F462751

General Info

Members Datasets Scaffolds Average Seq Length
552 361 1104 166

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0188827|Ga0373936_0188827_20_571
Length 183
Sequence LSGCIQESVIMSLIKPVPFKHCAFAILLLSGALASASAETPLPDAIAAPGETTVLTVHAEGAQVYECKAGADGKPAWAFREPIATLLVDGKTVGRHFAGPSWEHNDGSAVVGKVAGSAPGATANDIPWLKLEVVSRRGSGILSPVTTVQRIHTQGGKLDGACDQPGAFRNAPYSADYAFLRKG

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
59 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
60 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
127 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
128 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
129 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
277 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
278 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
284 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
285 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
286 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
287 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
288 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
289 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
290 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
291 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
292 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
293 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
294 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
295 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
296 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
297 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
298 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
299 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
300 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
301 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
302 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
303 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
304 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
305 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
306 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
307 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
308 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
309 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
310 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
311 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
312 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
313 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
314 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
315 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
316 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
317 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
318 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
319 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
320 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
321 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
322 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
323 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
324 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
325 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
326 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
327 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
328 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
329 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
330 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
331 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
332 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
333 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
334 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
335 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
336 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
337 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
338 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
339 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
340 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
341 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
342 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
343 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
344 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
345 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
346 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
347 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
348 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
349 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
350 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
351 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
352 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
353 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
354 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
355 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
356 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
357 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
358 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
359 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
360 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
361 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.41
Metatranscriptomes 0
Isolates 13.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.88
Nodule 12.86
Rhizoplane 9.24
Rhizosphere 61.78
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0188827 3300035113 Bacteria 906
2 JGI25153J46596_10030040 3300003215 Bacteria 1856
3 JGI25153J46596_10032577 3300003215 Bacteria 1736
4 Ga0055531_10001716 3300003794 Bacteria 15700
5 Ga0055543_1015196 3300004625 Bacteria 1487
6 Ga0065165_1001991 3300005262 Bacteria 19209
7 Ga0065165_1008464 3300005262 Bacteria 4804
8 Ga0065165_1030881 3300005262 Bacteria 1700
9 Ga0070690_100206311 3300005330 Bacteria 1370
10 Ga0070670_100553329 3300005331 Bacteria 1027
11 Ga0070666_10435477 3300005335 Bacteria 946
12 Ga0068868_101726820 3300005338 Unclassified 590
13 Ga0070668_100249607 3300005347 Bacteria 1472
14 Ga0070668_100390880 3300005347 Bacteria 1186
15 Ga0070671_100075534 3300005355 Bacteria 2815
16 Ga0070674_100892369 3300005356 Bacteria 774
17 Ga0070688_100376914 3300005365 Bacteria 1045
18 Ga0070667_101346602 3300005367 Bacteria 669
19 Ga0070709_10001804 3300005434 Bacteria 11606
20 Ga0070709_10390692 3300005434 Bacteria 1037
21 Ga0070714_100004239 3300005435 Bacteria 10801
22 Ga0070714_100323934 3300005435 Bacteria 1442
23 Ga0070714_100511801 3300005435 Bacteria 1146
24 Ga0070713_100001873 3300005436 Bacteria 13566
25 Ga0070713_100003091 3300005436 Bacteria 10950
26 Ga0070713_100498574 3300005436 Bacteria 1149
27 Ga0070713_101073047 3300005436 Bacteria 778
28 Ga0070713_101291858 3300005436 Bacteria 707
29 Ga0070710_10002237 3300005437 Bacteria 9155
30 Ga0070711_100148889 3300005439 Bacteria 1763
31 Ga0070708_100477146 3300005445 Bacteria 1177
32 Ga0070663_100664537 3300005455 Bacteria 883
33 Ga0070663_101003683 3300005455 Bacteria 726
34 Ga0070678_100112374 3300005456 Bacteria 2133
35 Ga0070662_100494448 3300005457 Bacteria 1020
36 Ga0070685_10667678 3300005466 Bacteria 755
37 Ga0070684_101410864 3300005535 Bacteria 656
38 Ga0068853_100206447 3300005539 Bacteria 1789
39 Ga0068853_100423537 3300005539 Bacteria 1249
40 Ga0070672_100447807 3300005543 Bacteria 1112
41 Ga0070693_100355711 3300005547 Bacteria 1004
42 Ga0070665_100182342 3300005548 Bacteria 2100
43 Ga0070665_101324313 3300005548 Bacteria 730
44 Ga0068855_100426740 3300005563 Bacteria 1449
45 Ga0068854_100497075 3300005578 Bacteria 1026
46 Ga0068854_101628604 3300005578 Bacteria 589
47 Ga0068856_100012484 3300005614 Bacteria 8223
48 Ga0068852_100189975 3300005616 Bacteria 1937
49 Ga0068859_101058739 3300005617 Bacteria 892
50 Ga0068864_100305374 3300005618 Bacteria 1491
51 Ga0068870_10402626 3300005840 Bacteria 891
52 Ga0068863_100198011 3300005841 Bacteria 1931
53 Ga0068858_100189852 3300005842 Bacteria 1941
54 Ga0068858_100327974 3300005842 Bacteria 1464
55 Ga0068860_100609515 3300005843 Bacteria 1098
56 Ga0081540_1041995 3300005983 Bacteria 2364
57 Ga0070717_10258744 3300006028 Bacteria 1539
58 Ga0070717_10292421 3300006028 Bacteria 1447
59 Ga0075368_10079708 3300006042 Bacteria 1331
60 Ga0075363_100400471 3300006048 Bacteria 807
61 Ga0075364_10365710 3300006051 Bacteria 983
62 Ga0070715_10057370 3300006163 Bacteria 1696
63 Ga0070716_100697879 3300006173 Bacteria 775
64 Ga0070716_100811737 3300006173 Bacteria 725
65 Ga0070712_100075681 3300006175 Bacteria 2422
66 Ga0070712_100264919 3300006175 Bacteria 1378
67 Ga0075362_10081218 3300006177 Bacteria 1494
68 Ga0075362_10630778 3300006177 Bacteria 555
69 Ga0075367_10228497 3300006178 Bacteria 1165
70 Ga0075369_10025162 3300006186 Bacteria 2473
71 Ga0075369_10064590 3300006186 Bacteria 1603
72 Ga0075366_10143830 3300006195 Bacteria 1442
73 Ga0097621_100163883 3300006237 Bacteria 1912
74 Ga0097621_100518583 3300006237 Bacteria 1081
75 Ga0075370_10058068 3300006353 Bacteria 2200
76 Ga0075428_100590312 3300006844 Bacteria 1187
77 Ga0075434_100259158 3300006871 Bacteria 1758
78 Ga0068865_100384979 3300006881 Bacteria 1145
79 Ga0097620_101058793 3300006931 Bacteria 892
80 Ga0099825_1040687 3300006941 Bacteria 1369
81 Ga0099824_1033810 3300006942 Bacteria 1696
82 Ga0099823_1030377 3300006944 Bacteria 4526
83 Ga0099794_10065042 3300007265 Bacteria 1778
84 Ga0099795_10017803 3300007788 Bacteria 2271
85 Ga0099795_10018057 3300007788 Bacteria 2259
86 Ga0105240_10309751 3300009093 Bacteria 1803
87 Ga0105245_10195722 3300009098 Bacteria 1939
88 Ga0105245_11226826 3300009098 Bacteria 798
89 Ga0105247_10133823 3300009101 Bacteria 1618
90 Ga0114129_10154361 3300009147 Bacteria 3141
91 Ga0105241_10245782 3300009174 Bacteria 1515
92 Ga0105242_10590211 3300009176 Bacteria 1071
93 Ga0105242_10740726 3300009176 Bacteria 966
94 Ga0105242_11543975 3300009176 Bacteria 696
95 Ga0105237_10076613 3300009545 Bacteria 3335
96 Ga0105237_10149952 3300009545 Bacteria 2328
97 Ga0105237_10507180 3300009545 Bacteria 1213
98 Ga0105238_11311797 3300009551 Bacteria 750
99 Ga0105249_10650525 3300009553 Bacteria 1112
100 Ga0099796_10177033 3300010159 Bacteria 854
101 Ga0099796_10263217 3300010159 Bacteria 720
102 Ga0105239_10064607 3300010375 Bacteria 4017
103 Ga0105239_11048029 3300010375 Bacteria 938
104 Ga0105239_11494065 3300010375 Bacteria 781
105 Ga0105246_10049364 3300011119 Bacteria 2882
106 Ga0105246_10091399 3300011119 Bacteria 2194
107 Ga0157378_10329884 3300013297 Bacteria 1485
108 Ga0157375_10226472 3300013308 Bacteria 2028
109 Ga0157375_10280790 3300013308 Bacteria 1828
110 Ga0157375_11567581 3300013308 Bacteria 778
111 Ga0163163_10251842 3300014325 Bacteria 1816
112 Ga0163163_10478674 3300014325 Bacteria 1306
113 Ga0163163_10586329 3300014325 Bacteria 1178
114 Ga0157379_10036408 3300014968 Bacteria 4389
115 Ga0157379_10477261 3300014968 Bacteria 1154
116 Ga0157379_10493781 3300014968 Bacteria 1134
117 Ga0163161_10230551 3300017792 Bacteria 1437
118 Ga0163161_10343469 3300017792 Bacteria 1185
119 Ga0207425_1025026 3300025245 Bacteria 1235
120 Ga0209130_1054642 3300025284 Bacteria 714
121 Ga0209564_1025748 3300025295 Bacteria 1967
122 Ga0209758_1010732 3300025297 Bacteria 5429
123 Ga0209758_1012556 3300025297 Bacteria 4725
124 Ga0209758_1025865 3300025297 Bacteria 2560
125 Ga0209256_1041979 3300025299 Bacteria 1158
126 Ga0207426_1004182 3300025302 Bacteria 7199
127 Ga0207426_1059293 3300025302 Bacteria 1107
128 Ga0209257_1001136 3300025304 Bacteria 34058
129 Ga0207697_10088489 3300025315 Bacteria 1311
130 Ga0207692_10480151 3300025898 Bacteria 786
131 Ga0207692_10508969 3300025898 Unclassified 765
132 Ga0207642_10051502 3300025899 Bacteria 1863
133 Ga0207710_10105179 3300025900 Bacteria 1335
134 Ga0207647_10133536 3300025904 Bacteria 1457
135 Ga0207699_10281957 3300025906 Bacteria 1155
136 Ga0207699_10335990 3300025906 Bacteria 1063
137 Ga0207654_10050319 3300025911 Bacteria 2394
138 Ga0207654_10166170 3300025911 Bacteria 1429
139 Ga0207695_10000029 3300025913 Bacteria 548364
140 Ga0207695_10187477 3300025913 Bacteria 1987
141 Ga0207671_10060973 3300025914 Bacteria 2799
142 Ga0207693_10052293 3300025915 Plasmid 3204
143 Ga0207663_10000136 3300025916 Bacteria 34085
144 Ga0207681_10462144 3300025923 Bacteria 1034
145 Ga0207694_10278408 3300025924 Bacteria 1374
146 Ga0207694_10440490 3300025924 Bacteria 1087
147 Ga0207650_10089112 3300025925 Bacteria 2354
148 Ga0207687_10271318 3300025927 Bacteria 1356
149 Ga0207700_10138666 3300025928 Bacteria 1995
150 Ga0207700_10233826 3300025928 Bacteria 1564
151 Ga0207700_10335420 3300025928 Bacteria 1313
152 Ga0207644_10216473 3300025931 Bacteria 1516
153 Ga0207644_10460867 3300025931 Bacteria 1045
154 Ga0207690_10727954 3300025932 Bacteria 817
155 Ga0207686_10285418 3300025934 Bacteria 1220
156 Ga0207669_10335775 3300025937 Bacteria 1162
157 Ga0207669_10385414 3300025937 Bacteria 1093
158 Ga0207704_10201730 3300025938 Bacteria 1456
159 Ga0207665_10004646 3300025939 Bacteria 9120
160 Ga0207665_10100884 3300025939 Bacteria 2015
161 Ga0207665_10138009 3300025939 Bacteria 1736
162 Ga0207665_10373783 3300025939 Bacteria 1080
163 Ga0207691_10232046 3300025940 Bacteria 1598
164 Ga0207711_10311307 3300025941 Bacteria 1454
165 Ga0207711_10327566 3300025941 Bacteria 1416
166 Ga0207667_10121728 3300025949 Bacteria 2688
167 Ga0207712_10958760 3300025961 Bacteria 758
168 Ga0207668_10215096 3300025972 Bacteria 1539
169 Ga0207668_10275270 3300025972 Bacteria 1378
170 Ga0207668_10746113 3300025972 Bacteria 863
171 Ga0207640_10907566 3300025981 Bacteria 770
172 Ga0207677_10563913 3300026023 Bacteria 994
173 Ga0207703_10280494 3300026035 Bacteria 1513
174 Ga0207703_10478660 3300026035 Bacteria 1166
175 Ga0207639_10614539 3300026041 Bacteria 1003
176 Ga0207639_10673819 3300026041 Bacteria 958
177 Ga0207678_10513211 3300026067 Bacteria 1046
178 Ga0207702_10001399 3300026078 Bacteria 24061
179 Ga0207702_10608666 3300026078 Bacteria 1072
180 Ga0207641_10399253 3300026088 Bacteria 1320
181 Ga0207648_10223190 3300026089 Bacteria 1675
182 Ga0207648_10464187 3300026089 Bacteria 1154
183 Ga0207676_10561396 3300026095 Bacteria 1092
184 Ga0207674_10887002 3300026116 Bacteria 860
185 Ga0207683_10151574 3300026121 Bacteria 2092
186 Ga0207698_10364708 3300026142 Bacteria 1369
187 Ga0209389_1000011 3300027296 Bacteria 223265
188 Ga0209489_100017 3300027361 Bacteria 223265
189 Ga0209700_100027 3300027363 Bacteria 223462
190 Ga0209179_1016188 3300027512 Bacteria 1396
191 Ga0209179_1102764 3300027512 Bacteria 636
192 Ga0209588_1002888 3300027671 Bacteria 4720
193 Ga0209813_10014113 3300027866 Bacteria 2146
194 Ga0268266_10113555 3300028379 Bacteria 2402
195 Ga0268264_10515788 3300028381 Bacteria 1168
196 Ga0268264_10720110 3300028381 Bacteria 992
197 Ga0265330_10015287 3300031235 Bacteria 3552
198 Ga0265330_10075388 3300031235 Bacteria 1457
199 Ga0265330_10081498 3300031235 Bacteria 1394
200 Ga0265332_10081821 3300031238 Bacteria 1369
201 Ga0265340_10016560 3300031247 Bacteria 3817
202 Ga0265339_10078105 3300031249 Bacteria 1753
203 Ga0265316_10365415 3300031344 Bacteria 1043
204 Ga0307513_10449520 3300031456 Bacteria 1013
205 Ga0307508_10596153 3300031616 Bacteria 706
206 Ga0265314_10013390 3300031711 Bacteria 6627
207 Ga0265314_10014628 3300031711 Bacteria 6266
208 Ga0265342_10140150 3300031712 Bacteria 1349
209 Ga0307516_10033572 3300031730 Bacteria 5164
210 Ga0307516_10112310 3300031730 Bacteria 2525
211 Ga0307405_10597814 3300031731 Bacteria 900
212 Ga0307510_10263086 3300033180 Bacteria 1205
213 Ga0373928_0024742 3300035084 Bacteria 1290
214 Ga0373934_0011218 3300035086 Bacteria 3372
215 Ga0373934_0103433 3300035086 Bacteria 1152
216 Ga0373940_0144420 3300035088 Bacteria 754
217 Ga0373949_0039383 3300035090 Bacteria 1157
218 Ga0373936_0023865 3300035113 Bacteria 2385
219 Ga0373936_0138462 3300035113 Unclassified 1050
220 Ga0373953_0000494 3300035117 Bacteria 10928
221 Ga0373954_0000167 3300035118 Bacteria 23536
222 Ga0373954_0176137 3300035118 Bacteria 1048
223 Ga0373956_0002737 3300035119 Bacteria 7130
224 Ga0373957_0004886 3300035120 Bacteria 4113
225 Ga0373960_0086117 3300035121 Bacteria 998
226 Ga0373943_0387282 3300035170 Bacteria 805
227 Ga0373946_0006525 3300035171 Bacteria 4232
228 Ga0373955_0000360 3300035172 Bacteria 19140
229 Ga0373955_0034564 3300035172 Bacteria 2671
230 Ga0373924_0042255 3300035410 Bacteria 1869
231 Ga0373931_0179007 3300035691 Bacteria 1254
232 Ga0373935_0008649 3300035692 Bacteria 6096
233 Ga0373935_0298155 3300035692 Bacteria 1139
234 Ga0373927_0000950 3300035695 Bacteria 22071
235 Ga0373927_0155185 3300035695 Bacteria 1499
236 Ga0373933_0000466 3300035724 Bacteria 25296
237 Ga0373933_0003487 3300035724 Bacteria 8754
238 Ga0373933_0040997 3300035724 Bacteria 2731
239 Ga0373933_0825857 3300035724 Bacteria 610
240 Ga0373947_0011645 3300035725 Bacteria 5044
241 Ga0373947_0060196 3300035725 Bacteria 2305
242 Ga0373947_0165386 3300035725 Bacteria 1433
243 Ga0373937_0020598 3300036401 Bacteria 5911
244 Ga0373937_0061819 3300036401 Bacteria 3443
245 Ga0373937_0140517 3300036401 Bacteria 2259
246 Ga0373937_0635410 3300036401 Bacteria 1013
247 Ga0373937_1036351 3300036401 Bacteria 769
248 Ga0373925_0003061 3300037068 Bacteria 13145
249 Ga0373925_0674466 3300037068 Bacteria 852
250 Ga0436364_0327422 3300037853 Bacteria 1441
251 Ga0436364_1420365 3300037853 Bacteria 902
252 Ga0436365_0306522 3300039437 Bacteria 1006
253 Ga0451789_0142457 3300041443 Bacteria 748
254 Ga0451800_1484367 3300041459 Bacteria 849
255 Ga0451833_1262002 3300041491 Bacteria 699
256 Ga0466969_0392498 3300044656 Bacteria 630
257 Ga0466957_0625627 3300044842 Bacteria 755
258 Ga0466959_0035792 3300045049 Bacteria 3669
259 Ga0495592_0001833 3300046454 Bacteria 14940
260 Ga0495592_0085284 3300046454 Bacteria 2277
261 Ga0495592_0090539 3300046454 Bacteria 2195
262 Ga0495603_0000200 3300046455 Bacteria 31435
263 Ga0495629_0002535 3300046459 Bacteria 14008
264 Ga0495629_0002997 3300046459 Bacteria 12847
265 Ga0495638_0023071 3300046460 Bacteria 4076
266 Ga0495641_0092595 3300046461 Bacteria 1350
267 Ga0495651_0015886 3300046462 Bacteria 5828
268 Ga0495651_0279799 3300046462 Bacteria 1128
269 Ga0495653_0001070 3300046463 Bacteria 21097
270 Ga0495653_0117135 3300046463 Bacteria 1904
271 Ga0495653_0677544 3300046463 Bacteria 628
272 Ga0495580_0002104 3300046472 Bacteria 17472
273 Ga0495582_0000354 3300046473 Bacteria 25130
274 Ga0495582_0677757 3300046473 Bacteria 597
275 Ga0495639_0002381 3300046475 Bacteria 8216
276 Ga0495662_0039645 3300046476 Bacteria 2275
277 Ga0495662_0325962 3300046476 Bacteria 755
278 Ga0495664_0075336 3300046477 Bacteria 2019
279 Ga0495664_0232146 3300046477 Bacteria 1116
280 Ga0495664_0480287 3300046477 Bacteria 743
281 Ga0495584_0516212 3300046491 Bacteria 609
282 Ga0495594_0001396 3300046499 Bacteria 12540
283 Ga0495596_0139828 3300046500 Bacteria 940
284 Ga0495606_0151755 3300046507 Bacteria 1359
285 Ga0495606_0343178 3300046507 Bacteria 795
286 Ga0495608_0000832 3300046511 Bacteria 21541
287 Ga0495608_0139350 3300046511 Bacteria 1549
288 Ga0495608_0268501 3300046511 Bacteria 1061
289 Ga0495620_0107584 3300046515 Bacteria 1107
290 Ga0495628_0008405 3300046516 Bacteria 8856
291 Ga0495628_0039155 3300046516 Bacteria 3792
292 Ga0495628_0068962 3300046516 Bacteria 2758
293 Ga0495630_0002803 3300046517 Bacteria 12089
294 Ga0495630_0493069 3300046517 Bacteria 939
295 Ga0495630_0546032 3300046517 Unclassified 889
296 Ga0495643_0037656 3300046522 Bacteria 2651
297 Ga0495643_0209215 3300046522 Bacteria 932
298 Ga0495648_0124441 3300046524 Bacteria 1380
299 Ga0495648_0331313 3300046524 Bacteria 702
300 Ga0495666_0152899 3300046526 Bacteria 1072
301 Ga0495652_0015589 3300046529 Bacteria 6802
302 Ga0495652_0161659 3300046529 Bacteria 1738
303 Ga0495652_0420811 3300046529 Bacteria 941
304 Ga0495665_0004666 3300046531 Bacteria 7391
305 Ga0495640_0022977 3300046533 Bacteria 4553
306 Ga0495586_0049210 3300046535 Bacteria 2279
307 Ga0495586_0258052 3300046535 Bacteria 995
308 Ga0495587_0005941 3300046536 Bacteria 7958
309 Ga0495587_0154600 3300046536 Bacteria 1307
310 Ga0495609_0070720 3300046538 Bacteria 1534
311 Ga0495597_0043832 3300046542 Bacteria 1991
312 Ga0495645_0005396 3300046543 Bacteria 8768
313 Ga0495645_0051699 3300046543 Bacteria 2989
314 Ga0495645_0505164 3300046543 Bacteria 755
315 Ga0495622_0003765 3300046557 Bacteria 7096
316 Ga0495622_0117728 3300046557 Bacteria 1214
317 Ga0495667_0125601 3300046559 Bacteria 1655
318 Ga0495668_0148140 3300046616 Bacteria 1285
319 Ga0495634_0011838 3300046642 Bacteria 6342
320 Ga0495634_0055818 3300046642 Bacteria 2640
321 Ga0495625_0292875 3300046660 Bacteria 1044
322 Ga0495625_0318269 3300046660 Bacteria 991
323 Ga0495635_0003204 3300046663 Bacteria 11282
324 Ga0495635_0006430 3300046663 Bacteria 8192
325 Ga0495635_0300525 3300046663 Bacteria 1076
326 Ga0495635_0685577 3300046663 Unclassified 665
327 Ga0495661_0488079 3300046665 Bacteria 589
328 Ga0495588_0313556 3300046674 Bacteria 825
329 Ga0495657_0005689 3300046675 Bacteria 9821
330 Ga0495657_0214203 3300046675 Bacteria 1170
331 Ga0495599_0002898 3300046678 Bacteria 9977
332 Ga0495599_0073213 3300046678 Bacteria 2139
333 Ga0495623_0025661 3300046679 Bacteria 3795
334 Ga0495623_0141123 3300046679 Bacteria 1433
335 Ga0495623_0233795 3300046679 Bacteria 1041
336 Ga0495646_0001327 3300046680 Bacteria 14611
337 Ga0495646_0059525 3300046680 Bacteria 2281
338 Ga0495646_0254158 3300046680 Bacteria 940
339 Ga0495646_0397423 3300046680 Bacteria 717
340 Ga0495647_0001121 3300046681 Bacteria 8198
341 Ga0495647_0475067 3300046681 Bacteria 580
342 Ga0495658_0000888 3300046683 Bacteria 16070
343 Ga0495669_0444676 3300046684 Bacteria 629
344 Ga0495613_0004930 3300046689 Bacteria 10028
345 Ga0495624_0002275 3300046690 Bacteria 14611
346 Ga0495600_0014514 3300046809 Bacteria 4965
347 Ga0495660_0117856 3300046810 Bacteria 1347
348 Ga0495581_0009639 3300047315 Bacteria 5586
349 Ga0495581_0044944 3300047315 Bacteria 2554
350 Ga0495604_0020020 3300047317 Bacteria 5347
351 Ga0495604_0027661 3300047317 Bacteria 4508
352 Ga0495604_0227207 3300047317 Bacteria 1282
353 Ga0495604_0411623 3300047317 Bacteria 889
354 Ga0495674_0000559 3300047319 Bacteria 34585
355 Ga0495674_0041720 3300047319 Bacteria 4097
356 Ga0495674_0062834 3300047319 Bacteria 3232
357 Ga0495674_0655768 3300047319 Unclassified 827
358 Ga0495672_0152778 3300047320 Bacteria 1195
359 Ga0495676_0135802 3300047321 Bacteria 1769
360 Ga0495676_0666780 3300047321 Bacteria 674
361 Ga0495680_0020249 3300047322 Bacteria 5601
362 Ga0495687_020378 3300047443 Bacteria 3231
363 Ga0495675_0001411 3300047444 Bacteria 14558
364 Ga0495675_0007287 3300047444 Bacteria 6814
365 Ga0495673_0121718 3300047469 Bacteria 1033
366 Ga0495673_0130430 3300047469 Bacteria 988
367 Ga0495673_0148471 3300047469 Bacteria 908
368 Ga0495684_0001116 3300047471 Bacteria 21626
369 Ga0495684_0209586 3300047471 Bacteria 1434
370 Ga0495684_0280987 3300047471 Bacteria 1201
371 Ga0495686_0735785 3300047472 Bacteria 501
372 Ga0495593_0000606 3300047673 Bacteria 20452
373 Ga0495593_0000677 3300047673 Bacteria 19636
374 Ga0495602_0010527 3300048088 Bacteria 9599
375 Ga0495602_0010571 3300048088 Bacteria 9574
376 Ga0495602_0245038 3300048088 Bacteria 1339
377 Ga0495614_0105764 3300048089 Bacteria 1233
378 Ga0495626_0078025 3300048091 Bacteria 1476
379 Ga0496100_0848518 3300048903 Bacteria 716
380 Ga0496101_0049025 3300048904 Bacteria 3036
381 Ga0496102_0174710 3300048905 Bacteria 2022
382 Ga0496102_0187333 3300048905 Bacteria 1950
383 Ga0496102_0221199 3300048905 Bacteria 1785
384 Ga0496103_0064706 3300048906 Bacteria 2280
385 Ga0496103_0552925 3300048906 Bacteria 735
386 Ga0496103_0993203 3300048906 Bacteria 523
387 Ga0496104_0091806 3300048907 Bacteria 2903
388 Ga0496104_0108459 3300048907 Bacteria 2661
389 Ga0496104_0122986 3300048907 Bacteria 2491
390 Ga0496104_0162280 3300048907 Bacteria 2143
391 Ga0496104_0496626 3300048907 Bacteria 1131
392 Ga0496105_0059069 3300048908 Bacteria 3164
393 Ga0496105_0061372 3300048908 Bacteria 3102
394 Ga0496105_0178862 3300048908 Bacteria 1737
395 Ga0496105_0302885 3300048908 Bacteria 1284
396 Ga0496106_0040173 3300048909 Bacteria 3503
397 Ga0496106_0084444 3300048909 Bacteria 2443
398 Ga0496106_1064104 3300048909 Bacteria 635
399 Ga0496107_0256137 3300048910 Bacteria 1302
400 Ga0496107_0310840 3300048910 Bacteria 1173
401 Ga0496108_0038596 3300048911 Bacteria 3979
402 Ga0496108_0172396 3300048911 Bacteria 1872
403 Ga0496108_0614999 3300048911 Bacteria 946
404 Ga0496109_0009711 3300048912 Bacteria 8213
405 Ga0496109_0180376 3300048912 Bacteria 1983
406 Ga0496109_0237910 3300048912 Bacteria 1713
407 Ga0496109_0719513 3300048912 Bacteria 936
408 Ga0496110_0225898 3300048913 Bacteria 1702
409 Ga0496110_0233398 3300048913 Bacteria 1673
410 Ga0496110_0373697 3300048913 Bacteria 1299
411 Ga0496111_0464169 3300048914 Bacteria 934
412 Ga0496112_0024105 3300048915 Bacteria 5823
413 Ga0496112_0042468 3300048915 Bacteria 4448
414 Ga0496112_0046597 3300048915 Bacteria 4253
415 Ga0496112_0133086 3300048915 Bacteria 2457
416 Ga0496112_0444565 3300048915 Bacteria 1234
417 Ga0496113_0048147 3300048916 Bacteria 3171
418 Ga0496114_0043118 3300048917 Bacteria 3741
419 Ga0496114_0075699 3300048917 Bacteria 2835
420 Ga0496114_0293453 3300048917 Bacteria 1435
421 Ga0496114_0334013 3300048917 Bacteria 1340
422 Ga0496115_0046271 3300048918 Bacteria 3476
423 Ga0496115_0167222 3300048918 Bacteria 1819
424 Ga0496115_0261406 3300048918 Bacteria 1423
425 Ga0496115_0380903 3300048918 Bacteria 1147
426 Ga0496115_0826458 3300048918 Bacteria 719
427 Ga0496115_1000018 3300048918 Bacteria 639
428 Ga0496116_0049604 3300048919 Bacteria 2805
429 Ga0496116_0189907 3300048919 Bacteria 1089
430 Ga0496117_0198615 3300048920 Bacteria 1135
431 Ga0496118_0078380 3300048921 Bacteria 2338
432 Ga0496118_0090341 3300048921 Bacteria 2111
433 Ga0496118_0224738 3300048921 Bacteria 1089
434 Ga0496118_0289505 3300048921 Bacteria 906
435 Ga0496119_0156744 3300048922 Bacteria 1215
436 Ga0496121_0045180 3300048924 Bacteria 3787
437 Ga0496121_0216324 3300048924 Bacteria 1353
438 Ga0496121_0448356 3300048924 Bacteria 832
439 Ga0496122_0194135 3300048925 Bacteria 1195
440 Ga0496123_0146490 3300048926 Bacteria 1282
441 Ga0496124_0265346 3300048927 Bacteria 1261
442 Ga0496125_0035659 3300048928 Bacteria 4358
443 Ga0496126_0021474 3300048929 Bacteria 6304
444 Ga0496126_0043062 3300048929 Bacteria 4167
445 Ga0496126_0048455 3300048929 Bacteria 3882
446 Ga0496126_0174550 3300048929 Bacteria 1829
447 Ga0496126_0345378 3300048929 Bacteria 1218
448 Ga0496126_0610275 3300048929 Bacteria 858
449 nmdc:mga00v17_350984_c1 3300050491 Bacteria 959
450 nmdc:mga0yw44_197877_c1 3300050492 Bacteria 1327
451 nmdc:mga0k408_37704_c1 3300050493 Bacteria 2775
452 nmdc:mga0k408_633930_c1 3300050493 Bacteria 629
453 nmdc:mga04h51_4945_c1 3300050495 Bacteria 3359
454 nmdc:mga07m45_220343_c1 3300050496 Bacteria 1104
455 nmdc:mga08y16_641202_c1 3300050511 Unclassified 1067
456 Ga0495601_0070661 3300053077 Bacteria 2229
457 Ga0495601_0109356 3300053077 Bacteria 1789
458 Ga0495601_0187025 3300053077 Bacteria 1354
459 Ga0495601_0197784 3300053077 Bacteria 1314
460 Ga0495612_0081519 3300053078 Bacteria 1360
461 Ga0495612_0180177 3300053078 Bacteria 928
462 Ga0495619_0000966 3300053085 Bacteria 18840
463 Ga0500647_0068955 3300053091 Bacteria 1700
464 Ga0500556_0232549 3300053104 Bacteria 726
465 Ga0500557_000039 3300053105 Bacteria 66862
466 Ga0500562_003302 3300053108 Bacteria 4031
467 Ga0500569_074175 3300053109 Bacteria 1076
468 Ga0500618_073487 3300053125 Bacteria 767
469 Ga0500642_0004438 3300053130 Bacteria 4392
470 Ga0500642_0047884 3300053130 Bacteria 1875
471 Ga0500559_0116307 3300053136 Bacteria 1241
472 Ga0500604_0029049 3300053151 Bacteria 1609
473 Ga0500622_0006086 3300053156 Bacteria 7086
474 Ga0500636_0031124 3300053177 Bacteria 3157
475 Ga0500636_0331330 3300053177 Bacteria 735
476 Ga0500637_0196283 3300053178 Bacteria 1151
477 Ga0500599_005947 3300053736 Bacteria 1545
478 2508697942 2508501042 Bacteria 8719808
479 2513643833 2513237094 Bacteria 8789602
480 2513697028 2513237101 Bacteria 7952346
481 2513702068 2513237102 Bacteria 7703324
482 2514012675 2513237161 Bacteria 8871253
483 2528849690 2528768022 Bacteria 10457665
484 2617352548 2617270735 Bacteria 9163226
485 2643756448 2643221547 Bacteria 4740017
486 2818241681 2816332527 Bacteria 8933356
487 2824674437 2824671348 Bacteria 8369588
488 2824687575 2824679649 Bacteria 8248951
489 2824692373 2824687955 Bacteria 8360029
490 2824778184 2824773399 Bacteria 8360218
491 2838127436 2838122688 Bacteria 8803140
492 2841941611 2841941048 Bacteria 8688029
493 2841952372 2841949485 Bacteria 8680857
494 2841959395 2841957949 Bacteria 8652217
495 2841967756 2841966195 Bacteria 8673214
496 2841982080 2841974524 Bacteria 8931498
497 2841986397 2841983080 Bacteria 8395090
498 2842038165 2842038055 Bacteria 8002051
499 2842048889 2842045827 Bacteria 8006841
500 2849080775 2849076700 Bacteria 7039503
501 2874623128 2874620515 Bacteria 8290088
502 2874636133 2874628541 Bacteria 8630250
503 2876766770 2876761206 Bacteria 10111113
504 2879107646 2879099564 Bacteria 10442239
505 2885391209 2885383462 Bacteria 9473874
506 2888382368 2888378607 Bacteria 9652610
507 2904669948 2904666416 Bacteria 8226587
508 2922362283 2922361189 Bacteria 7436256
509 2922394893 2922393267 Bacteria 8285685
510 2932787004 2932784394 Bacteria 9704911
511 2932811206 2932809354 Bacteria 9135765
512 2932819920 2932818245 Bacteria 9955613
513 2932832406 2932828146 Bacteria 9745859
514 2935619110 2935616580 Bacteria 9032984
515 2935643071 2935638405 Bacteria 10015038
516 2935669698 2935665750 Bacteria 9571747
517 2935677161 2935675223 Bacteria 9928132
518 2935693197 2935684952 Bacteria 9590419
519 2935695309 2935694250 Bacteria 9291695
520 2935719805 2935713505 Bacteria 9608509
521 2935729428 2935722832 Bacteria 9608746
522 2935739688 2935732158 Bacteria 9706831
523 2935748726 2935741537 Bacteria 9707219
524 2935756687 2935750917 Bacteria 9590372
525 2935761329 2935760218 Bacteria 9817913
526 2935779088 2935777560 Bacteria 8077691
527 2935807220 2935801545 Bacteria 9301974
528 2935812352 2935810662 Bacteria 9401221
529 2935832784 2935827899 Bacteria 10038562
530 2935839134 2935837841 Bacteria 9454360
531 2935857475 2935855204 Bacteria 9035059
532 2935884886 2935883170 Bacteria 7964738
533 2935987770 2935984226 Bacteria 8302647
534 2935999603 2935992306 Bacteria 9802711
535 2936038945 2936037263 Bacteria 9446081
536 2940562601 2940556831 Bacteria 9590747
537 2941539824 2941538514 Bacteria 9402094
538 8006995592 8006994254 Bacteria 8309700
539 8016515208 8016511872 Bacteria 9921665
540 8016522989 8016522445 Bacteria 8156687
541 8016540729 8016539877 Bacteria 8155419
542 8016552513 8016548790 Bacteria 8155074
543 8016560894 8016557553 Bacteria 8154380
544 8016574812 8016566248 Bacteria 8158151
545 8016578886 8016575299 Bacteria 8154085
546 8016598763 8016595262 Bacteria 8149947
547 8016612318 8016603502 Bacteria 8731218
548 8016621488 8016613128 Bacteria 8794220
549 8016628472 8016622563 Bacteria 7999408
550 8016632675 8016630954 Bacteria 9217207
551 8017061250 8017057580 Bacteria 10023680
552 8019543299 8019538911 Bacteria 7872763
553 Ga0373936_0188827
554 JGI25153J46596_10030040
555 JGI25153J46596_10032577
556 Ga0055531_10001716
557 Ga0055543_1015196
558 Ga0065165_1001991
559 Ga0065165_1008464
560 Ga0065165_1030881
561 Ga0070690_100206311
562 Ga0070670_100553329
563 Ga0070666_10435477
564 Ga0068868_101726820
565 Ga0070668_100249607
566 Ga0070668_100390880
567 Ga0070671_100075534
568 Ga0070674_100892369
569 Ga0070688_100376914
570 Ga0070667_101346602
571 Ga0070709_10001804
572 Ga0070709_10390692
573 Ga0070714_100004239
574 Ga0070714_100323934
575 Ga0070714_100511801
576 Ga0070713_100001873
577 Ga0070713_100003091
578 Ga0070713_100498574
579 Ga0070713_101073047
580 Ga0070713_101291858
581 Ga0070710_10002237
582 Ga0070711_100148889
583 Ga0070708_100477146
584 Ga0070663_100664537
585 Ga0070663_101003683
586 Ga0070678_100112374
587 Ga0070662_100494448
588 Ga0070685_10667678
589 Ga0070684_101410864
590 Ga0068853_100206447
591 Ga0068853_100423537
592 Ga0070672_100447807
593 Ga0070693_100355711
594 Ga0070665_100182342
595 Ga0070665_101324313
596 Ga0068855_100426740
597 Ga0068854_100497075
598 Ga0068854_101628604
599 Ga0068856_100012484
600 Ga0068852_100189975
601 Ga0068859_101058739
602 Ga0068864_100305374
603 Ga0068870_10402626
604 Ga0068863_100198011
605 Ga0068858_100189852
606 Ga0068858_100327974
607 Ga0068860_100609515
608 Ga0081540_1041995
609 Ga0070717_10258744
610 Ga0070717_10292421
611 Ga0075368_10079708
612 Ga0075363_100400471
613 Ga0075364_10365710
614 Ga0070715_10057370
615 Ga0070716_100697879
616 Ga0070716_100811737
617 Ga0070712_100075681
618 Ga0070712_100264919
619 Ga0075362_10081218
620 Ga0075362_10630778
621 Ga0075367_10228497
622 Ga0075369_10025162
623 Ga0075369_10064590
624 Ga0075366_10143830
625 Ga0097621_100163883
626 Ga0097621_100518583
627 Ga0075370_10058068
628 Ga0075428_100590312
629 Ga0075434_100259158
630 Ga0068865_100384979
631 Ga0097620_101058793
632 Ga0099825_1040687
633 Ga0099824_1033810
634 Ga0099823_1030377
635 Ga0099794_10065042
636 Ga0099795_10017803
637 Ga0099795_10018057
638 Ga0105240_10309751
639 Ga0105245_10195722
640 Ga0105245_11226826
641 Ga0105247_10133823
642 Ga0114129_10154361
643 Ga0105241_10245782
644 Ga0105242_10590211
645 Ga0105242_10740726
646 Ga0105242_11543975
647 Ga0105237_10076613
648 Ga0105237_10149952
649 Ga0105237_10507180
650 Ga0105238_11311797
651 Ga0105249_10650525
652 Ga0099796_10177033
653 Ga0099796_10263217
654 Ga0105239_10064607
655 Ga0105239_11048029
656 Ga0105239_11494065
657 Ga0105246_10049364
658 Ga0105246_10091399
659 Ga0157378_10329884
660 Ga0157375_10226472
661 Ga0157375_10280790
662 Ga0157375_11567581
663 Ga0163163_10251842
664 Ga0163163_10478674
665 Ga0163163_10586329
666 Ga0157379_10036408
667 Ga0157379_10477261
668 Ga0157379_10493781
669 Ga0163161_10230551
670 Ga0163161_10343469
671 Ga0207425_1025026
672 Ga0209130_1054642
673 Ga0209564_1025748
674 Ga0209758_1010732
675 Ga0209758_1012556
676 Ga0209758_1025865
677 Ga0209256_1041979
678 Ga0207426_1004182
679 Ga0207426_1059293
680 Ga0209257_1001136
681 Ga0207697_10088489
682 Ga0207692_10480151
683 Ga0207692_10508969
684 Ga0207642_10051502
685 Ga0207710_10105179
686 Ga0207647_10133536
687 Ga0207699_10281957
688 Ga0207699_10335990
689 Ga0207654_10050319
690 Ga0207654_10166170
691 Ga0207695_10000029
692 Ga0207695_10187477
693 Ga0207671_10060973
694 Ga0207693_10052293
695 Ga0207663_10000136
696 Ga0207681_10462144
697 Ga0207694_10278408
698 Ga0207694_10440490
699 Ga0207650_10089112
700 Ga0207687_10271318
701 Ga0207700_10138666
702 Ga0207700_10233826
703 Ga0207700_10335420
704 Ga0207644_10216473
705 Ga0207644_10460867
706 Ga0207690_10727954
707 Ga0207686_10285418
708 Ga0207669_10335775
709 Ga0207669_10385414
710 Ga0207704_10201730
711 Ga0207665_10004646
712 Ga0207665_10100884
713 Ga0207665_10138009
714 Ga0207665_10373783
715 Ga0207691_10232046
716 Ga0207711_10311307
717 Ga0207711_10327566
718 Ga0207667_10121728
719 Ga0207712_10958760
720 Ga0207668_10215096
721 Ga0207668_10275270
722 Ga0207668_10746113
723 Ga0207640_10907566
724 Ga0207677_10563913
725 Ga0207703_10280494
726 Ga0207703_10478660
727 Ga0207639_10614539
728 Ga0207639_10673819
729 Ga0207678_10513211
730 Ga0207702_10001399
731 Ga0207702_10608666
732 Ga0207641_10399253
733 Ga0207648_10223190
734 Ga0207648_10464187
735 Ga0207676_10561396
736 Ga0207674_10887002
737 Ga0207683_10151574
738 Ga0207698_10364708
739 Ga0209389_1000011
740 Ga0209489_100017
741 Ga0209700_100027
742 Ga0209179_1016188
743 Ga0209179_1102764
744 Ga0209588_1002888
745 Ga0209813_10014113
746 Ga0268266_10113555
747 Ga0268264_10515788
748 Ga0268264_10720110
749 Ga0265330_10015287
750 Ga0265330_10075388
751 Ga0265330_10081498
752 Ga0265332_10081821
753 Ga0265340_10016560
754 Ga0265339_10078105
755 Ga0265316_10365415
756 Ga0307513_10449520
757 Ga0307508_10596153
758 Ga0265314_10013390
759 Ga0265314_10014628
760 Ga0265342_10140150
761 Ga0307516_10033572
762 Ga0307516_10112310
763 Ga0307405_10597814
764 Ga0307510_10263086
765 Ga0373928_0024742
766 Ga0373934_0011218
767 Ga0373934_0103433
768 Ga0373940_0144420
769 Ga0373949_0039383
770 Ga0373936_0023865
771 Ga0373936_0138462
772 Ga0373953_0000494
773 Ga0373954_0000167
774 Ga0373954_0176137
775 Ga0373956_0002737
776 Ga0373957_0004886
777 Ga0373960_0086117
778 Ga0373943_0387282
779 Ga0373946_0006525
780 Ga0373955_0000360
781 Ga0373955_0034564
782 Ga0373924_0042255
783 Ga0373931_0179007
784 Ga0373935_0008649
785 Ga0373935_0298155
786 Ga0373927_0000950
787 Ga0373927_0155185
788 Ga0373933_0000466
789 Ga0373933_0003487
790 Ga0373933_0040997
791 Ga0373933_0825857
792 Ga0373947_0011645
793 Ga0373947_0060196
794 Ga0373947_0165386
795 Ga0373937_0020598
796 Ga0373937_0061819
797 Ga0373937_0140517
798 Ga0373937_0635410
799 Ga0373937_1036351
800 Ga0373925_0003061
801 Ga0373925_0674466
802 Ga0436364_0327422
803 Ga0436364_1420365
804 Ga0436365_0306522
805 Ga0451789_0142457
806 Ga0451800_1484367
807 Ga0451833_1262002
808 Ga0466969_0392498
809 Ga0466957_0625627
810 Ga0466959_0035792
811 Ga0495592_0001833
812 Ga0495592_0085284
813 Ga0495592_0090539
814 Ga0495603_0000200
815 Ga0495629_0002535
816 Ga0495629_0002997
817 Ga0495638_0023071
818 Ga0495641_0092595
819 Ga0495651_0015886
820 Ga0495651_0279799
821 Ga0495653_0001070
822 Ga0495653_0117135
823 Ga0495653_0677544
824 Ga0495580_0002104
825 Ga0495582_0000354
826 Ga0495582_0677757
827 Ga0495639_0002381
828 Ga0495662_0039645
829 Ga0495662_0325962
830 Ga0495664_0075336
831 Ga0495664_0232146
832 Ga0495664_0480287
833 Ga0495584_0516212
834 Ga0495594_0001396
835 Ga0495596_0139828
836 Ga0495606_0151755
837 Ga0495606_0343178
838 Ga0495608_0000832
839 Ga0495608_0139350
840 Ga0495608_0268501
841 Ga0495620_0107584
842 Ga0495628_0008405
843 Ga0495628_0039155
844 Ga0495628_0068962
845 Ga0495630_0002803
846 Ga0495630_0493069
847 Ga0495630_0546032
848 Ga0495643_0037656
849 Ga0495643_0209215
850 Ga0495648_0124441
851 Ga0495648_0331313
852 Ga0495666_0152899
853 Ga0495652_0015589
854 Ga0495652_0161659
855 Ga0495652_0420811
856 Ga0495665_0004666
857 Ga0495640_0022977
858 Ga0495586_0049210
859 Ga0495586_0258052
860 Ga0495587_0005941
861 Ga0495587_0154600
862 Ga0495609_0070720
863 Ga0495597_0043832
864 Ga0495645_0005396
865 Ga0495645_0051699
866 Ga0495645_0505164
867 Ga0495622_0003765
868 Ga0495622_0117728
869 Ga0495667_0125601
870 Ga0495668_0148140
871 Ga0495634_0011838
872 Ga0495634_0055818
873 Ga0495625_0292875
874 Ga0495625_0318269
875 Ga0495635_0003204
876 Ga0495635_0006430
877 Ga0495635_0300525
878 Ga0495635_0685577
879 Ga0495661_0488079
880 Ga0495588_0313556
881 Ga0495657_0005689
882 Ga0495657_0214203
883 Ga0495599_0002898
884 Ga0495599_0073213
885 Ga0495623_0025661
886 Ga0495623_0141123
887 Ga0495623_0233795
888 Ga0495646_0001327
889 Ga0495646_0059525
890 Ga0495646_0254158
891 Ga0495646_0397423
892 Ga0495647_0001121
893 Ga0495647_0475067
894 Ga0495658_0000888
895 Ga0495669_0444676
896 Ga0495613_0004930
897 Ga0495624_0002275
898 Ga0495600_0014514
899 Ga0495660_0117856
900 Ga0495581_0009639
901 Ga0495581_0044944
902 Ga0495604_0020020
903 Ga0495604_0027661
904 Ga0495604_0227207
905 Ga0495604_0411623
906 Ga0495674_0000559
907 Ga0495674_0041720
908 Ga0495674_0062834
909 Ga0495674_0655768
910 Ga0495672_0152778
911 Ga0495676_0135802
912 Ga0495676_0666780
913 Ga0495680_0020249
914 Ga0495687_020378
915 Ga0495675_0001411
916 Ga0495675_0007287
917 Ga0495673_0121718
918 Ga0495673_0130430
919 Ga0495673_0148471
920 Ga0495684_0001116
921 Ga0495684_0209586
922 Ga0495684_0280987
923 Ga0495686_0735785
924 Ga0495593_0000606
925 Ga0495593_0000677
926 Ga0495602_0010527
927 Ga0495602_0010571
928 Ga0495602_0245038
929 Ga0495614_0105764
930 Ga0495626_0078025
931 Ga0496100_0848518
932 Ga0496101_0049025
933 Ga0496102_0174710
934 Ga0496102_0187333
935 Ga0496102_0221199
936 Ga0496103_0064706
937 Ga0496103_0552925
938 Ga0496103_0993203
939 Ga0496104_0091806
940 Ga0496104_0108459
941 Ga0496104_0122986
942 Ga0496104_0162280
943 Ga0496104_0496626
944 Ga0496105_0059069
945 Ga0496105_0061372
946 Ga0496105_0178862
947 Ga0496105_0302885
948 Ga0496106_0040173
949 Ga0496106_0084444
950 Ga0496106_1064104
951 Ga0496107_0256137
952 Ga0496107_0310840
953 Ga0496108_0038596
954 Ga0496108_0172396
955 Ga0496108_0614999
956 Ga0496109_0009711
957 Ga0496109_0180376
958 Ga0496109_0237910
959 Ga0496109_0719513
960 Ga0496110_0225898
961 Ga0496110_0233398
962 Ga0496110_0373697
963 Ga0496111_0464169
964 Ga0496112_0024105
965 Ga0496112_0042468
966 Ga0496112_0046597
967 Ga0496112_0133086
968 Ga0496112_0444565
969 Ga0496113_0048147
970 Ga0496114_0043118
971 Ga0496114_0075699
972 Ga0496114_0293453
973 Ga0496114_0334013
974 Ga0496115_0046271
975 Ga0496115_0167222
976 Ga0496115_0261406
977 Ga0496115_0380903
978 Ga0496115_0826458
979 Ga0496115_1000018
980 Ga0496116_0049604
981 Ga0496116_0189907
982 Ga0496117_0198615
983 Ga0496118_0078380
984 Ga0496118_0090341
985 Ga0496118_0224738
986 Ga0496118_0289505
987 Ga0496119_0156744
988 Ga0496121_0045180
989 Ga0496121_0216324
990 Ga0496121_0448356
991 Ga0496122_0194135
992 Ga0496123_0146490
993 Ga0496124_0265346
994 Ga0496125_0035659
995 Ga0496126_0021474
996 Ga0496126_0043062
997 Ga0496126_0048455
998 Ga0496126_0174550
999 Ga0496126_0345378
1000 Ga0496126_0610275
1001 nmdc:mga00v17_350984_c1
1002 nmdc:mga0yw44_197877_c1
1003 nmdc:mga0k408_37704_c1
1004 nmdc:mga0k408_633930_c1
1005 nmdc:mga04h51_4945_c1
1006 nmdc:mga07m45_220343_c1
1007 nmdc:mga08y16_641202_c1
1008 Ga0495601_0070661
1009 Ga0495601_0109356
1010 Ga0495601_0187025
1011 Ga0495601_0197784
1012 Ga0495612_0081519
1013 Ga0495612_0180177
1014 Ga0495619_0000966
1015 Ga0500647_0068955
1016 Ga0500556_0232549
1017 Ga0500557_000039
1018 Ga0500562_003302
1019 Ga0500569_074175
1020 Ga0500618_073487
1021 Ga0500642_0004438
1022 Ga0500642_0047884
1023 Ga0500559_0116307
1024 Ga0500604_0029049
1025 Ga0500622_0006086
1026 Ga0500636_0031124
1027 Ga0500636_0331330
1028 Ga0500637_0196283
1029 Ga0500599_005947
1030 2508697942
1031 2513643833
1032 2513697028
1033 2513702068
1034 2514012675
1035 2528849690
1036 2617352548
1037 2643756448
1038 2818241681
1039 2824674437
1040 2824687575
1041 2824692373
1042 2824778184
1043 2838127436
1044 2841941611
1045 2841952372
1046 2841959395
1047 2841967756
1048 2841982080
1049 2841986397
1050 2842038165
1051 2842048889
1052 2849080775
1053 2874623128
1054 2874636133
1055 2876766770
1056 2879107646
1057 2885391209
1058 2888382368
1059 2904669948
1060 2922362283
1061 2922394893
1062 2932787004
1063 2932811206
1064 2932819920
1065 2932832406
1066 2935619110
1067 2935643071
1068 2935669698
1069 2935677161
1070 2935693197
1071 2935695309
1072 2935719805
1073 2935729428
1074 2935739688
1075 2935748726
1076 2935756687
1077 2935761329
1078 2935779088
1079 2935807220
1080 2935812352
1081 2935832784
1082 2935839134
1083 2935857475
1084 2935884886
1085 2935987770
1086 2935999603
1087 2936038945
1088 2940562601
1089 2941539824
1090 8006995592
1091 8016515208
1092 8016522989
1093 8016540729
1094 8016552513
1095 8016560894
1096 8016574812
1097 8016578886
1098 8016598763
1099 8016612318
1100 8016621488
1101 8016628472
1102 8016632675
1103 8017061250
1104 8019543299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11937

DUF3455

Protein of unknown function (DUF3455)

47

181

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k21-assembly1.cif.gz_A pyocyanin demethylase 0.4854 36 158
5k21-assembly1.cif.gz_A pyocyanin demethylase 0.471 36 158
4iho-assembly1.cif.gz_A crystal structure of h-2db y159f in complex with chimeric gp100 0.4483 37 87
6ugl-assembly1.cif.gz_A vqma bound to dpo 0.4098 36 78
4iho-assembly2.cif.gz_D crystal structure of h-2db y159f in complex with chimeric gp100 0.4071 37 85
ID Description Score Start End Superfamily
af_I1KHR7_28_195_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.651 42 72 3.30.450.40
af_Q2G1Z8_409_554_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.5228 45 78 3.30.420.10
af_Q4DE76_18_209_3.10.20.550 Alpha Beta;Roll;Ubiquitin-like (UB roll);ASAP complex, SAP18 subunit 0.4882 36 79 3.10.20.550
af_A0A0R0G5G3_704_777_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.4583 45 79 3.30.160.20
af_I1LHG3_113_220_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4238 31 119 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2V5LJ75-F1-model_v4 DUF3455 domain-containing protein 0.9644 33 164
AF-A0A7Y8DI63-F1-model_v4 DUF3455 domain-containing protein 0.9629 22 163
AF-A0A367PM43-F1-model_v4 DUF3455 domain-containing protein 0.9588 38 162
AF-K7SG47-F1-model_v4 deleted 0.9569 36 163
AF-A0A1I7E3Q6-F1-model_v4 DUF3455 domain-containing protein 0.9539 36 160

Map