10 | 3300005535 | Ga0070684_100342636 | Ga0070684_1003426362 | 63 |
| 11 | 3300005563 | Ga0068855_100001829 | Ga0068855_10000182923 | 63 |
| 12 | 3300005577 | Ga0068857_100018186 | Ga0068857_1000181866 | 63 |
| 13 | 3300009174 | Ga0105241_10497333 | Ga0105241_104973333 | 63 |
| 14 | 3300009545 | Ga0105237_10089883 | Ga0105237_100898833 | 63 |
| 15 | 3300009551 | Ga0105238_10000721 | Ga0105238_1000072111 | 63 |
| 16 | 3300009551 | Ga0105238_11874358 | Ga0105238_118743582 | 63 |
| 17 | 3300013104 | Ga0157370_10111292 | Ga0157370_101112923 | 63 |
| 18 | 3300025911 | Ga0207654_10574849 | Ga0207654_105748492 | 63 |
| 19 | 3300025914 | Ga0207671_10290268 | Ga0207671_102902682 | 63 |
| 20 | 3300025921 | Ga0207652_11330181 | Ga0207652_113301812 | 63 |
| 21 | 3300025924 | Ga0207694_10006064 | Ga0207694_1000606413 | 63 |
| 22 | 3300025949 | Ga0207667_10034128 | Ga0207667_100341287 | 63 |
| 23 | 3300028800 | Ga0265338_10000313 | Ga0265338_1000031363 | 63 |
| 24 | 3300028800 | Ga0265338_10005339 | Ga0265338_100053397 | 63 |
| 25 | 3300046674 | Ga0495588_0000236 | Ga0495588_0000236_17170_17385 | 63 |
| 26 | 3300049773 | Ga0501276_028753 | Ga0501276_028753_214_429 | 63 |
| 27 | 3300053079 | Ga0500610_0299925 | Ga0500610_0299925_437_628 | 63 |
| 28 | 3300053088 | Ga0500644_0020807 | Ga0500644_0020807_87_278 | 63 |
| 29 | 3300053090 | Ga0500646_0025526 | Ga0500646_0025526_936_1127 | 63 |
| 30 | 3300053092 | Ga0500583_0002071 | Ga0500583_0002071_1262_1453 | 63 |
| 31 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_577580_577771 | 63 |
| 32 | 3300053108 | Ga0500562_009059 | Ga0500562_009059_539_730 | 63 |
| 33 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_61144_61335 | 63 |
| 34 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_521750_521965 | 63 |
| 35 | 3300053133 | Ga0500655_002749 | Ga0500655_002749_1010_1201 | 63 |
| 36 | 3300053142 | Ga0500577_0000521 | Ga0500577_0000521_5855_6046 | 63 |
| 37 | 3300053143 | Ga0500579_000688 | Ga0500579_000688_2873_3064 | 63 |
| 38 | 3300053151 | Ga0500604_0117250 | Ga0500604_0117250_265_480 | 63 |
| 39 | 3300053160 | Ga0500633_0005267 | Ga0500633_0005267_1851_2042 | 63 |
| 40 | 3300053722 | Ga0500649_000011 | Ga0500649_000011_10376_10591 | 63 |
| 41 | 3300041458 | Ga0451798_0547688 | Ga0451798_0547688_43_258 | 64 |
| 42 | 3300010375 | Ga0105239_10091108 | Ga0105239_100911082 | 65 |
| 43 | 3300025914 | Ga0207671_11071430 | Ga0207671_110714301 | 65 |
| 44 | 3300009177 | Ga0105248_10463865 | Ga0105248_104638652 | 68 |
| 45 | 3300005329 | Ga0070683_100301894 | Ga0070683_1003018942 | 69 |
| 46 | 3300005335 | Ga0070666_11336704 | Ga0070666_113367042 | 69 |
| 47 | 3300005347 | Ga0070668_100203913 | Ga0070668_1002039132 | 69 |
| 48 | 3300005347 | Ga0070668_100380397 | Ga0070668_1003803972 | 69 |
| 49 | 3300005367 | Ga0070667_100073489 | Ga0070667_1000734893 | 69 |
| 50 | 3300005544 | Ga0070686_100577054 | Ga0070686_1005770542 | 69 |
| 51 | 3300005841 | Ga0068863_101370844 | Ga0068863_1013708442 | 69 |
| 52 | 3300005843 | Ga0068860_100032886 | Ga0068860_1000328864 | 69 |
| 53 | 3300005844 | Ga0068862_100024657 | Ga0068862_1000246572 | 69 |
| 54 | 3300009177 | Ga0105248_10189139 | Ga0105248_101891392 | 69 |
| 55 | 3300009553 | Ga0105249_10002064 | Ga0105249_1000206411 | 69 |
| 56 | 3300025941 | Ga0207711_10578889 | Ga0207711_105788893 | 69 |
| 57 | 3300025944 | Ga0207661_10246665 | Ga0207661_102466652 | 69 |
| 58 | 3300025961 | Ga0207712_10001438 | Ga0207712_100014384 | 69 |
| 59 | 3300025972 | Ga0207668_11548649 | Ga0207668_115486492 | 69 |
| 60 | 3300025986 | Ga0207658_10027146 | Ga0207658_100271463 | 69 |
| 61 | 3300026088 | Ga0207641_10650747 | Ga0207641_106507472 | 69 |
| 62 | 3300028380 | Ga0268265_10028375 | Ga0268265_100283755 | 69 |
| 63 | 3300028381 | Ga0268264_10064411 | Ga0268264_100644112 | 69 |
| 64 | 3300001904 | JGI24736J21556_1012325 | JGI24736J21556_10123253 | 70 |
| 65 | 3300005327 | Ga0070658_10000012 | Ga0070658_10000012162 | 70 |
| 66 | 3300005327 | Ga0070658_10270031 | Ga0070658_102700311 | 70 |
| 67 | 3300005327 | Ga0070658_10393817 | Ga0070658_103938172 | 70 |
| 68 | 3300005327 | Ga0070658_11521127 | Ga0070658_115211272 | 70 |
| 69 | 3300005328 | Ga0070676_10033662 | Ga0070676_100336622 | 70 |
| 70 | 3300005331 | Ga0070670_100038066 | Ga0070670_1000380662 | 70 |
| 71 | 3300005331 | Ga0070670_101507263 | Ga0070670_1015072632 | 70 |
| 72 | 3300005334 | Ga0068869_101043054 | Ga0068869_1010430541 | 70 |
| 73 | 3300005335 | Ga0070666_10069396 | Ga0070666_100693963 | 70 |
| 74 | 3300005335 | Ga0070666_10950615 | Ga0070666_109506152 | 70 |
| 75 | 3300005339 | Ga0070660_100000249 | Ga0070660_1000002495 | 70 |
| 76 | 3300005339 | Ga0070660_101376390 | Ga0070660_1013763902 | 70 |
| 77 | 3300005341 | Ga0070691_10277022 | Ga0070691_102770222 | 70 |
| 78 | 3300005344 | Ga0070661_101663279 | Ga0070661_1016632791 | 70 |
| 79 | 3300005353 | Ga0070669_100837190 | Ga0070669_1008371901 | 70 |
| 80 | 3300005354 | Ga0070675_100907712 | Ga0070675_1009077122 | 70 |
| 81 | 3300005355 | Ga0070671_100000001 | Ga0070671_100000001681 | 70 |
| 82 | 3300005355 | Ga0070671_101586016 | Ga0070671_1015860161 | 70 |
| 83 | 3300005364 | Ga0070673_100000192 | Ga0070673_10000019234 | 70 |
| 84 | 3300005366 | Ga0070659_100001735 | Ga0070659_10000173513 | 70 |
| 85 | 3300005366 | Ga0070659_100271080 | Ga0070659_1002710802 | 70 |
| 86 | 3300005366 | Ga0070659_100645333 | Ga0070659_1006453331 | 70 |
| 87 | 3300005367 | Ga0070667_100000001 | Ga0070667_100000001584 | 70 |
| 88 | 3300005456 | Ga0070678_100000895 | Ga0070678_10000089510 | 70 |
| 89 | 3300005458 | Ga0070681_10124354 | Ga0070681_101243542 | 70 |
| 90 | 3300005458 | Ga0070681_10796107 | Ga0070681_107961072 | 70 |
| 91 | 3300005458 | Ga0070681_10921580 | Ga0070681_109215802 | 70 |
| 92 | 3300005466 | Ga0070685_10000179 | Ga0070685_100001794 | 70 |
| 93 | 3300005530 | Ga0070679_100005663 | Ga0070679_10000566310 | 70 |
| 94 | 3300005530 | Ga0070679_100038416 | Ga0070679_1000384164 | 70 |
| 95 | 3300005530 | Ga0070679_100544426 | Ga0070679_1005444261 | 70 |
| 96 | 3300005530 | Ga0070679_101954574 | Ga0070679_1019545741 | 70 |
| 97 | 3300005539 | Ga0068853_100352086 | Ga0068853_1003520862 | 70 |
| 98 | 3300005543 | Ga0070672_100008381 | Ga0070672_1000083818 | 70 |
| 99 | 3300005548 | Ga0070665_100315115 | Ga0070665_1003151153 | 70 |
| 100 | 3300005548 | Ga0070665_100630106 | Ga0070665_1006301063 | 70 |
| 101 | 3300005563 | Ga0068855_100000001 | Ga0068855_100000001110 | 70 |
| 102 | 3300005563 | Ga0068855_100000136 | Ga0068855_10000013634 | 70 |
| 103 | 3300005563 | Ga0068855_100054461 | Ga0068855_1000544615 | 70 |
| 104 | 3300005563 | Ga0068855_100097167 | Ga0068855_1000971672 | 70 |
| 105 | 3300005563 | Ga0068855_100222625 | Ga0068855_1002226252 | 70 |
| 106 | 3300005563 | Ga0068855_100637409 | Ga0068855_1006374092 | 70 |
| 107 | 3300005563 | Ga0068855_100709060 | Ga0068855_1007090602 | 70 |
| 108 | 3300005563 | Ga0068855_100737561 | Ga0068855_1007375612 | 70 |
| 109 | 3300005563 | Ga0068855_101202126 | Ga0068855_1012021262 | 70 |
| 110 | 3300005563 | Ga0068855_101443898 | Ga0068855_1014438982 | 70 |
| 111 | 3300005563 | Ga0068855_101500214 | Ga0068855_1015002142 | 70 |
| 112 | 3300005577 | Ga0068857_100000002 | Ga0068857_100000002239 | 70 |
| 113 | 3300005577 | Ga0068857_100021950 | Ga0068857_1000219506 | 70 |
| 114 | 3300005577 | Ga0068857_100097385 | Ga0068857_1000973853 | 70 |
| 115 | 3300005577 | Ga0068857_100154521 | Ga0068857_1001545211 | 70 |
| 116 | 3300005614 | Ga0068856_100005058 | Ga0068856_1000050588 | 70 |
| 117 | 3300005834 | Ga0068851_10819207 | Ga0068851_108192072 | 70 |
| 118 | 3300005841 | Ga0068863_100014451 | Ga0068863_10001445111 | 70 |
| 119 | 3300005841 | Ga0068863_101008476 | Ga0068863_1010084762 | 70 |
| 120 | 3300005842 | Ga0068858_100527299 | Ga0068858_1005272993 | 70 |
| 121 | 3300005843 | Ga0068860_100001264 | Ga0068860_10000126416 | 70 |
| 122 | 3300005985 | Ga0081539_10051652 | Ga0081539_100516522 | 70 |
| 123 | 3300006028 | Ga0070717_10036201 | Ga0070717_100362016 | 70 |
| 124 | 3300006038 | Ga0075365_10003756 | Ga0075365_100037568 | 70 |
| 125 | 3300006051 | Ga0075364_10011031 | Ga0075364_100110316 | 70 |
| 126 | 3300006186 | Ga0075369_10080952 | Ga0075369_100809523 | 70 |
| 127 | 3300009093 | Ga0105240_10000003 | Ga0105240_10000003924 | 70 |
| 128 | 3300009098 | Ga0105245_10000050 | Ga0105245_1000005063 | 70 |
| 129 | 3300009098 | Ga0105245_10016449 | Ga0105245_100164495 | 70 |
| 130 | 3300009098 | Ga0105245_10738194 | Ga0105245_107381942 | 70 |
| 131 | 3300009148 | Ga0105243_10000001 | Ga0105243_10000001367 | 70 |
| 132 | 3300009148 | Ga0105243_10635712 | Ga0105243_106357122 | 70 |
| 133 | 3300009174 | Ga0105241_10000003 | Ga0105241_10000003403 | 70 |
| 134 | 3300009174 | Ga0105241_11516997 | Ga0105241_115169972 | 70 |
| 135 | 3300009174 | Ga0105241_12232976 | Ga0105241_122329762 | 70 |
| 136 | 3300009176 | Ga0105242_10000011 | Ga0105242_1000001184 | 70 |
| 137 | 3300009176 | Ga0105242_10222747 | Ga0105242_102227472 | 70 |
| 138 | 3300009177 | Ga0105248_11887189 | Ga0105248_118871892 | 70 |
| 139 | 3300009177 | Ga0105248_12812264 | Ga0105248_128122641 | 70 |
| 140 | 3300009545 | Ga0105237_10005423 | Ga0105237_1000542311 | 70 |
| 141 | 3300009551 | Ga0105238_11618234 | Ga0105238_116182342 | 70 |
| 142 | 3300009551 | Ga0105238_12023876 | Ga0105238_120238762 | 70 |
| 143 | 3300009551 | Ga0105238_12383693 | Ga0105238_123836932 | 70 |
| 144 | 3300009553 | Ga0105249_12886510 | Ga0105249_128865101 | 70 |
| 145 | 3300010375 | Ga0105239_10093094 | Ga0105239_100930942 | 70 |
| 146 | 3300010375 | Ga0105239_10380811 | Ga0105239_103808113 | 70 |
| 147 | 3300010375 | Ga0105239_10596606 | Ga0105239_105966061 | 70 |
| 148 | 3300013100 | Ga0157373_10607636 | Ga0157373_106076362 | 70 |
| 149 | 3300013105 | Ga0157369_10000505 | Ga0157369_100005055 | 70 |
| 150 | 3300013105 | Ga0157369_10297635 | Ga0157369_102976352 | 70 |
| 151 | 3300013296 | Ga0157374_10000115 | Ga0157374_1000011527 | 70 |
| 152 | 3300013296 | Ga0157374_10003275 | Ga0157374_100032759 | 70 |
| 153 | 3300013296 | Ga0157374_10029826 | Ga0157374_100298264 | 70 |
| 154 | 3300013296 | Ga0157374_10550511 | Ga0157374_105505112 | 70 |
| 155 | 3300013296 | Ga0157374_10609145 | Ga0157374_106091452 | 70 |
| 156 | 3300013296 | Ga0157374_12072708 | Ga0157374_120727082 | 70 |
| 157 | 3300013297 | Ga0157378_10466535 | Ga0157378_104665352 | 70 |
| 158 | 3300013297 | Ga0157378_10827488 | Ga0157378_108274882 | 70 |
| 159 | 3300013307 | Ga0157372_10000090 | Ga0157372_1000009017 | 70 |
| 160 | 3300013307 | Ga0157372_10143548 | Ga0157372_101435483 | 70 |
| 161 | 3300013307 | Ga0157372_10877820 | Ga0157372_108778203 | 70 |
| 162 | 3300013307 | Ga0157372_12570032 | Ga0157372_125700322 | 70 |
| 163 | 3300014325 | Ga0163163_11195908 | Ga0163163_111959082 | 70 |
| 164 | 3300014326 | Ga0157380_13082708 | Ga0157380_130827082 | 70 |
| 165 | 3300014969 | Ga0157376_10000007 | Ga0157376_10000007386 | 70 |
| 166 | 3300017792 | Ga0163161_10980290 | Ga0163161_109802902 | 70 |
| 167 | 3300025315 | Ga0207697_10356839 | Ga0207697_103568392 | 70 |
| 168 | 3300025903 | Ga0207680_11205655 | Ga0207680_112056552 | 70 |
| 169 | 3300025904 | Ga0207647_10001224 | Ga0207647_1000122410 | 70 |
| 170 | 3300025909 | Ga0207705_10000038 | Ga0207705_10000038129 | 70 |
| 171 | 3300025909 | Ga0207705_10006447 | Ga0207705_100064475 | 70 |
| 172 | 3300025909 | Ga0207705_10315848 | Ga0207705_103158482 | 70 |
| 173 | 3300025909 | Ga0207705_10573717 | Ga0207705_105737172 | 70 |
| 174 | 3300025911 | Ga0207654_10000002 | Ga0207654_10000002804 | 70 |
| 175 | 3300025912 | Ga0207707_10100299 | Ga0207707_101002993 | 70 |
| 176 | 3300025912 | Ga0207707_10691338 | Ga0207707_106913382 | 70 |
| 177 | 3300025913 | Ga0207695_10000005 | Ga0207695_10000005934 | 70 |
| 178 | 3300025913 | Ga0207695_10234193 | Ga0207695_102341932 | 70 |
| 179 | 3300025914 | Ga0207671_10112276 | Ga0207671_101122761 | 70 |
| 180 | 3300025919 | Ga0207657_10015575 | Ga0207657_100155755 | 70 |
| 181 | 3300025921 | Ga0207652_10005649 | Ga0207652_100056499 | 70 |
| 182 | 3300025921 | Ga0207652_10445118 | Ga0207652_104451184 | 70 |
| 183 | 3300025923 | Ga0207681_10778623 | Ga0207681_107786232 | 70 |
| 184 | 3300025925 | Ga0207650_10155866 | Ga0207650_101558662 | 70 |
| 185 | 3300025925 | Ga0207650_11764367 | Ga0207650_117643671 | 70 |
| 186 | 3300025927 | Ga0207687_10000375 | Ga0207687_1000037511 | 70 |
| 187 | 3300025927 | Ga0207687_10011398 | Ga0207687_100113983 | 70 |
| 188 | 3300025927 | Ga0207687_10130511 | Ga0207687_101305113 | 70 |
| 189 | 3300025927 | Ga0207687_11583586 | Ga0207687_115835862 | 70 |
| 190 | 3300025931 | Ga0207644_10000001 | Ga0207644_10000001755 | 70 |
| 191 | 3300025932 | Ga0207690_10000469 | Ga0207690_100004698 | 70 |
| 192 | 3300025932 | Ga0207690_10256272 | Ga0207690_102562723 | 70 |
| 193 | 3300025934 | Ga0207686_10000001 | Ga0207686_10000001775 | 70 |
| 194 | 3300025934 | Ga0207686_10197664 | Ga0207686_101976642 | 70 |
| 195 | 3300025935 | Ga0207709_10000002 | Ga0207709_10000002893 | 70 |
| 196 | 3300025935 | Ga0207709_10384050 | Ga0207709_103840502 | 70 |
| 197 | 3300025937 | Ga0207669_10012427 | Ga0207669_100124273 | 70 |
| 198 | 3300025940 | Ga0207691_10077344 | Ga0207691_100773444 | 70 |
| 199 | 3300025941 | Ga0207711_11015912 | Ga0207711_110159122 | 70 |
| 200 | 3300025942 | Ga0207689_11285155 | Ga0207689_112851552 | 70 |
| 201 | 3300025949 | Ga0207667_10000003 | Ga0207667_10000003104 | 70 |
| 202 | 3300025949 | Ga0207667_10000060 | Ga0207667_1000006090 | 70 |
| 203 | 3300025949 | Ga0207667_10055275 | Ga0207667_100552754 | 70 |
| 204 | 3300025949 | Ga0207667_10141832 | Ga0207667_101418322 | 70 |
| 205 | 3300025949 | Ga0207667_11171607 | Ga0207667_111716072 | 70 |
| 206 | 3300025960 | Ga0207651_10000546 | Ga0207651_100005467 | 70 |
| 207 | 3300025986 | Ga0207658_10000003 | Ga0207658_10000003797 | 70 |
| 208 | 3300026041 | Ga0207639_10285943 | Ga0207639_102859433 | 70 |
| 209 | 3300026078 | Ga0207702_10013253 | Ga0207702_100132538 | 70 |
| 210 | 3300026078 | Ga0207702_10381789 | Ga0207702_103817893 | 70 |
| 211 | 3300026088 | Ga0207641_10107119 | Ga0207641_101071193 | 70 |
| 212 | 3300026088 | Ga0207641_11060282 | Ga0207641_110602822 | 70 |
| 213 | 3300026116 | Ga0207674_10000001 | Ga0207674_10000001662 | 70 |
| 214 | 3300026116 | Ga0207674_10186785 | Ga0207674_101867851 | 70 |
| 215 | 3300026116 | Ga0207674_11200976 | Ga0207674_112009762 | 70 |
| 216 | 3300026121 | Ga0207683_10002815 | Ga0207683_100028156 | 70 |
| 217 | 3300027717 | Ga0209998_10068440 | Ga0209998_100684401 | 70 |
| 218 | 3300028379 | Ga0268266_10516898 | Ga0268266_105168981 | 70 |
| 219 | 3300028381 | Ga0268264_10003540 | Ga0268264_100035407 | 70 |
| 220 | 3300028556 | Ga0265337_1064185 | Ga0265337_10641852 | 70 |
| 221 | 3300028558 | Ga0265326_10177104 | Ga0265326_101771042 | 70 |
| 222 | 3300028573 | Ga0265334_10001298 | Ga0265334_100012985 | 70 |
| 223 | 3300028800 | Ga0265338_10000217 | Ga0265338_1000021754 | 70 |
| 224 | 3300028800 | Ga0265338_10002339 | Ga0265338_100023394 | 70 |
| 225 | 3300028800 | Ga0265338_10008101 | Ga0265338_100081017 | 70 |
| 226 | 3300028800 | Ga0265338_10130767 | Ga0265338_101307673 | 70 |
| 227 | 3300031247 | Ga0265340_10000915 | Ga0265340_100009158 | 70 |
| 228 | 3300031711 | Ga0265314_10486169 | Ga0265314_104861692 | 70 |
| 229 | 3300037418 | Ga0395900_0454742 | Ga0395900_0454742_845_1057 | 70 |
| 230 | 3300037418 | Ga0395900_1333229 | Ga0395900_1333229_43_255 | 70 |
| 231 | 3300037466 | Ga0395898_0737286 | Ga0395898_0737286_80_292 | 70 |
| 232 | 3300037471 | Ga0395905_0002235 | Ga0395905_0002235_19058_19270 | 70 |
| 233 | 3300038443 | Ga0395901_0012638 | Ga0395901_0012638_3687_3899 | 70 |
| 234 | 3300038443 | Ga0395901_0037796 | Ga0395901_0037796_3442_3654 | 70 |
| 235 | 3300041463 | Ga0451804_0662213 | Ga0451804_0662213_287_499 | 70 |
| 236 | 3300042876 | Ga0451577_1007404 | Ga0451577_1007404_28_243 | 70 |
| 237 | 3300045976 | Ga0466967_0203229 | Ga0466967_0203229_1403_1615 | 70 |
| 238 | 3300045976 | Ga0466967_0341628 | Ga0466967_0341628_522_734 | 70 |
| 239 | 3300047320 | Ga0495672_0000010 | Ga0495672_0000010_511720_511932 | 70 |
| 240 | 3300048904 | Ga0496101_0382223 | Ga0496101_0382223_658_870 | 70 |
| 241 | 3300048907 | Ga0496104_1034241 | Ga0496104_1034241_362_574 | 70 |
| 242 | 3300048907 | Ga0496104_1047866 | Ga0496104_1047866_241_459 | 70 |
| 243 | 3300048908 | Ga0496105_0465784 | Ga0496105_0465784_641_853 | 70 |
| 244 | 3300048911 | Ga0496108_1239074 | Ga0496108_1239074_251_469 | 70 |
| 245 | 3300048912 | Ga0496109_0076587 | Ga0496109_0076587_2276_2494 | 70 |
| 246 | 3300048915 | Ga0496112_0179603 | Ga0496112_0179603_793_1011 | 70 |
| 247 | 3300049586 | Ga0501070_0233774 | Ga0501070_0233774_668_880 | 70 |
| 248 | 3300049589 | Ga0501073_0750538 | Ga0501073_0750538_393_605 | 70 |
| 249 | 3300050491 | nmdc:mga00v17_43362_c1 | nmdc:mga00v17_43362_c1_1037_1249 | 70 |
| 250 | 3300050492 | nmdc:mga0yw44_1143_c2 | nmdc:mga0yw44_1143_c2_2750_2962 | 70 |
| 251 | 3300050492 | nmdc:mga0yw44_162346_c1 | nmdc:mga0yw44_162346_c1_1123_1335 | 70 |
| 252 | 3300050516 | nmdc:mga0sz30_72053_c1 | nmdc:mga0sz30_72053_c1_660_872 | 70 |
| 253 | 3300053087 | Ga0500643_000043 | Ga0500643_000043_37732_37944 | 70 |
| 254 | 3300053087 | Ga0500643_000148 | Ga0500643_000148_45546_45758 | 70 |
| 255 | 3300053088 | Ga0500644_0282078 | Ga0500644_0282078_316_528 | 70 |
| 256 | 3300053091 | Ga0500647_0300729 | Ga0500647_0300729_83_295 | 70 |
| 257 | 3300053092 | Ga0500583_0001709 | Ga0500583_0001709_4418_4630 | 70 |
| 258 | 3300053093 | Ga0500651_0000050 | Ga0500651_0000050_47289_47501 | 70 |
| 259 | 3300053093 | Ga0500651_0003130 | Ga0500651_0003130_3148_3360 | 70 |
| 260 | 3300053123 | Ga0500614_002701 | Ga0500614_002701_2532_2744 | 70 |
| 261 | 3300053139 | Ga0500568_0007346 | Ga0500568_0007346_363_575 | 70 |
| 262 | 3300053139 | Ga0500568_0040568 | Ga0500568_0040568_425_637 | 70 |
| 263 | 3300053147 | Ga0500589_053376 | Ga0500589_053376_1397_1609 | 70 |
| 264 | 3300053727 | Ga0500611_002366 | Ga0500611_002366_371_583 | 70 |
| 265 | 2088090001 | CNB_F6ESG4R02F26E1 | CNB_01220220 | 71 |
| 266 | 3300001979 | JGI24740J21852_10048734 | JGI24740J21852_100487343 | 71 |
| 267 | 3300003316 | rootH1_10107612 | rootH1_101076122 | 71 |
| 268 | 3300003320 | rootH2_10249488 | rootH2_102494886 | 71 |
| 269 | 3300003322 | rootL2_10317277 | rootL2_103172772 | 71 |
| 270 | 3300003322 | rootL2_10384956 | rootL2_103849563 | 71 |
| 271 | 3300003911 | JGI25405J52794_10017988 | JGI25405J52794_100179881 | 71 |
| 272 | 3300005289 | Ga0065704_10264973 | Ga0065704_102649731 | 71 |
| 273 | 3300005327 | Ga0070658_10000015 | Ga0070658_10000015226 | 71 |
| 274 | 3300005329 | Ga0070683_100000444 | Ga0070683_10000044417 | 71 |
| 275 | 3300005329 | Ga0070683_101014207 | Ga0070683_1010142072 | 71 |
| 276 | 3300005330 | Ga0070690_100001909 | Ga0070690_1000019096 | 71 |
| 277 | 3300005331 | Ga0070670_100936792 | Ga0070670_1009367922 | 71 |
| 278 | 3300005334 | Ga0068869_101086492 | Ga0068869_1010864922 | 71 |
| 279 | 3300005336 | Ga0070680_100017205 | Ga0070680_1000172055 | 71 |
| 280 | 3300005336 | Ga0070680_100458794 | Ga0070680_1004587942 | 71 |
| 281 | 3300005337 | Ga0070682_100000762 | Ga0070682_1000007628 | 71 |
| 282 | 3300005338 | Ga0068868_101889479 | Ga0068868_1018894792 | 71 |
| 283 | 3300005338 | Ga0068868_101910028 | Ga0068868_1019100282 | 71 |
| 284 | 3300005339 | Ga0070660_100000880 | Ga0070660_10000088013 | 71 |
| 285 | 3300005340 | Ga0070689_101246870 | Ga0070689_1012468702 | 71 |
| 286 | 3300005343 | Ga0070687_100063289 | Ga0070687_1000632891 | 71 |
| 287 | 3300005344 | Ga0070661_101374659 | Ga0070661_1013746592 | 71 |
| 288 | 3300005355 | Ga0070671_100361018 | Ga0070671_1003610181 | 71 |
| 289 | 3300005356 | Ga0070674_100012866 | Ga0070674_1000128665 | 71 |
| 290 | 3300005365 | Ga0070688_101167883 | Ga0070688_1011678832 | 71 |
| 291 | 3300005366 | Ga0070659_100454414 | Ga0070659_1004544142 | 71 |
| 292 | 3300005367 | Ga0070667_100028262 | Ga0070667_1000282622 | 71 |
| 293 | 3300005435 | Ga0070714_100103038 | Ga0070714_1001030383 | 71 |
| 294 | 3300005455 | Ga0070663_100286648 | Ga0070663_1002866482 | 71 |
| 295 | 3300005456 | Ga0070678_100015910 | Ga0070678_1000159102 | 71 |
| 296 | 3300005458 | Ga0070681_10435031 | Ga0070681_104350312 | 71 |
| 297 | 3300005466 | Ga0070685_10002933 | Ga0070685_100029337 | 71 |
| 298 | 3300005530 | Ga0070679_100000459 | Ga0070679_1000004593 | 71 |
| 299 | 3300005530 | Ga0070679_100004837 | Ga0070679_1000048378 | 71 |
| 300 | 3300005530 | Ga0070679_100067526 | Ga0070679_1000675262 | 71 |
| 301 | 3300005530 | Ga0070679_100088365 | Ga0070679_1000883653 | 71 |
| 302 | 3300005530 | Ga0070679_100126308 | Ga0070679_1001263083 | 71 |
| 303 | 3300005535 | Ga0070684_100000546 | Ga0070684_1000005469 | 71 |
| 304 | 3300005535 | Ga0070684_100805093 | Ga0070684_1008050931 | 71 |
| 305 | 3300005539 | Ga0068853_101475627 | Ga0068853_1014756272 | 71 |
| 306 | 3300005544 | Ga0070686_100038466 | Ga0070686_1000384663 | 71 |
| 307 | 3300005545 | Ga0070695_101132497 | Ga0070695_1011324972 | 71 |
| 308 | 3300005563 | Ga0068855_100683989 | Ga0068855_1006839893 | 71 |
| 309 | 3300005563 | Ga0068855_101034466 | Ga0068855_1010344663 | 71 |
| 310 | 3300005614 | Ga0068856_100000445 | Ga0068856_1000004453 | 71 |
| 311 | 3300005616 | Ga0068852_100759088 | Ga0068852_1007590882 | 71 |
| 312 | 3300005617 | Ga0068859_100379353 | Ga0068859_1003793532 | 71 |
| 313 | 3300005617 | Ga0068859_100635644 | Ga0068859_1006356443 | 71 |
| 314 | 3300005937 | Ga0081455_10000008 | Ga0081455_1000000844 | 71 |
| 315 | 3300005985 | Ga0081539_10007087 | Ga0081539_100070875 | 71 |
| 316 | 3300006042 | Ga0075368_10000061 | Ga0075368_100000616 | 71 |
| 317 | 3300006048 | Ga0075363_100000048 | Ga0075363_10000004826 | 71 |
| 318 | 3300006048 | Ga0075363_100335704 | Ga0075363_1003357042 | 71 |
| 319 | 3300006051 | Ga0075364_10074457 | Ga0075364_100744573 | 71 |
| 320 | 3300006051 | Ga0075364_10404295 | Ga0075364_104042952 | 71 |
| 321 | 3300006178 | Ga0075367_10012978 | Ga0075367_100129783 | 71 |
| 322 | 3300006186 | Ga0075369_10000001 | Ga0075369_1000000161 | 71 |
| 323 | 3300006195 | Ga0075366_10000175 | Ga0075366_1000017519 | 71 |
| 324 | 3300006195 | Ga0075366_10000379 | Ga0075366_1000037915 | 71 |
| 325 | 3300006195 | Ga0075366_10620813 | Ga0075366_106208131 | 71 |
| 326 | 3300006237 | Ga0097621_100000275 | Ga0097621_1000002756 | 71 |
| 327 | 3300006237 | Ga0097621_100307575 | Ga0097621_1003075752 | 71 |
| 328 | 3300006353 | Ga0075370_10029555 | Ga0075370_100295553 | 71 |
| 329 | 3300006358 | Ga0068871_100000038 | Ga0068871_10000003836 | 71 |
| 330 | 3300006844 | Ga0075428_101863206 | Ga0075428_1018632062 | 71 |
| 331 | 3300006931 | Ga0097620_100379340 | Ga0097620_1003793402 | 71 |
| 332 | 3300006931 | Ga0097620_100635662 | Ga0097620_1006356623 | 71 |
| 333 | 3300009093 | Ga0105240_10009099 | Ga0105240_100090995 | 71 |
| 334 | 3300009093 | Ga0105240_10638756 | Ga0105240_106387562 | 71 |
| 335 | 3300009093 | Ga0105240_10975957 | Ga0105240_109759572 | 71 |
| 336 | 3300009093 | Ga0105240_12089183 | Ga0105240_120891831 | 71 |
| 337 | 3300009094 | Ga0111539_10001052 | Ga0111539_1000105224 | 71 |
| 338 | 3300009098 | Ga0105245_10000001 | Ga0105245_10000001547 | 71 |
| 339 | 3300009098 | Ga0105245_10000044 | Ga0105245_1000004434 | 71 |
| 340 | 3300009098 | Ga0105245_10333970 | Ga0105245_103339702 | 71 |
| 341 | 3300009148 | Ga0105243_10006553 | Ga0105243_100065532 | 71 |
| 342 | 3300009174 | Ga0105241_10002756 | Ga0105241_100027563 | 71 |
| 343 | 3300009174 | Ga0105241_10011505 | Ga0105241_100115057 | 71 |
| 344 | 3300009177 | Ga0105248_10106219 | Ga0105248_101062193 | 71 |
| 345 | 3300009551 | Ga0105238_10874968 | Ga0105238_108749682 | 71 |
| 346 | 3300009986 | Ga0105033_100929 | Ga0105033_1009292 | 71 |
| 347 | 3300010375 | Ga0105239_10347625 | Ga0105239_103476252 | 71 |
| 348 | 3300013100 | Ga0157373_10000061 | Ga0157373_100000613 | 71 |
| 349 | 3300013102 | Ga0157371_10000105 | Ga0157371_1000010526 | 71 |
| 350 | 3300013104 | Ga0157370_10135866 | Ga0157370_101358662 | 71 |
| 351 | 3300013104 | Ga0157370_10494931 | Ga0157370_104949312 | 71 |
| 352 | 3300013105 | Ga0157369_10319152 | Ga0157369_103191523 | 71 |
| 353 | 3300013296 | Ga0157374_10000058 | Ga0157374_1000005887 | 71 |
| 354 | 3300013296 | Ga0157374_10186481 | Ga0157374_101864812 | 71 |
| 355 | 3300013296 | Ga0157374_10873081 | Ga0157374_108730812 | 71 |
| 356 | 3300013307 | Ga0157372_10317240 | Ga0157372_103172403 | 71 |
| 357 | 3300013307 | Ga0157372_12807035 | Ga0157372_128070352 | 71 |
| 358 | 3300014745 | Ga0157377_10432098 | Ga0157377_104320982 | 71 |
| 359 | 3300014745 | Ga0157377_10533947 | Ga0157377_105339472 | 71 |
| 360 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011119 | 71 |
| 361 | 3300025909 | Ga0207705_10024904 | Ga0207705_100249046 | 71 |
| 362 | 3300025911 | Ga0207654_10001391 | Ga0207654_1000139115 | 71 |
| 363 | 3300025911 | Ga0207654_10017729 | Ga0207654_100177294 | 71 |
| 364 | 3300025912 | Ga0207707_11167553 | Ga0207707_111675532 | 71 |
| 365 | 3300025913 | Ga0207695_10010293 | Ga0207695_100102939 | 71 |
| 366 | 3300025913 | Ga0207695_10277251 | Ga0207695_102772512 | 71 |
| 367 | 3300025913 | Ga0207695_10601919 | Ga0207695_106019192 | 71 |
| 368 | 3300025917 | Ga0207660_10038002 | Ga0207660_100380023 | 71 |
| 369 | 3300025917 | Ga0207660_10913786 | Ga0207660_109137862 | 71 |
| 370 | 3300025918 | Ga0207662_10120627 | Ga0207662_101206273 | 71 |
| 371 | 3300025919 | Ga0207657_10012859 | Ga0207657_100128592 | 71 |
| 372 | 3300025919 | Ga0207657_10967695 | Ga0207657_109676952 | 71 |
| 373 | 3300025920 | Ga0207649_10304143 | Ga0207649_103041433 | 71 |
| 374 | 3300025921 | Ga0207652_10003452 | Ga0207652_1000345211 | 71 |
| 375 | 3300025921 | Ga0207652_10095506 | Ga0207652_100955063 | 71 |
| 376 | 3300025921 | Ga0207652_10318350 | Ga0207652_103183502 | 71 |
| 377 | 3300025921 | Ga0207652_10363174 | Ga0207652_103631742 | 71 |
| 378 | 3300025921 | Ga0207652_10944598 | Ga0207652_109445982 | 71 |
| 379 | 3300025924 | Ga0207694_11655053 | Ga0207694_116550531 | 71 |
| 380 | 3300025927 | Ga0207687_10000001 | Ga0207687_10000001109 | 71 |
| 381 | 3300025927 | Ga0207687_10000004 | Ga0207687_10000004724 | 71 |
| 382 | 3300025927 | Ga0207687_10000033 | Ga0207687_1000003333 | 71 |
| 383 | 3300025927 | Ga0207687_11458830 | Ga0207687_114588302 | 71 |
| 384 | 3300025929 | Ga0207664_10098662 | Ga0207664_100986623 | 71 |
| 385 | 3300025931 | Ga0207644_10368928 | Ga0207644_103689281 | 71 |
| 386 | 3300025934 | Ga0207686_10008752 | Ga0207686_100087524 | 71 |
| 387 | 3300025935 | Ga0207709_10014221 | Ga0207709_100142212 | 71 |
| 388 | 3300025936 | Ga0207670_10717089 | Ga0207670_107170893 | 71 |
| 389 | 3300025937 | Ga0207669_10009623 | Ga0207669_100096231 | 71 |
| 390 | 3300025941 | Ga0207711_10173480 | Ga0207711_101734802 | 71 |
| 391 | 3300025941 | Ga0207711_11492936 | Ga0207711_114929362 | 71 |
| 392 | 3300025942 | Ga0207689_10102483 | Ga0207689_101024832 | 71 |
| 393 | 3300025944 | Ga0207661_10000544 | Ga0207661_100005447 | 71 |
| 394 | 3300025944 | Ga0207661_11571406 | Ga0207661_115714062 | 71 |
| 395 | 3300025949 | Ga0207667_11705237 | Ga0207667_117052372 | 71 |
| 396 | 3300025961 | Ga0207712_11350430 | Ga0207712_113504302 | 71 |
| 397 | 3300025986 | Ga0207658_10009634 | Ga0207658_100096343 | 71 |
| 398 | 3300026041 | Ga0207639_11081114 | Ga0207639_110811142 | 71 |
| 399 | 3300026067 | Ga0207678_10392626 | Ga0207678_103926262 | 71 |
| 400 | 3300026078 | Ga0207702_10001979 | Ga0207702_100019793 | 71 |
| 401 | 3300026116 | Ga0207674_10480426 | Ga0207674_104804262 | 71 |
| 402 | 3300026121 | Ga0207683_10010914 | Ga0207683_100109146 | 71 |
| 403 | 3300026142 | Ga0207698_10690249 | Ga0207698_106902492 | 71 |
| 404 | 3300027866 | Ga0209813_10000001 | Ga0209813_10000001224 | 71 |
| 405 | 3300028379 | Ga0268266_10002852 | Ga0268266_1000285210 | 71 |
| 406 | 3300028556 | Ga0265337_1000558 | Ga0265337_100055813 | 71 |
| 407 | 3300028556 | Ga0265337_1003836 | Ga0265337_10038367 | 71 |
| 408 | 3300028558 | Ga0265326_10004953 | Ga0265326_100049537 | 71 |
| 409 | 3300028563 | Ga0265319_1001066 | Ga0265319_10010667 | 71 |
| 410 | 3300028563 | Ga0265319_1003528 | Ga0265319_10035283 | 71 |
| 411 | 3300028563 | Ga0265319_1064558 | Ga0265319_10645582 | 71 |
| 412 | 3300028573 | Ga0265334_10008717 | Ga0265334_100087177 | 71 |
| 413 | 3300028573 | Ga0265334_10019774 | Ga0265334_100197742 | 71 |
| 414 | 3300028573 | Ga0265334_10099761 | Ga0265334_100997613 | 71 |
| 415 | 3300028577 | Ga0265318_10008410 | Ga0265318_100084102 | 71 |
| 416 | 3300028653 | Ga0265323_10003586 | Ga0265323_100035868 | 71 |
| 417 | 3300028654 | Ga0265322_10001650 | Ga0265322_100016503 | 71 |
| 418 | 3300028666 | Ga0265336_10002591 | Ga0265336_100025917 | 71 |
| 419 | 3300028800 | Ga0265338_10002134 | Ga0265338_1000213421 | 71 |
| 420 | 3300028800 | Ga0265338_10002608 | Ga0265338_1000260819 | 71 |
| 421 | 3300028800 | Ga0265338_10015920 | Ga0265338_100159204 | 71 |
| 422 | 3300028800 | Ga0265338_10060642 | Ga0265338_100606422 | 71 |
| 423 | 3300028800 | Ga0265338_10850919 | Ga0265338_108509191 | 71 |
| 424 | 3300029957 | Ga0265324_10008047 | Ga0265324_100080477 | 71 |
| 425 | 3300029957 | Ga0265324_10326779 | Ga0265324_103267792 | 71 |
| 426 | 3300031235 | Ga0265330_10008028 | Ga0265330_100080283 | 71 |
| 427 | 3300031238 | Ga0265332_10072211 | Ga0265332_100722113 | 71 |
| 428 | 3300031239 | Ga0265328_10002143 | Ga0265328_100021436 | 71 |
| 429 | 3300031240 | Ga0265320_10007604 | Ga0265320_100076043 | 71 |
| 430 | 3300031240 | Ga0265320_10103373 | Ga0265320_101033731 | 71 |
| 431 | 3300031240 | Ga0265320_10454493 | Ga0265320_104544932 | 71 |
| 432 | 3300031241 | Ga0265325_10081012 | Ga0265325_100810121 | 71 |
| 433 | 3300031242 | Ga0265329_10009872 | Ga0265329_100098725 | 71 |
| 434 | 3300031247 | Ga0265340_10010097 | Ga0265340_100100975 | 71 |
| 435 | 3300031249 | Ga0265339_10009617 | Ga0265339_100096179 | 71 |
| 436 | 3300031250 | Ga0265331_10007742 | Ga0265331_1000774213 | 71 |
| 437 | 3300031250 | Ga0265331_10140034 | Ga0265331_101400341 | 71 |
| 438 | 3300031250 | Ga0265331_10165330 | Ga0265331_101653302 | 71 |
| 439 | 3300031251 | Ga0265327_10000025 | Ga0265327_10000025378 | 71 |
| 440 | 3300031251 | Ga0265327_10001026 | Ga0265327_1000102636 | 71 |
| 441 | 3300031251 | Ga0265327_10067188 | Ga0265327_100671882 | 71 |
| 442 | 3300031251 | Ga0265327_10108050 | Ga0265327_101080502 | 71 |
| 443 | 3300031251 | Ga0265327_10180627 | Ga0265327_101806272 | 71 |
| 444 | 3300031344 | Ga0265316_10049173 | Ga0265316_100491732 | 71 |
| 445 | 3300031344 | Ga0265316_10074657 | Ga0265316_100746572 | 71 |
| 446 | 3300031344 | Ga0265316_10963792 | Ga0265316_109637922 | 71 |
| 447 | 3300031595 | Ga0265313_10010889 | Ga0265313_1001088912 | 71 |
| 448 | 3300031595 | Ga0265313_10045444 | Ga0265313_100454441 | 71 |
| 449 | 3300031711 | Ga0265314_10305639 | Ga0265314_103056392 | 71 |
| 450 | 3300031711 | Ga0265314_10351202 | Ga0265314_103512022 | 71 |
| 451 | 3300031712 | Ga0265342_10556200 | Ga0265342_105562002 | 71 |
| 452 | 3300032005 | Ga0307411_12097110 | Ga0307411_120971102 | 71 |
| 453 | 3300035092 | Ga0373952_0104384 | Ga0373952_0104384_222_437 | 71 |
| 454 | 3300037312 | Ga0395899_0030864 | Ga0395899_0030864_1917_2132 | 71 |
| 455 | 3300037312 | Ga0395899_0034514 | Ga0395899_0034514_234_449 | 71 |
| 456 | 3300037312 | Ga0395899_0269309 | Ga0395899_0269309_726_941 | 71 |
| 457 | 3300037312 | Ga0395899_0637406 | Ga0395899_0637406_80_295 | 71 |
| 458 | 3300037418 | Ga0395900_0002337 | Ga0395900_0002337_16538_16753 | 71 |
| 459 | 3300037418 | Ga0395900_0003752 | Ga0395900_0003752_15661_15876 | 71 |
| 460 | 3300037418 | Ga0395900_0004799 | Ga0395900_0004799_10781_10996 | 71 |
| 461 | 3300037418 | Ga0395900_0132848 | Ga0395900_0132848_1668_1883 | 71 |
| 462 | 3300037418 | Ga0395900_0222137 | Ga0395900_0222137_1425_1640 | 71 |
| 463 | 3300037418 | Ga0395900_0645857 | Ga0395900_0645857_109_324 | 71 |
| 464 | 3300037418 | Ga0395900_0927357 | Ga0395900_0927357_27_242 | 71 |
| 465 | 3300037466 | Ga0395898_0003233 | Ga0395898_0003233_10482_10697 | 71 |
| 466 | 3300037466 | Ga0395898_0020497 | Ga0395898_0020497_3959_4174 | 71 |
| 467 | 3300037466 | Ga0395898_0127662 | Ga0395898_0127662_2176_2391 | 71 |
| 468 | 3300037466 | Ga0395898_0303385 | Ga0395898_0303385_967_1182 | 71 |
| 469 | 3300037466 | Ga0395898_0543814 | Ga0395898_0543814_226_441 | 71 |
| 470 | 3300037471 | Ga0395905_0004073 | Ga0395905_0004073_2954_3169 | 71 |
| 471 | 3300037471 | Ga0395905_0063653 | Ga0395905_0063653_2680_2895 | 71 |
| 472 | 3300037471 | Ga0395905_0077344 | Ga0395905_0077344_566_781 | 71 |
| 473 | 3300037471 | Ga0395905_0388491 | Ga0395905_0388491_883_1098 | 71 |
| 474 | 3300037471 | Ga0395905_0487073 | Ga0395905_0487073_132_347 | 71 |
| 475 | 3300037471 | Ga0395905_1009875 | Ga0395905_1009875_140_355 | 71 |
| 476 | 3300038443 | Ga0395901_0037932 | Ga0395901_0037932_3543_3758 | 71 |
| 477 | 3300038443 | Ga0395901_0061745 | Ga0395901_0061745_537_752 | 71 |
| 478 | 3300038443 | Ga0395901_0343868 | Ga0395901_0343868_819_1034 | 71 |
| 479 | 3300038443 | Ga0395901_0551324 | Ga0395901_0551324_17_232 | 71 |
| 480 | 3300038443 | Ga0395901_0552170 | Ga0395901_0552170_37_252 | 71 |
| 481 | 3300046538 | Ga0495609_0073467 | Ga0495609_0073467_309_539 | 71 |
| 482 | 3300046692 | Ga0495671_0136834 | Ga0495671_0136834_771_995 | 71 |
| 483 | 3300047320 | Ga0495672_0139251 | Ga0495672_0139251_745_975 | 71 |
| 484 | 3300047320 | Ga0495672_0367527 | Ga0495672_0367527_384_605 | 71 |
| 485 | 3300048089 | Ga0495614_0214111 | Ga0495614_0214111_77_292 | 71 |
| 486 | 3300048908 | Ga0496105_0090024 | Ga0496105_0090024_1478_1696 | 71 |
| 487 | 3300048929 | Ga0496126_0197099 | Ga0496126_0197099_703_918 | 71 |
| 488 | 3300049459 | Ga0495678_174733 | Ga0495678_174733_186_410 | 71 |
| 489 | 3300049568 | Ga0501031_0000319 | Ga0501031_0000319_14059_14283 | 71 |
| 490 | 3300049569 | Ga0501032_0005885 | Ga0501032_0005885_5049_5273 | 71 |
| 491 | 3300049569 | Ga0501032_0122799 | Ga0501032_0122799_57_272 | 71 |
| 492 | 3300049570 | Ga0501033_0025669 | Ga0501033_0025669_3289_3504 | 71 |
| 493 | 3300049571 | Ga0501034_0001225 | Ga0501034_0001225_10709_10924 | 71 |
| 494 | 3300049572 | Ga0501036_0030723 | Ga0501036_0030723_1744_1968 | 71 |
| 495 | 3300049572 | Ga0501036_0037028 | Ga0501036_0037028_1634_1849 | 71 |
| 496 | 3300049573 | Ga0501037_0000031 | Ga0501037_0000031_85480_85704 | 71 |
| 497 | 3300049573 | Ga0501037_0043928 | Ga0501037_0043928_555_770 | 71 |
| 498 | 3300049573 | Ga0501037_0185494 | Ga0501037_0185494_1166_1381 | 71 |
| 499 | 3300049574 | Ga0501038_0037593 | Ga0501038_0037593_3787_4011 | 71 |
| 500 | 3300049574 | Ga0501038_0157081 | Ga0501038_0157081_441_656 | 71 |
| 501 | 3300049575 | Ga0501039_0257404 | Ga0501039_0257404_845_1069 | 71 |
| 502 | 3300049578 | Ga0501042_0107412 | Ga0501042_0107412_1532_1756 | 71 |
| 503 | 3300049579 | Ga0501043_0000366 | Ga0501043_0000366_40245_40469 | 71 |
| 504 | 3300049579 | Ga0501043_0199336 | Ga0501043_0199336_568_783 | 71 |
| 505 | 3300049580 | Ga0501046_0000819 | Ga0501046_0000819_4284_4508 | 71 |
| 506 | 3300049581 | Ga0501047_0000032 | Ga0501047_0000032_64719_64943 | 71 |
| 507 | 3300049581 | Ga0501047_0000057 | Ga0501047_0000057_14722_14937 | 71 |
| 508 | 3300049582 | Ga0501048_0000013 | Ga0501048_0000013_72306_72530 | 71 |
| 509 | 3300049582 | Ga0501048_0016686 | Ga0501048_0016686_2658_2873 | 71 |
| 510 | 3300049585 | Ga0501069_0061787 | Ga0501069_0061787_307_531 | 71 |
| 511 | 3300049586 | Ga0501070_0015061 | Ga0501070_0015061_5774_5998 | 71 |
| 512 | 3300049707 | Ga0501234_000812 | Ga0501234_000812_4195_4410 | 71 |
| 513 | 3300049744 | Ga0501083_0022968 | Ga0501083_0022968_1461_1685 | 71 |
| 514 | 3300049744 | Ga0501083_0033657 | Ga0501083_0033657_359_574 | 71 |
| 515 | 3300049744 | Ga0501083_0075289 | Ga0501083_0075289_1702_1917 | 71 |
| 516 | 3300049822 | Ga0501035_0000005 | Ga0501035_0000005_371165_371380 | 71 |
| 517 | 3300049822 | Ga0501035_0011740 | Ga0501035_0011740_2345_2569 | 71 |
| 518 | 3300049823 | Ga0501044_0049040 | Ga0501044_0049040_2100_2324 | 71 |
| 519 | 3300049823 | Ga0501044_0110088 | Ga0501044_0110088_529_744 | 71 |
| 520 | 3300049824 | Ga0501045_0538966 | Ga0501045_0538966_205_429 | 71 |
| 521 | 3300050489 | nmdc:mga03683_49_c1 | nmdc:mga03683_49_c1_6057_6272 | 71 |
| 522 | 3300050490 | nmdc:mga03n38_312183_c1 | nmdc:mga03n38_312183_c1_406_627 | 71 |
| 523 | 3300050490 | nmdc:mga03n38_78_c1 | nmdc:mga03n38_78_c1_19010_19225 | 71 |
| 524 | 3300050491 | nmdc:mga00v17_483531_c1 | nmdc:mga00v17_483531_c1_128_343 | 71 |
| 525 | 3300050491 | nmdc:mga00v17_65661_c1 | nmdc:mga00v17_65661_c1_570_785 | 71 |
| 526 | 3300050493 | nmdc:mga0k408_183_c2 | nmdc:mga0k408_183_c2_9596_9814 | 71 |
| 527 | 3300050493 | nmdc:mga0k408_2341_c1 | nmdc:mga0k408_2341_c1_9178_9393 | 71 |
| 528 | 3300050494 | nmdc:mga06z11_15_c1 | nmdc:mga06z11_15_c1_58884_59099 | 71 |
| 529 | 3300050494 | nmdc:mga06z11_161732_c1 | nmdc:mga06z11_161732_c1_46_270 | 71 |
| 530 | 3300050495 | nmdc:mga04h51_1_c1 | nmdc:mga04h51_1_c1_207346_207561 | 71 |
| 531 | 3300050496 | nmdc:mga07m45_126191_c1 | nmdc:mga07m45_126191_c1_506_721 | 71 |
| 532 | 3300050496 | nmdc:mga07m45_256655_c1 | nmdc:mga07m45_256655_c1_728_952 | 71 |
| 533 | 3300050496 | nmdc:mga07m45_553691_c1 | nmdc:mga07m45_553691_c1_134_349 | 71 |
| 534 | 3300050511 | nmdc:mga08y16_388_c1 | nmdc:mga08y16_388_c1_18964_19179 | 71 |
| 535 | 3300050516 | nmdc:mga0sz30_1_c1 | nmdc:mga0sz30_1_c1_28044_28268 | 71 |
| 536 | 3300053079 | Ga0500610_0000006 | Ga0500610_0000006_25856_26083 | 71 |
| 537 | 3300053079 | Ga0500610_0005196 | Ga0500610_0005196_4025_4249 | 71 |
| 538 | 3300053087 | Ga0500643_008683 | Ga0500643_008683_3000_3227 | 71 |
| 539 | 3300053088 | Ga0500644_0000646 | Ga0500644_0000646_7464_7691 | 71 |
| 540 | 3300053088 | Ga0500644_0052537 | Ga0500644_0052537_244_474 | 71 |
| 541 | 3300053092 | Ga0500583_0000219 | Ga0500583_0000219_1407_1631 | 71 |
| 542 | 3300053093 | Ga0500651_0113418 | Ga0500651_0113418_669_893 | 71 |
| 543 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_747670_747897 | 71 |
| 544 | 3300053104 | Ga0500556_0002599 | Ga0500556_0002599_2804_3019 | 71 |
| 545 | 3300053108 | Ga0500562_006240 | Ga0500562_006240_2640_2867 | 71 |
| 546 | 3300053117 | Ga0500593_000001 | Ga0500593_000001_712024_712239 | 71 |
| 547 | 3300053118 | Ga0500594_0000082 | Ga0500594_0000082_26245_26475 | 71 |
| 548 | 3300053129 | Ga0500628_000042 | Ga0500628_000042_44185_44415 | 71 |
| 549 | 3300053129 | Ga0500628_012797 | Ga0500628_012797_282_497 | 71 |
| 550 | 3300053130 | Ga0500642_0005452 | Ga0500642_0005452_1088_1312 | 71 |
| 551 | 3300053131 | Ga0500652_000022 | Ga0500652_000022_89288_89515 | 71 |
| 552 | 3300053147 | Ga0500589_000028 | Ga0500589_000028_2117_2341 | 71 |
| 553 | 3300053736 | Ga0500599_027423 | Ga0500599_027423_149_370 | 71 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8szb-assembly1.cif.gz_A | cryo-em structure of ninj2 filament at 3.07 angstrom resolution | 0.8491 | 4 | 71 |
| 8sza-assembly1.cif.gz_B | cryo-em structure of ninj1 filament at 2.75 angstrom resolution | 0.8129 | 3 | 71 |
| 7pjs-assembly1.cif.gz_Y | structure of the 70s ribosome with trnas in the classical pre-translocation state and apramycin (c) | 0.7926 | 8 | 63 |
| 7uvx-assembly1.cif.gz_X | a. baumannii 70s ribosome-streptothricin-f complex | 0.754 | 8 | 62 |
| 7uvv-assembly1.cif.gz_X | a. baumannii ribosome-streptothricin-f complex: 70s with p-site trna | 0.7372 | 11 | 63 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6JY39_152_277_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.8501 | 4 | 65 | 1.20.5.110 |
| 1vf7M03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8464 | 2 | 65 | 1.10.287.470 |
| 1vf7E03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8431 | 2 | 65 | 1.10.287.470 |
| 1vf7C03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8406 | 2 | 65 | 1.10.287.470 |
| 1vf7B03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8404 | 2 | 65 | 1.10.287.470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T0N6R3-F1-model_v4 | Excreted virulence factor EspC (Type VII ESX diderm) | 0.4398 | 4 | 63 |
|
| AF-A0A858X862-F1-model_v4 | Efflux RND transporter periplasmic adaptor subunit | 0.4364 | 4 | 63 |
GO:0005886
GO:0015562 GO:1990281 |
| AF-A0A424HCH2-F1-model_v4 | Efflux RND transporter periplasmic adaptor subunit | 0.4258 | 4 | 63 |
GO:0015562
GO:1990281 |
| AF-A0A2V9YYA0-F1-model_v4 | Efflux RND transporter periplasmic adaptor subunit | 0.4238 | 4 | 71 |
GO:0015562
GO:0030313 GO:1990281 |
| AF-A0A2V9YYA0-F1-model_v4 | Efflux RND transporter periplasmic adaptor subunit | 0.4014 | 4 | 71 |
GO:0015562
GO:0030313 GO:1990281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar