F462694
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 552 | 244 | 551 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100058532|Ga0070714_1000585322 |
| Length | 149 |
| Sequence | MSIEAQEASRQEQLAQVNPDEQEVAAGREREQLEGWIPEMASEADVREALEKAFDYRGDITITRKDGSKVEGYVFDRRNGRSLDDSYVRVIPSGQQRTKLTVPYAEIAALAFTGRDTAAGKTFEAWVKKYWEKKAAGETNIQIEPEKLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 81 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 82 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 123 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 124 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 130 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 131 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 133 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 134 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 139 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 141 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 147 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 148 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 149 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 150 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 211 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 212 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 220 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 243 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 244 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.83 |
| Metatranscriptomes | 1.99 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.72 |
| Nodule | 0 |
| Rhizoplane | 3.8 |
| Rhizosphere | 94.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10014514 | 3300005327 | Bacteria | 6322 |
| 2 | Ga0070658_10025306 | 3300005327 | Bacteria | 4759 |
| 3 | Ga0070658_10071080 | 3300005327 | Bacteria | 2850 |
| 4 | Ga0070658_10796204 | 3300005327 | Unclassified | 821 |
| 5 | Ga0070683_100015441 | 3300005329 | Bacteria | 6708 |
| 6 | Ga0070683_100170919 | 3300005329 | Bacteria | 2063 |
| 7 | Ga0070683_100321822 | 3300005329 | Bacteria | 1472 |
| 8 | Ga0070683_101349983 | 3300005329 | Unclassified | 685 |
| 9 | Ga0070666_10483981 | 3300005335 | Bacteria | 896 |
| 10 | Ga0070680_100189811 | 3300005336 | Bacteria | 1731 |
| 11 | Ga0070680_100562203 | 3300005336 | Bacteria | 978 |
| 12 | Ga0070680_101128741 | 3300005336 | Bacteria | 677 |
| 13 | Ga0070682_100929107 | 3300005337 | Bacteria | 717 |
| 14 | Ga0070660_100069635 | 3300005339 | Bacteria | 2744 |
| 15 | Ga0070660_100141584 | 3300005339 | Bacteria | 1930 |
| 16 | Ga0070692_10743060 | 3300005345 | Bacteria | 664 |
| 17 | Ga0070671_100082244 | 3300005355 | Bacteria | 2692 |
| 18 | Ga0070673_100357127 | 3300005364 | Bacteria | 1298 |
| 19 | Ga0070659_101553339 | 3300005366 | Unclassified | 590 |
| 20 | Ga0070709_10606208 | 3300005434 | Unclassified | 843 |
| 21 | Ga0070709_11159941 | 3300005434 | Bacteria | 620 |
| 22 | Ga0070714_100058532 | 3300005435 | Bacteria | 3301 |
| 23 | Ga0070714_100115097 | 3300005435 | Bacteria | 2386 |
| 24 | Ga0070714_100587806 | 3300005435 | Bacteria | 1068 |
| 25 | Ga0070714_100985186 | 3300005435 | Unclassified | 820 |
| 26 | Ga0070713_100007913 | 3300005436 | Bacteria | 7504 |
| 27 | Ga0070713_100016290 | 3300005436 | Bacteria | 5588 |
| 28 | Ga0070713_100021870 | 3300005436 | Bacteria | 4930 |
| 29 | Ga0070713_100117512 | 3300005436 | Bacteria | 2327 |
| 30 | Ga0070713_100167558 | 3300005436 | Bacteria | 1965 |
| 31 | Ga0070713_100477364 | 3300005436 | Bacteria | 1174 |
| 32 | Ga0070713_101087825 | 3300005436 | Bacteria | 772 |
| 33 | Ga0070713_101900074 | 3300005436 | Unclassified | 578 |
| 34 | Ga0070710_10015469 | 3300005437 | Bacteria | 3864 |
| 35 | Ga0070710_10213308 | 3300005437 | Bacteria | 1225 |
| 36 | Ga0070710_10669067 | 3300005437 | Unclassified | 730 |
| 37 | Ga0070710_11340319 | 3300005437 | Bacteria | 533 |
| 38 | Ga0070711_100178493 | 3300005439 | Bacteria | 1624 |
| 39 | Ga0070711_100333615 | 3300005439 | Bacteria | 1215 |
| 40 | Ga0070711_100352284 | 3300005439 | Bacteria | 1184 |
| 41 | Ga0070711_100905932 | 3300005439 | Unclassified | 753 |
| 42 | Ga0070678_100063876 | 3300005456 | Bacteria | 2726 |
| 43 | Ga0070678_100411302 | 3300005456 | Unclassified | 1177 |
| 44 | Ga0070681_10025159 | 3300005458 | Bacteria | 5990 |
| 45 | Ga0070681_10059397 | 3300005458 | Bacteria | 3804 |
| 46 | Ga0070681_10072842 | 3300005458 | Bacteria | 3397 |
| 47 | Ga0070681_10075854 | 3300005458 | Bacteria | 3322 |
| 48 | Ga0070681_10242035 | 3300005458 | Bacteria | 1718 |
| 49 | Ga0070706_100934373 | 3300005467 | Unclassified | 801 |
| 50 | Ga0070707_100754997 | 3300005468 | Unclassified | 936 |
| 51 | Ga0070699_100212854 | 3300005518 | Bacteria | 1721 |
| 52 | Ga0070699_100527762 | 3300005518 | Bacteria | 1074 |
| 53 | Ga0070679_100108298 | 3300005530 | Bacteria | 2765 |
| 54 | Ga0070679_100202821 | 3300005530 | Bacteria | 1948 |
| 55 | Ga0070679_100919151 | 3300005530 | Bacteria | 819 |
| 56 | Ga0070679_101294282 | 3300005530 | Unclassified | 675 |
| 57 | Ga0070684_100028447 | 3300005535 | Bacteria | 4728 |
| 58 | Ga0070684_100485507 | 3300005535 | Bacteria | 1144 |
| 59 | Ga0070684_102239044 | 3300005535 | Bacteria | 515 |
| 60 | Ga0068853_100026875 | 3300005539 | Bacteria | 4835 |
| 61 | Ga0068853_100027051 | 3300005539 | Bacteria | 4819 |
| 62 | Ga0068853_100034787 | 3300005539 | Bacteria | 4277 |
| 63 | Ga0068853_100906484 | 3300005539 | Bacteria | 847 |
| 64 | Ga0070672_100353336 | 3300005543 | Bacteria | 1253 |
| 65 | Ga0070693_100290227 | 3300005547 | Bacteria | 1099 |
| 66 | Ga0070665_100019136 | 3300005548 | Bacteria | 6870 |
| 67 | Ga0070665_100039408 | 3300005548 | Bacteria | 4751 |
| 68 | Ga0070665_100253004 | 3300005548 | Bacteria | 1762 |
| 69 | Ga0070665_100253295 | 3300005548 | Bacteria | 1761 |
| 70 | Ga0070665_101128039 | 3300005548 | Bacteria | 795 |
| 71 | Ga0068855_100006829 | 3300005563 | Bacteria | 13845 |
| 72 | Ga0068855_100015930 | 3300005563 | Bacteria | 9044 |
| 73 | Ga0068855_100045695 | 3300005563 | Bacteria | 5179 |
| 74 | Ga0068855_100169211 | 3300005563 | Bacteria | 2475 |
| 75 | Ga0068855_100335613 | 3300005563 | Bacteria | 1668 |
| 76 | Ga0068855_100762172 | 3300005563 | Bacteria | 1031 |
| 77 | Ga0068855_101801654 | 3300005563 | Bacteria | 622 |
| 78 | Ga0068855_102493919 | 3300005563 | Bacteria | 515 |
| 79 | Ga0070664_100087128 | 3300005564 | Bacteria | 2699 |
| 80 | Ga0070664_100638767 | 3300005564 | Bacteria | 989 |
| 81 | Ga0068857_100376677 | 3300005577 | Bacteria | 1317 |
| 82 | Ga0068857_101768012 | 3300005577 | Bacteria | 605 |
| 83 | Ga0068854_100130141 | 3300005578 | Bacteria | 1921 |
| 84 | Ga0068854_101354883 | 3300005578 | Bacteria | 642 |
| 85 | Ga0068854_101626006 | 3300005578 | Unclassified | 589 |
| 86 | Ga0068856_100217978 | 3300005614 | Bacteria | 1923 |
| 87 | Ga0068856_100487536 | 3300005614 | Bacteria | 1254 |
| 88 | Ga0068856_101023643 | 3300005614 | Bacteria | 844 |
| 89 | Ga0068856_101897836 | 3300005614 | Unclassified | 607 |
| 90 | Ga0068852_100017759 | 3300005616 | Bacteria | 5589 |
| 91 | Ga0068852_100018634 | 3300005616 | Bacteria | 5471 |
| 92 | Ga0068852_100220919 | 3300005616 | Bacteria | 1802 |
| 93 | Ga0068852_100288887 | 3300005616 | Bacteria | 1583 |
| 94 | Ga0068852_100646669 | 3300005616 | Unclassified | 1064 |
| 95 | Ga0068852_100735929 | 3300005616 | Bacteria | 998 |
| 96 | Ga0068852_100742037 | 3300005616 | Bacteria | 994 |
| 97 | Ga0068852_100917260 | 3300005616 | Bacteria | 893 |
| 98 | Ga0068852_101549171 | 3300005616 | Bacteria | 685 |
| 99 | Ga0068852_102318194 | 3300005616 | Bacteria | 558 |
| 100 | Ga0068864_100133266 | 3300005618 | Bacteria | 2235 |
| 101 | Ga0068851_10271645 | 3300005834 | Bacteria | 967 |
| 102 | Ga0068863_100098039 | 3300005841 | Bacteria | 2784 |
| 103 | Ga0068858_100071940 | 3300005842 | Bacteria | 3208 |
| 104 | Ga0068858_100156242 | 3300005842 | Bacteria | 2146 |
| 105 | Ga0068862_101053830 | 3300005844 | Bacteria | 806 |
| 106 | Ga0070717_10008710 | 3300006028 | Bacteria | 7591 |
| 107 | Ga0070717_10036116 | 3300006028 | Bacteria | 4005 |
| 108 | Ga0070717_10044242 | 3300006028 | Bacteria | 3635 |
| 109 | Ga0070717_10098596 | 3300006028 | Bacteria | 2477 |
| 110 | Ga0070717_10125800 | 3300006028 | Bacteria | 2201 |
| 111 | Ga0070717_10131082 | 3300006028 | Unclassified | 2156 |
| 112 | Ga0070717_10188056 | 3300006028 | Bacteria | 1803 |
| 113 | Ga0070717_10274444 | 3300006028 | Unclassified | 1494 |
| 114 | Ga0070715_10251404 | 3300006163 | Unclassified | 924 |
| 115 | Ga0070715_10516676 | 3300006163 | Bacteria | 686 |
| 116 | Ga0070715_10517877 | 3300006163 | Bacteria | 686 |
| 117 | Ga0070716_100091591 | 3300006173 | Bacteria | 1841 |
| 118 | Ga0070712_100153647 | 3300006175 | Bacteria | 1770 |
| 119 | Ga0070712_100298334 | 3300006175 | Bacteria | 1303 |
| 120 | Ga0070712_100629585 | 3300006175 | Bacteria | 910 |
| 121 | Ga0097621_101002836 | 3300006237 | Unclassified | 781 |
| 122 | Ga0075434_100223189 | 3300006871 | Bacteria | 1904 |
| 123 | Ga0075436_100285667 | 3300006914 | Bacteria | 1180 |
| 124 | Ga0105240_10000648 | 3300009093 | Bacteria | 64281 |
| 125 | Ga0105240_10053944 | 3300009093 | Bacteria | 5041 |
| 126 | Ga0105240_10179932 | 3300009093 | Bacteria | 2496 |
| 127 | Ga0105240_10352994 | 3300009093 | Bacteria | 1668 |
| 128 | Ga0105240_10831422 | 3300009093 | Unclassified | 998 |
| 129 | Ga0105240_10880038 | 3300009093 | Bacteria | 965 |
| 130 | Ga0105240_11328501 | 3300009093 | Bacteria | 758 |
| 131 | Ga0105240_11353663 | 3300009093 | Unclassified | 749 |
| 132 | Ga0105245_10076381 | 3300009098 | Bacteria | 3051 |
| 133 | Ga0105247_10572667 | 3300009101 | Bacteria | 833 |
| 134 | Ga0105241_10158769 | 3300009174 | Bacteria | 1857 |
| 135 | Ga0105241_10436862 | 3300009174 | Bacteria | 1155 |
| 136 | Ga0105241_10662275 | 3300009174 | Bacteria | 949 |
| 137 | Ga0105241_10868752 | 3300009174 | Bacteria | 835 |
| 138 | Ga0105241_11340367 | 3300009174 | Unclassified | 683 |
| 139 | Ga0105242_10048107 | 3300009176 | Bacteria | 3465 |
| 140 | Ga0105248_10020720 | 3300009177 | Bacteria | 7285 |
| 141 | Ga0105248_10111934 | 3300009177 | Bacteria | 3079 |
| 142 | Ga0105248_10909507 | 3300009177 | Unclassified | 994 |
| 143 | Ga0105248_11005751 | 3300009177 | Bacteria | 942 |
| 144 | Ga0105237_10535473 | 3300009545 | Bacteria | 1178 |
| 145 | Ga0105238_10017249 | 3300009551 | Bacteria | 7335 |
| 146 | Ga0105238_10020194 | 3300009551 | Bacteria | 6781 |
| 147 | Ga0105238_10040781 | 3300009551 | Bacteria | 4703 |
| 148 | Ga0105238_10217164 | 3300009551 | Bacteria | 1888 |
| 149 | Ga0105238_10293852 | 3300009551 | Bacteria | 1607 |
| 150 | Ga0105238_10503174 | 3300009551 | Unclassified | 1213 |
| 151 | Ga0105238_10583747 | 3300009551 | Bacteria | 1124 |
| 152 | Ga0105238_10634819 | 3300009551 | Bacteria | 1077 |
| 153 | Ga0105238_11857736 | 3300009551 | Bacteria | 635 |
| 154 | Ga0105249_10056030 | 3300009553 | Bacteria | 3609 |
| 155 | Ga0099796_10029684 | 3300010159 | Bacteria | 1767 |
| 156 | Ga0099796_10054408 | 3300010159 | Unclassified | 1399 |
| 157 | Ga0099796_10151068 | 3300010159 | Unclassified | 914 |
| 158 | Ga0105239_10545360 | 3300010375 | Bacteria | 1320 |
| 159 | Ga0105239_11082445 | 3300010375 | Unclassified | 922 |
| 160 | Ga0105239_11154712 | 3300010375 | Bacteria | 892 |
| 161 | Ga0105239_11207379 | 3300010375 | Unclassified | 872 |
| 162 | Ga0105239_13279215 | 3300010375 | Unclassified | 527 |
| 163 | Ga0157373_10053933 | 3300013100 | Bacteria | 2858 |
| 164 | Ga0157371_10126492 | 3300013102 | Bacteria | 1818 |
| 165 | Ga0157371_10161609 | 3300013102 | Bacteria | 1600 |
| 166 | Ga0157370_10019731 | 3300013104 | Bacteria | 6748 |
| 167 | Ga0157370_10055021 | 3300013104 | Bacteria | 3793 |
| 168 | Ga0157370_10078401 | 3300013104 | Bacteria | 3111 |
| 169 | Ga0157370_10254674 | 3300013104 | Bacteria | 1623 |
| 170 | Ga0157370_10290357 | 3300013104 | Bacteria | 1510 |
| 171 | Ga0157369_10015156 | 3300013105 | Bacteria | 8701 |
| 172 | Ga0157369_10033391 | 3300013105 | Bacteria | 5655 |
| 173 | Ga0157369_10070093 | 3300013105 | Bacteria | 3766 |
| 174 | Ga0157369_10116220 | 3300013105 | Bacteria | 2841 |
| 175 | Ga0157369_10202247 | 3300013105 | Bacteria | 2084 |
| 176 | Ga0157369_10238339 | 3300013105 | Bacteria | 1900 |
| 177 | Ga0157369_10318466 | 3300013105 | Bacteria | 1617 |
| 178 | Ga0157369_10511880 | 3300013105 | Bacteria | 1242 |
| 179 | Ga0157369_10794403 | 3300013105 | Bacteria | 972 |
| 180 | Ga0157369_10889976 | 3300013105 | Bacteria | 913 |
| 181 | Ga0157369_10908100 | 3300013105 | Bacteria | 903 |
| 182 | Ga0157374_10137904 | 3300013296 | Bacteria | 2366 |
| 183 | Ga0157374_10162701 | 3300013296 | Bacteria | 2174 |
| 184 | Ga0157374_10246554 | 3300013296 | Bacteria | 1757 |
| 185 | Ga0157374_10587645 | 3300013296 | Bacteria | 1123 |
| 186 | Ga0157374_10598141 | 3300013296 | Bacteria | 1113 |
| 187 | Ga0157374_11572506 | 3300013296 | Bacteria | 681 |
| 188 | Ga0163162_10003188 | 3300013306 | Bacteria | 15682 |
| 189 | Ga0163162_10164268 | 3300013306 | Bacteria | 2344 |
| 190 | Ga0163162_10372895 | 3300013306 | Bacteria | 1560 |
| 191 | Ga0163162_10616507 | 3300013306 | Bacteria | 1210 |
| 192 | Ga0157372_10046392 | 3300013307 | Bacteria | 4823 |
| 193 | Ga0157372_10062187 | 3300013307 | Bacteria | 4182 |
| 194 | Ga0157372_10078978 | 3300013307 | Bacteria | 3720 |
| 195 | Ga0157372_10186141 | 3300013307 | Bacteria | 2405 |
| 196 | Ga0157372_10256629 | 3300013307 | Bacteria | 2029 |
| 197 | Ga0157372_10318396 | 3300013307 | Bacteria | 1811 |
| 198 | Ga0157372_10387656 | 3300013307 | Bacteria | 1628 |
| 199 | Ga0157375_10860920 | 3300013308 | Bacteria | 1052 |
| 200 | Ga0163163_10777778 | 3300014325 | Bacteria | 1021 |
| 201 | Ga0182008_10658141 | 3300014497 | Unclassified | 594 |
| 202 | Ga0157379_10057230 | 3300014968 | Bacteria | 3484 |
| 203 | Ga0157379_10104554 | 3300014968 | Bacteria | 2541 |
| 204 | Ga0157376_10032731 | 3300014969 | Bacteria | 4177 |
| 205 | Ga0157376_10107552 | 3300014969 | Bacteria | 2449 |
| 206 | Ga0157376_10247252 | 3300014969 | Bacteria | 1664 |
| 207 | Ga0157376_10393800 | 3300014969 | Bacteria | 1338 |
| 208 | Ga0182007_10068098 | 3300015262 | Unclassified | 1166 |
| 209 | Ga0197907_10327289 | 3300020069 | Bacteria | 594 |
| 210 | Ga0197907_10726330 | 3300020069 | Bacteria | 2103 |
| 211 | Ga0206356_10955734 | 3300020070 | Bacteria | 2115 |
| 212 | Ga0206349_1929961 | 3300020075 | Bacteria | 1223 |
| 213 | Ga0206351_10082539 | 3300020077 | Bacteria | 3179 |
| 214 | Ga0206352_11306157 | 3300020078 | Bacteria | 1925 |
| 215 | Ga0206350_11455148 | 3300020080 | Bacteria | 3114 |
| 216 | Ga0206354_10894720 | 3300020081 | Bacteria | 1403 |
| 217 | Ga0154015_1576844 | 3300020610 | Bacteria | 2673 |
| 218 | Ga0213872_10002855 | 3300021361 | Bacteria | 9870 |
| 219 | Ga0213872_10017431 | 3300021361 | Bacteria | 3319 |
| 220 | Ga0213876_10409092 | 3300021384 | Unclassified | 722 |
| 221 | Ga0213875_10022515 | 3300021388 | Bacteria | 3013 |
| 222 | Ga0213871_10000715 | 3300021441 | Bacteria | 4863 |
| 223 | Ga0213871_10002116 | 3300021441 | Bacteria | 3580 |
| 224 | Ga0224712_10214358 | 3300022467 | Bacteria | 879 |
| 225 | Ga0224712_10247017 | 3300022467 | Bacteria | 823 |
| 226 | Ga0207692_10302885 | 3300025898 | Bacteria | 973 |
| 227 | Ga0207692_10386411 | 3300025898 | Unclassified | 870 |
| 228 | Ga0207692_10415514 | 3300025898 | Bacteria | 841 |
| 229 | Ga0207692_10899043 | 3300025898 | Unclassified | 582 |
| 230 | Ga0207710_10572372 | 3300025900 | Bacteria | 589 |
| 231 | Ga0207699_10082386 | 3300025906 | Bacteria | 1998 |
| 232 | Ga0207699_10260867 | 3300025906 | Bacteria | 1198 |
| 233 | Ga0207705_10004549 | 3300025909 | Bacteria | 10470 |
| 234 | Ga0207705_10028162 | 3300025909 | Bacteria | 4006 |
| 235 | Ga0207705_10036049 | 3300025909 | Bacteria | 3540 |
| 236 | Ga0207705_10434522 | 3300025909 | Bacteria | 1017 |
| 237 | Ga0207654_11116162 | 3300025911 | Unclassified | 574 |
| 238 | Ga0207707_10016112 | 3300025912 | Bacteria | 6517 |
| 239 | Ga0207707_10104156 | 3300025912 | Bacteria | 2480 |
| 240 | Ga0207707_10262448 | 3300025912 | Bacteria | 1498 |
| 241 | Ga0207707_10531635 | 3300025912 | Bacteria | 1000 |
| 242 | Ga0207695_10000448 | 3300025913 | Bacteria | 89964 |
| 243 | Ga0207695_10039822 | 3300025913 | Bacteria | 5048 |
| 244 | Ga0207695_10184705 | 3300025913 | Bacteria | 2005 |
| 245 | Ga0207695_10246912 | 3300025913 | Bacteria | 1685 |
| 246 | Ga0207695_10339143 | 3300025913 | Bacteria | 1391 |
| 247 | Ga0207695_10733430 | 3300025913 | Unclassified | 868 |
| 248 | Ga0207695_11122290 | 3300025913 | Unclassified | 666 |
| 249 | Ga0207671_10417763 | 3300025914 | Bacteria | 1067 |
| 250 | Ga0207693_10009654 | 3300025915 | Bacteria | 7857 |
| 251 | Ga0207693_10051582 | 3300025915 | Bacteria | 3228 |
| 252 | Ga0207663_10387895 | 3300025916 | Bacteria | 1065 |
| 253 | Ga0207663_10562310 | 3300025916 | Unclassified | 893 |
| 254 | Ga0207660_10383228 | 3300025917 | Bacteria | 1130 |
| 255 | Ga0207660_10657374 | 3300025917 | Unclassified | 855 |
| 256 | Ga0207657_10111548 | 3300025919 | Bacteria | 2258 |
| 257 | Ga0207657_10131538 | 3300025919 | Bacteria | 2050 |
| 258 | Ga0207649_10102438 | 3300025920 | Bacteria | 1897 |
| 259 | Ga0207652_10042459 | 3300025921 | Bacteria | 3871 |
| 260 | Ga0207652_10120227 | 3300025921 | Bacteria | 2337 |
| 261 | Ga0207652_10177633 | 3300025921 | Bacteria | 1912 |
| 262 | Ga0207652_10490444 | 3300025921 | Bacteria | 1106 |
| 263 | Ga0207694_10049958 | 3300025924 | Bacteria | 3238 |
| 264 | Ga0207694_10100014 | 3300025924 | Bacteria | 2297 |
| 265 | Ga0207694_10116379 | 3300025924 | Bacteria | 2131 |
| 266 | Ga0207694_10921030 | 3300025924 | Bacteria | 739 |
| 267 | Ga0207694_11042744 | 3300025924 | Unclassified | 692 |
| 268 | Ga0207687_10010313 | 3300025927 | Bacteria | 6105 |
| 269 | Ga0207700_10004508 | 3300025928 | Bacteria | 8224 |
| 270 | Ga0207700_10014753 | 3300025928 | Bacteria | 5130 |
| 271 | Ga0207700_10125809 | 3300025928 | Bacteria | 2085 |
| 272 | Ga0207700_10250427 | 3300025928 | Bacteria | 1513 |
| 273 | Ga0207700_10538882 | 3300025928 | Bacteria | 1035 |
| 274 | Ga0207700_11335370 | 3300025928 | Unclassified | 638 |
| 275 | Ga0207700_11725983 | 3300025928 | Unclassified | 552 |
| 276 | Ga0207664_10014614 | 3300025929 | Bacteria | 5677 |
| 277 | Ga0207664_10174077 | 3300025929 | Bacteria | 1844 |
| 278 | Ga0207664_10489989 | 3300025929 | Bacteria | 1100 |
| 279 | Ga0207664_11280131 | 3300025929 | Unclassified | 652 |
| 280 | Ga0207644_10001821 | 3300025931 | Bacteria | 13834 |
| 281 | Ga0207686_10122515 | 3300025934 | Bacteria | 1772 |
| 282 | Ga0207665_10008046 | 3300025939 | Bacteria | 6956 |
| 283 | Ga0207665_10277974 | 3300025939 | Bacteria | 1245 |
| 284 | Ga0207665_10766319 | 3300025939 | Unclassified | 761 |
| 285 | Ga0207711_10051178 | 3300025941 | Bacteria | 3537 |
| 286 | Ga0207711_10481118 | 3300025941 | Bacteria | 1157 |
| 287 | Ga0207661_10011549 | 3300025944 | Bacteria | 6404 |
| 288 | Ga0207661_10053542 | 3300025944 | Bacteria | 3230 |
| 289 | Ga0207661_10773719 | 3300025944 | Bacteria | 884 |
| 290 | Ga0207679_10799052 | 3300025945 | Bacteria | 860 |
| 291 | Ga0207667_10001856 | 3300025949 | Bacteria | 26550 |
| 292 | Ga0207667_10018535 | 3300025949 | Bacteria | 7804 |
| 293 | Ga0207667_10035213 | 3300025949 | Bacteria | 5371 |
| 294 | Ga0207667_10035813 | 3300025949 | Bacteria | 5323 |
| 295 | Ga0207667_10101174 | 3300025949 | Bacteria | 2973 |
| 296 | Ga0207667_10181704 | 3300025949 | Bacteria | 2160 |
| 297 | Ga0207667_10215264 | 3300025949 | Bacteria | 1969 |
| 298 | Ga0207667_10481745 | 3300025949 | Bacteria | 1259 |
| 299 | Ga0207667_11014084 | 3300025949 | Bacteria | 817 |
| 300 | Ga0207667_11175990 | 3300025949 | Unclassified | 747 |
| 301 | Ga0207712_10073878 | 3300025961 | Unclassified | 2460 |
| 302 | Ga0207712_10418088 | 3300025961 | Bacteria | 1130 |
| 303 | Ga0207640_10034309 | 3300025981 | Bacteria | 3166 |
| 304 | Ga0207658_11105513 | 3300025986 | Unclassified | 724 |
| 305 | Ga0207677_10008853 | 3300026023 | Bacteria | 5643 |
| 306 | Ga0207639_10009836 | 3300026041 | Bacteria | 6607 |
| 307 | Ga0207639_10020184 | 3300026041 | Bacteria | 4767 |
| 308 | Ga0207639_10035635 | 3300026041 | Bacteria | 3683 |
| 309 | Ga0207639_10109743 | 3300026041 | Bacteria | 2246 |
| 310 | Ga0207639_10433891 | 3300026041 | Bacteria | 1190 |
| 311 | Ga0207678_10003811 | 3300026067 | Bacteria | 13571 |
| 312 | Ga0207678_10283684 | 3300026067 | Bacteria | 1422 |
| 313 | Ga0207702_10296845 | 3300026078 | Unclassified | 1532 |
| 314 | Ga0207702_10359215 | 3300026078 | Bacteria | 1396 |
| 315 | Ga0207702_10479236 | 3300026078 | Bacteria | 1210 |
| 316 | Ga0207641_10125369 | 3300026088 | Bacteria | 2298 |
| 317 | Ga0207676_10128554 | 3300026095 | Bacteria | 2150 |
| 318 | Ga0207674_10459247 | 3300026116 | Bacteria | 1231 |
| 319 | Ga0207674_11320965 | 3300026116 | Bacteria | 691 |
| 320 | Ga0207683_10090415 | 3300026121 | Bacteria | 2726 |
| 321 | Ga0207683_10304537 | 3300026121 | Bacteria | 1458 |
| 322 | Ga0207698_10095546 | 3300026142 | Bacteria | 2447 |
| 323 | Ga0207698_10183927 | 3300026142 | Bacteria | 1854 |
| 324 | Ga0207698_10337596 | 3300026142 | Unclassified | 1418 |
| 325 | Ga0207698_10350746 | 3300026142 | Bacteria | 1394 |
| 326 | Ga0207698_11672142 | 3300026142 | Unclassified | 652 |
| 327 | Ga0268266_10055386 | 3300028379 | Bacteria | 3409 |
| 328 | Ga0268266_10145491 | 3300028379 | Bacteria | 2130 |
| 329 | Ga0268266_10212025 | 3300028379 | Bacteria | 1776 |
| 330 | Ga0268266_10212283 | 3300028379 | Bacteria | 1775 |
| 331 | Ga0265338_11076188 | 3300028800 | Unclassified | 542 |
| 332 | Ga0265325_10002276 | 3300031241 | Bacteria | 13017 |
| 333 | Ga0265325_10037820 | 3300031241 | Bacteria | 2549 |
| 334 | Ga0265340_10087147 | 3300031247 | Bacteria | 1463 |
| 335 | Ga0265331_10030349 | 3300031250 | Bacteria | 2691 |
| 336 | Ga0265327_10020558 | 3300031251 | Bacteria | 4016 |
| 337 | Ga0265316_10030584 | 3300031344 | Bacteria | 4411 |
| 338 | Ga0265316_10206174 | 3300031344 | Bacteria | 1456 |
| 339 | Ga0265316_11134329 | 3300031344 | Bacteria | 542 |
| 340 | Ga0265313_10016509 | 3300031595 | Bacteria | 4241 |
| 341 | Ga0265313_10065697 | 3300031595 | Bacteria | 1684 |
| 342 | Ga0265342_10029865 | 3300031712 | Bacteria | 3382 |
| 343 | Ga0265342_10032270 | 3300031712 | Bacteria | 3231 |
| 344 | Ga0265342_10524162 | 3300031712 | Bacteria | 603 |
| 345 | Ga0307510_10081045 | 3300033180 | Bacteria | 3150 |
| 346 | Ga0373926_0024666 | 3300035083 | Bacteria | 2095 |
| 347 | Ga0373923_0036493 | 3300035111 | Bacteria | 2006 |
| 348 | Ga0373923_0422391 | 3300035111 | Unclassified | 644 |
| 349 | Ga0373936_0232557 | 3300035113 | Unclassified | 820 |
| 350 | Ga0373945_0017383 | 3300035116 | Bacteria | 2435 |
| 351 | Ga0373957_0056071 | 3300035120 | Bacteria | 1516 |
| 352 | Ga0373943_0020972 | 3300035170 | Bacteria | 3017 |
| 353 | Ga0373946_0161122 | 3300035171 | Bacteria | 1053 |
| 354 | Ga0373955_0723086 | 3300035172 | Unclassified | 611 |
| 355 | Ga0373924_0000689 | 3300035410 | Bacteria | 10503 |
| 356 | Ga0373924_0044873 | 3300035410 | Bacteria | 1817 |
| 357 | Ga0373935_0019561 | 3300035692 | Bacteria | 4128 |
| 358 | Ga0373935_0059018 | 3300035692 | Bacteria | 2451 |
| 359 | Ga0373935_0061760 | 3300035692 | Bacteria | 2399 |
| 360 | Ga0373927_0010496 | 3300035695 | Bacteria | 6174 |
| 361 | Ga0373927_0097253 | 3300035695 | Bacteria | 1913 |
| 362 | Ga0373933_0290233 | 3300035724 | Bacteria | 1058 |
| 363 | Ga0373933_0745222 | 3300035724 | Unclassified | 644 |
| 364 | Ga0373947_0021403 | 3300035725 | Bacteria | 3742 |
| 365 | Ga0373947_0021599 | 3300035725 | Bacteria | 3726 |
| 366 | Ga0373947_0063220 | 3300035725 | Bacteria | 2254 |
| 367 | Ga0373947_0662834 | 3300035725 | Bacteria | 712 |
| 368 | Ga0373937_0000422 | 3300036401 | Bacteria | 39461 |
| 369 | Ga0373937_1020577 | 3300036401 | Bacteria | 776 |
| 370 | Ga0373937_1410046 | 3300036401 | Unclassified | 644 |
| 371 | Ga0373925_0134968 | 3300037068 | Bacteria | 1927 |
| 372 | Ga0373925_0335342 | 3300037068 | Bacteria | 1226 |
| 373 | Ga0373925_0495808 | 3300037068 | Bacteria | 1002 |
| 374 | Ga0395898_0307293 | 3300037466 | Bacteria | 1513 |
| 375 | Ga0395905_0271535 | 3300037471 | Bacteria | 1582 |
| 376 | Ga0436364_0902927 | 3300037853 | Bacteria | 2600 |
| 377 | Ga0436365_1896276 | 3300039437 | Bacteria | 938 |
| 378 | Ga0436360_0061507 | 3300039438 | Bacteria | 9012 |
| 379 | Ga0436360_0497221 | 3300039438 | Bacteria | 4928 |
| 380 | Ga0436360_0546638 | 3300039438 | Unclassified | 1244 |
| 381 | Ga0436361_0274684 | 3300039447 | Bacteria | 26616 |
| 382 | Ga0436361_0464047 | 3300039447 | Bacteria | 78853 |
| 383 | Ga0436361_0509515 | 3300039447 | Bacteria | 7573 |
| 384 | Ga0436361_0893033 | 3300039447 | Bacteria | 5203 |
| 385 | Ga0466966_0348255 | 3300044684 | Bacteria | 890 |
| 386 | Ga0466961_0228313 | 3300044693 | Bacteria | 1146 |
| 387 | Ga0466963_0078669 | 3300044694 | Bacteria | 2230 |
| 388 | Ga0466958_0080876 | 3300045836 | Bacteria | 1999 |
| 389 | Ga0466958_0466031 | 3300045836 | Bacteria | 819 |
| 390 | Ga0466967_0125944 | 3300045976 | Bacteria | 2373 |
| 391 | Ga0495603_0014346 | 3300046455 | Bacteria | 4792 |
| 392 | Ga0495603_0131756 | 3300046455 | Bacteria | 1455 |
| 393 | Ga0495629_0007401 | 3300046459 | Bacteria | 8090 |
| 394 | Ga0495629_0026812 | 3300046459 | Bacteria | 4092 |
| 395 | Ga0495629_0395884 | 3300046459 | Bacteria | 939 |
| 396 | Ga0495651_0037581 | 3300046462 | Bacteria | 3770 |
| 397 | Ga0495651_0047467 | 3300046462 | Bacteria | 3320 |
| 398 | Ga0495653_0003062 | 3300046463 | Bacteria | 13404 |
| 399 | Ga0495650_0000009 | 3300046471 | Bacteria | 653845 |
| 400 | Ga0495650_0007486 | 3300046471 | Bacteria | 6549 |
| 401 | Ga0495580_0101673 | 3300046472 | Unclassified | 1999 |
| 402 | Ga0495580_0445265 | 3300046472 | Bacteria | 869 |
| 403 | Ga0495580_0608808 | 3300046472 | Unclassified | 721 |
| 404 | Ga0495582_0005041 | 3300046473 | Bacteria | 7402 |
| 405 | Ga0495582_0104293 | 3300046473 | Bacteria | 1589 |
| 406 | Ga0495582_0193299 | 3300046473 | Bacteria | 1161 |
| 407 | Ga0495639_0002336 | 3300046475 | Bacteria | 8291 |
| 408 | Ga0495639_0056476 | 3300046475 | Bacteria | 1792 |
| 409 | Ga0495662_0000859 | 3300046476 | Bacteria | 14828 |
| 410 | Ga0495664_0057438 | 3300046477 | Bacteria | 2315 |
| 411 | Ga0495585_0122016 | 3300046492 | Bacteria | 1378 |
| 412 | Ga0495594_0000950 | 3300046499 | Bacteria | 15038 |
| 413 | Ga0495594_0021463 | 3300046499 | Bacteria | 3447 |
| 414 | Ga0495607_0043684 | 3300046501 | Bacteria | 2648 |
| 415 | Ga0495606_0075445 | 3300046507 | Bacteria | 2110 |
| 416 | Ga0495606_0084270 | 3300046507 | Bacteria | 1969 |
| 417 | Ga0495606_0424296 | 3300046507 | Unclassified | 687 |
| 418 | Ga0495608_0156069 | 3300046511 | Bacteria | 1453 |
| 419 | Ga0495608_0548364 | 3300046511 | Bacteria | 697 |
| 420 | Ga0495618_0171328 | 3300046514 | Bacteria | 1381 |
| 421 | Ga0495628_0381903 | 3300046516 | Bacteria | 1031 |
| 422 | Ga0495630_0086310 | 3300046517 | Bacteria | 2370 |
| 423 | Ga0495630_0708016 | 3300046517 | Bacteria | 770 |
| 424 | Ga0495644_0000936 | 3300046523 | Bacteria | 12112 |
| 425 | Ga0495666_0000909 | 3300046526 | Bacteria | 13866 |
| 426 | Ga0495642_0013648 | 3300046528 | Bacteria | 3146 |
| 427 | Ga0495642_0157834 | 3300046528 | Bacteria | 983 |
| 428 | Ga0495652_0008184 | 3300046529 | Bacteria | 9562 |
| 429 | Ga0495665_0012132 | 3300046531 | Bacteria | 4666 |
| 430 | Ga0495665_0025405 | 3300046531 | Bacteria | 3182 |
| 431 | Ga0495640_0004442 | 3300046533 | Bacteria | 11187 |
| 432 | Ga0495586_0002177 | 3300046535 | Bacteria | 10649 |
| 433 | Ga0495609_0011733 | 3300046538 | Bacteria | 4167 |
| 434 | Ga0495645_0002766 | 3300046543 | Bacteria | 11912 |
| 435 | Ga0495645_0082315 | 3300046543 | Bacteria | 2309 |
| 436 | Ga0495645_0288417 | 3300046543 | Bacteria | 1077 |
| 437 | Ga0495667_0018941 | 3300046559 | Bacteria | 4646 |
| 438 | Ga0495667_0091000 | 3300046559 | Bacteria | 1976 |
| 439 | Ga0495634_0008753 | 3300046642 | Bacteria | 7501 |
| 440 | Ga0495634_0033642 | 3300046642 | Bacteria | 3521 |
| 441 | Ga0495611_0286024 | 3300046648 | Bacteria | 761 |
| 442 | Ga0495625_0001513 | 3300046660 | Bacteria | 27875 |
| 443 | Ga0495625_0006994 | 3300046660 | Bacteria | 9941 |
| 444 | Ga0495625_0074975 | 3300046660 | Bacteria | 2368 |
| 445 | Ga0495625_0618045 | 3300046660 | Bacteria | 649 |
| 446 | Ga0495635_0001183 | 3300046663 | Bacteria | 17382 |
| 447 | Ga0495635_0374940 | 3300046663 | Bacteria | 947 |
| 448 | Ga0495657_0034837 | 3300046675 | Bacteria | 3494 |
| 449 | Ga0495657_0206336 | 3300046675 | Bacteria | 1196 |
| 450 | Ga0495599_0004552 | 3300046678 | Bacteria | 8220 |
| 451 | Ga0495599_0333307 | 3300046678 | Bacteria | 912 |
| 452 | Ga0495599_0415842 | 3300046678 | Bacteria | 799 |
| 453 | Ga0495646_0461510 | 3300046680 | Bacteria | 655 |
| 454 | Ga0495658_0136130 | 3300046683 | Bacteria | 1499 |
| 455 | Ga0495669_0000816 | 3300046684 | Bacteria | 13252 |
| 456 | Ga0495669_0638949 | 3300046684 | Unclassified | 517 |
| 457 | Ga0495613_0001246 | 3300046689 | Bacteria | 19420 |
| 458 | Ga0495613_0040046 | 3300046689 | Bacteria | 3472 |
| 459 | Ga0495624_0015784 | 3300046690 | Bacteria | 5089 |
| 460 | Ga0495589_0284655 | 3300046794 | Bacteria | 768 |
| 461 | Ga0495589_0443132 | 3300046794 | Unclassified | 594 |
| 462 | Ga0495600_0023564 | 3300046809 | Bacteria | 3960 |
| 463 | Ga0495600_0807402 | 3300046809 | Bacteria | 558 |
| 464 | Ga0495581_0007980 | 3300047315 | Bacteria | 6131 |
| 465 | Ga0495581_0029917 | 3300047315 | Bacteria | 3157 |
| 466 | Ga0495604_0000846 | 3300047317 | Bacteria | 25544 |
| 467 | Ga0495604_0029312 | 3300047317 | Bacteria | 4378 |
| 468 | Ga0495604_0072759 | 3300047317 | Bacteria | 2597 |
| 469 | Ga0495674_0036935 | 3300047319 | Bacteria | 4391 |
| 470 | Ga0495674_0046974 | 3300047319 | Bacteria | 3830 |
| 471 | Ga0495674_0061705 | 3300047319 | Bacteria | 3266 |
| 472 | Ga0495672_0002389 | 3300047320 | Bacteria | 17348 |
| 473 | Ga0495672_0443603 | 3300047320 | Bacteria | 586 |
| 474 | Ga0495676_0020124 | 3300047321 | Bacteria | 5865 |
| 475 | Ga0495680_0272694 | 3300047322 | Bacteria | 1194 |
| 476 | Ga0495680_0309451 | 3300047322 | Unclassified | 1107 |
| 477 | Ga0495683_0039623 | 3300047323 | Bacteria | 2381 |
| 478 | Ga0495675_0009912 | 3300047444 | Bacteria | 5939 |
| 479 | Ga0495684_0115163 | 3300047471 | Bacteria | 2027 |
| 480 | Ga0495686_0003013 | 3300047472 | Bacteria | 14964 |
| 481 | Ga0495686_0465816 | 3300047472 | Bacteria | 669 |
| 482 | Ga0495593_0081322 | 3300047673 | Bacteria | 1675 |
| 483 | Ga0495593_0310495 | 3300047673 | Unclassified | 788 |
| 484 | Ga0495602_0182120 | 3300048088 | Bacteria | 1619 |
| 485 | Ga0495614_0000493 | 3300048089 | Bacteria | 16151 |
| 486 | Ga0495614_0016600 | 3300048089 | Bacteria | 3203 |
| 487 | Ga0495614_0118364 | 3300048089 | Unclassified | 1167 |
| 488 | Ga0496103_0079899 | 3300048906 | Bacteria | 2056 |
| 489 | Ga0496104_0022156 | 3300048907 | Bacteria | 5838 |
| 490 | Ga0496104_0042223 | 3300048907 | Bacteria | 4278 |
| 491 | Ga0496104_0299897 | 3300048907 | Bacteria | 1519 |
| 492 | Ga0496104_0744932 | 3300048907 | Bacteria | 887 |
| 493 | Ga0496105_0005487 | 3300048908 | Bacteria | 9623 |
| 494 | Ga0496110_0244182 | 3300048913 | Bacteria | 1634 |
| 495 | Ga0496110_0487102 | 3300048913 | Bacteria | 1123 |
| 496 | Ga0496110_0728251 | 3300048913 | Bacteria | 894 |
| 497 | Ga0496111_0000856 | 3300048914 | Bacteria | 16481 |
| 498 | Ga0496112_0000986 | 3300048915 | Bacteria | 20797 |
| 499 | Ga0496112_0047612 | 3300048915 | Bacteria | 4207 |
| 500 | Ga0496112_0128687 | 3300048915 | Bacteria | 2503 |
| 501 | Ga0496112_0512289 | 3300048915 | Unclassified | 1135 |
| 502 | Ga0496112_1073418 | 3300048915 | Bacteria | 724 |
| 503 | Ga0496113_0001708 | 3300048916 | Bacteria | 12430 |
| 504 | Ga0496113_0150148 | 3300048916 | Bacteria | 1838 |
| 505 | Ga0496114_1420226 | 3300048917 | Bacteria | 581 |
| 506 | Ga0496115_0007118 | 3300048918 | Bacteria | 8215 |
| 507 | Ga0496115_0030660 | 3300048918 | Bacteria | 4232 |
| 508 | Ga0496115_0145800 | 3300048918 | Bacteria | 1954 |
| 509 | Ga0496126_0000004 | 3300048929 | Bacteria | 925026 |
| 510 | Ga0496126_0260357 | 3300048929 | Bacteria | 1443 |
| 511 | Ga0495682_0014348 | 3300049460 | Bacteria | 3006 |
| 512 | Ga0495682_0102222 | 3300049460 | Bacteria | 1028 |
| 513 | Ga0501031_0003773 | 3300049568 | Bacteria | 9746 |
| 514 | Ga0501032_0000447 | 3300049569 | Bacteria | 33626 |
| 515 | Ga0501032_0323761 | 3300049569 | Bacteria | 994 |
| 516 | Ga0501033_0000977 | 3300049570 | Bacteria | 25956 |
| 517 | Ga0501033_0247241 | 3300049570 | Bacteria | 1265 |
| 518 | Ga0501034_0002362 | 3300049571 | Bacteria | 22927 |
| 519 | Ga0501036_0000747 | 3300049572 | Bacteria | 24088 |
| 520 | Ga0501036_0555361 | 3300049572 | Bacteria | 954 |
| 521 | Ga0501037_0003466 | 3300049573 | Bacteria | 11452 |
| 522 | Ga0501037_0194717 | 3300049573 | Bacteria | 1434 |
| 523 | Ga0501037_1133153 | 3300049573 | Bacteria | 506 |
| 524 | Ga0501038_0002758 | 3300049574 | Bacteria | 16359 |
| 525 | Ga0501038_0071498 | 3300049574 | Bacteria | 2943 |
| 526 | Ga0501043_0001025 | 3300049579 | Bacteria | 24570 |
| 527 | Ga0501043_0443884 | 3300049579 | Bacteria | 976 |
| 528 | Ga0501046_0001776 | 3300049580 | Bacteria | 20596 |
| 529 | Ga0501047_0005256 | 3300049581 | Bacteria | 12164 |
| 530 | Ga0501047_0216470 | 3300049581 | Bacteria | 1772 |
| 531 | Ga0501068_0283194 | 3300049584 | Bacteria | 1059 |
| 532 | Ga0501070_0022776 | 3300049586 | Bacteria | 5244 |
| 533 | Ga0501070_0135799 | 3300049586 | Bacteria | 2031 |
| 534 | Ga0501073_0070325 | 3300049589 | Bacteria | 2438 |
| 535 | Ga0501074_0041693 | 3300049590 | Bacteria | 3323 |
| 536 | Ga0501080_0023120 | 3300049742 | Bacteria | 5764 |
| 537 | Ga0501080_1208722 | 3300049742 | Bacteria | 650 |
| 538 | Ga0501035_0002312 | 3300049822 | Bacteria | 18805 |
| 539 | Ga0501035_0133005 | 3300049822 | Bacteria | 2167 |
| 540 | Ga0501044_0001863 | 3300049823 | Bacteria | 24450 |
| 541 | Ga0501044_0057455 | 3300049823 | Bacteria | 3992 |
| 542 | Ga0501044_0436715 | 3300049823 | Bacteria | 1217 |
| 543 | Ga0501044_0783816 | 3300049823 | Bacteria | 833 |
| 544 | Ga0501045_0309035 | 3300049824 | Bacteria | 1177 |
| 545 | nmdc:mga0n895_457559_c1 | 3300050512 | Unclassified | 1288 |
| 546 | nmdc:mga08x19_297877_c1 | 3300050514 | Bacteria | 1120 |
| 547 | Ga0495601_0007131 | 3300053077 | Bacteria | 6550 |
| 548 | Ga0500651_0000020 | 3300053093 | Bacteria | 141936 |
| 549 | Ga0500595_000020 | 3300053119 | Bacteria | 165019 |
| 550 | Ga0500595_009804 | 3300053119 | Bacteria | 3847 |
| 551 | Ga0500661_009937 | 3300055283 | Bacteria | 1735 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005539 | Ga0068853_100026875 | Ga0068853_1000268755 | 131 |
| 2 | 3300005563 | Ga0068855_100045695 | Ga0068855_1000456954 | 131 |
| 3 | 3300005564 | Ga0070664_100087128 | Ga0070664_1000871282 | 131 |
| 4 | 3300005616 | Ga0068852_100917260 | Ga0068852_1009172602 | 131 |
| 5 | 3300025945 | Ga0207679_10799052 | Ga0207679_107990522 | 131 |
| 6 | 3300025949 | Ga0207667_10035213 | Ga0207667_100352134 | 131 |
| 7 | 3300026041 | Ga0207639_10009836 | Ga0207639_100098365 | 131 |
| 8 | 3300026078 | Ga0207702_10296845 | Ga0207702_102968452 | 131 |
| 9 | 3300026142 | Ga0207698_10337596 | Ga0207698_103375962 | 131 |
| 10 | 3300037471 | Ga0395905_0271535 | Ga0395905_0271535_559_954 | 131 |
| 11 | 3300046472 | Ga0495580_0101673 | Ga0495580_0101673_937_1344 | 131 |
| 12 | 3300005336 | Ga0070680_101128741 | Ga0070680_1011287411 | 132 |
| 13 | 3300005337 | Ga0070682_100929107 | Ga0070682_1009291072 | 132 |
| 14 | 3300005436 | Ga0070713_100477364 | Ga0070713_1004773642 | 132 |
| 15 | 3300005458 | Ga0070681_10072842 | Ga0070681_100728424 | 132 |
| 16 | 3300005530 | Ga0070679_100202821 | Ga0070679_1002028212 | 132 |
| 17 | 3300005530 | Ga0070679_100919151 | Ga0070679_1009191512 | 132 |
| 18 | 3300005530 | Ga0070679_101294282 | Ga0070679_1012942822 | 132 |
| 19 | 3300005535 | Ga0070684_102239044 | Ga0070684_1022390441 | 132 |
| 20 | 3300005548 | Ga0070665_100039408 | Ga0070665_1000394083 | 132 |
| 21 | 3300005563 | Ga0068855_100762172 | Ga0068855_1007621722 | 132 |
| 22 | 3300005578 | Ga0068854_101354883 | Ga0068854_1013548831 | 132 |
| 23 | 3300005842 | Ga0068858_100071940 | Ga0068858_1000719402 | 132 |
| 24 | 3300009093 | Ga0105240_10053944 | Ga0105240_100539442 | 132 |
| 25 | 3300009093 | Ga0105240_10179932 | Ga0105240_101799323 | 132 |
| 26 | 3300009093 | Ga0105240_11353663 | Ga0105240_113536631 | 132 |
| 27 | 3300009174 | Ga0105241_11340367 | Ga0105241_113403671 | 132 |
| 28 | 3300009551 | Ga0105238_10503174 | Ga0105238_105031743 | 132 |
| 29 | 3300010375 | Ga0105239_11082445 | Ga0105239_110824451 | 132 |
| 30 | 3300013102 | Ga0157371_10161609 | Ga0157371_101616093 | 132 |
| 31 | 3300013104 | Ga0157370_10254674 | Ga0157370_102546743 | 132 |
| 32 | 3300013105 | Ga0157369_10238339 | Ga0157369_102383391 | 132 |
| 33 | 3300013307 | Ga0157372_10046392 | Ga0157372_100463924 | 132 |
| 34 | 3300020069 | Ga0197907_10726330 | Ga0197907_107263303 | 132 |
| 35 | 3300020075 | Ga0206349_1929961 | Ga0206349_19299612 | 132 |
| 36 | 3300020077 | Ga0206351_10082539 | Ga0206351_100825392 | 132 |
| 37 | 3300020078 | Ga0206352_11306157 | Ga0206352_113061573 | 132 |
| 38 | 3300020080 | Ga0206350_11455148 | Ga0206350_114551482 | 132 |
| 39 | 3300020081 | Ga0206354_10894720 | Ga0206354_108947202 | 132 |
| 40 | 3300020610 | Ga0154015_1576844 | Ga0154015_15768443 | 132 |
| 41 | 3300025911 | Ga0207654_11116162 | Ga0207654_111161621 | 132 |
| 42 | 3300025913 | Ga0207695_10246912 | Ga0207695_102469122 | 132 |
| 43 | 3300025913 | Ga0207695_11122290 | Ga0207695_111222901 | 132 |
| 44 | 3300025917 | Ga0207660_10657374 | Ga0207660_106573742 | 132 |
| 45 | 3300025921 | Ga0207652_10177633 | Ga0207652_101776333 | 132 |
| 46 | 3300025949 | Ga0207667_10215264 | Ga0207667_102152642 | 132 |
| 47 | 3300025949 | Ga0207667_11014084 | Ga0207667_110140841 | 132 |
| 48 | 3300025961 | Ga0207712_10418088 | Ga0207712_104180881 | 132 |
| 49 | 3300026078 | Ga0207702_10359215 | Ga0207702_103592152 | 132 |
| 50 | 3300026116 | Ga0207674_11320965 | Ga0207674_113209651 | 132 |
| 51 | 3300028379 | Ga0268266_10055386 | Ga0268266_100553864 | 132 |
| 52 | 3300037466 | Ga0395898_0307293 | Ga0395898_0307293_715_1113 | 132 |
| 53 | 3300049823 | Ga0501044_0001863 | Ga0501044_0001863_7162_7563 | 133 |
| 54 | 3300005329 | Ga0070683_101349983 | Ga0070683_1013499832 | 134 |
| 55 | 3300005578 | Ga0068854_101626006 | Ga0068854_1016260061 | 134 |
| 56 | 3300005614 | Ga0068856_100487536 | Ga0068856_1004875362 | 134 |
| 57 | 3300009174 | Ga0105241_10158769 | Ga0105241_101587692 | 134 |
| 58 | 3300009551 | Ga0105238_11857736 | Ga0105238_118577361 | 134 |
| 59 | 3300014497 | Ga0182008_10658141 | Ga0182008_106581412 | 134 |
| 60 | 3300014969 | Ga0157376_10032731 | Ga0157376_100327314 | 134 |
| 61 | 3300015262 | Ga0182007_10068098 | Ga0182007_100680982 | 134 |
| 62 | 3300005844 | Ga0068862_101053830 | Ga0068862_1010538302 | 135 |
| 63 | 3300006237 | Ga0097621_101002836 | Ga0097621_1010028362 | 135 |
| 64 | 3300009101 | Ga0105247_10572667 | Ga0105247_105726672 | 135 |
| 65 | 3300009177 | Ga0105248_10909507 | Ga0105248_109095071 | 135 |
| 66 | 3300009553 | Ga0105249_10056030 | Ga0105249_100560303 | 135 |
| 67 | 3300010159 | Ga0099796_10029684 | Ga0099796_100296841 | 135 |
| 68 | 3300021388 | Ga0213875_10022515 | Ga0213875_100225152 | 135 |
| 69 | 3300025900 | Ga0207710_10572372 | Ga0207710_105723722 | 135 |
| 70 | 3300025961 | Ga0207712_10073878 | Ga0207712_100738783 | 135 |
| 71 | 3300025986 | Ga0207658_11105513 | Ga0207658_111055131 | 135 |
| 72 | 3300037853 | Ga0436364_0902927 | Ga0436364_0902927_1532_1939 | 135 |
| 73 | 3300005335 | Ga0070666_10483981 | Ga0070666_104839811 | 136 |
| 74 | 3300005366 | Ga0070659_101553339 | Ga0070659_1015533391 | 136 |
| 75 | 3300005437 | Ga0070710_11340319 | Ga0070710_113403191 | 136 |
| 76 | 3300005439 | Ga0070711_100178493 | Ga0070711_1001784932 | 136 |
| 77 | 3300005456 | Ga0070678_100411302 | Ga0070678_1004113022 | 136 |
| 78 | 3300006028 | Ga0070717_10125800 | Ga0070717_101258002 | 136 |
| 79 | 3300010375 | Ga0105239_11207379 | Ga0105239_112073792 | 136 |
| 80 | 3300013100 | Ga0157373_10053933 | Ga0157373_100539333 | 136 |
| 81 | 3300013105 | Ga0157369_10015156 | Ga0157369_100151562 | 136 |
| 82 | 3300021384 | Ga0213876_10409092 | Ga0213876_104090922 | 136 |
| 83 | 3300025924 | Ga0207694_11042744 | Ga0207694_110427441 | 136 |
| 84 | 3300026121 | Ga0207683_10090415 | Ga0207683_100904154 | 136 |
| 85 | 3300031344 | Ga0265316_11134329 | Ga0265316_111343291 | 136 |
| 86 | 3300031712 | Ga0265342_10029865 | Ga0265342_100298652 | 136 |
| 87 | 3300039437 | Ga0436365_1896276 | Ga0436365_1896276_459_869 | 136 |
| 88 | 3300048918 | Ga0496115_0007118 | Ga0496115_0007118_4508_4918 | 136 |
| 89 | 3300006871 | Ga0075434_100223189 | Ga0075434_1002231891 | 137 |
| 90 | 3300021361 | Ga0213872_10002855 | Ga0213872_100028552 | 137 |
| 91 | 3300021361 | Ga0213872_10017431 | Ga0213872_100174312 | 137 |
| 92 | 3300021441 | Ga0213871_10000715 | Ga0213871_100007152 | 137 |
| 93 | 3300021441 | Ga0213871_10002116 | Ga0213871_100021163 | 137 |
| 94 | 3300039438 | Ga0436360_0061507 | Ga0436360_0061507_6041_6454 | 137 |
| 95 | 3300039438 | Ga0436360_0497221 | Ga0436360_0497221_1130_1543 | 137 |
| 96 | 3300039447 | Ga0436361_0274684 | Ga0436361_0274684_17270_17683 | 137 |
| 97 | 3300039447 | Ga0436361_0464047 | Ga0436361_0464047_41925_42338 | 137 |
| 98 | 3300039447 | Ga0436361_0509515 | Ga0436361_0509515_5408_5821 | 137 |
| 99 | 3300039447 | Ga0436361_0893033 | Ga0436361_0893033_158_571 | 137 |
| 100 | 3300050512 | nmdc:mga0n895_457559_c1 | nmdc:mga0n895_457559_c1_89_502 | 137 |
| 101 | 3300005434 | Ga0070709_10606208 | Ga0070709_106062082 | 138 |
| 102 | 3300005842 | Ga0068858_100156242 | Ga0068858_1001562423 | 139 |
| 103 | 3300031241 | Ga0265325_10002276 | Ga0265325_100022766 | 139 |
| 104 | 3300031241 | Ga0265325_10037820 | Ga0265325_100378201 | 139 |
| 105 | 3300031247 | Ga0265340_10087147 | Ga0265340_100871472 | 139 |
| 106 | 3300031250 | Ga0265331_10030349 | Ga0265331_100303492 | 139 |
| 107 | 3300031251 | Ga0265327_10020558 | Ga0265327_100205585 | 139 |
| 108 | 3300031344 | Ga0265316_10030584 | Ga0265316_100305843 | 139 |
| 109 | 3300031344 | Ga0265316_10206174 | Ga0265316_102061742 | 139 |
| 110 | 3300031595 | Ga0265313_10016509 | Ga0265313_100165093 | 139 |
| 111 | 3300031595 | Ga0265313_10065697 | Ga0265313_100656971 | 139 |
| 112 | 3300031712 | Ga0265342_10032270 | Ga0265342_100322704 | 139 |
| 113 | 3300031712 | Ga0265342_10524162 | Ga0265342_105241621 | 139 |
| 114 | 3300039438 | Ga0436360_0546638 | Ga0436360_0546638_22_441 | 139 |
| 115 | 3300046459 | Ga0495629_0395884 | Ga0495629_0395884_459_878 | 139 |
| 116 | 3300046472 | Ga0495580_0608808 | Ga0495580_0608808_249_668 | 139 |
| 117 | 3300046642 | Ga0495634_0033642 | Ga0495634_0033642_12_494 | 139 |
| 118 | 3300046648 | Ga0495611_0286024 | Ga0495611_0286024_89_508 | 139 |
| 119 | 3300046684 | Ga0495669_0638949 | Ga0495669_0638949_25_507 | 139 |
| 120 | 3300046794 | Ga0495589_0443132 | Ga0495589_0443132_12_494 | 139 |
| 121 | 3300047322 | Ga0495680_0309451 | Ga0495680_0309451_12_494 | 139 |
| 122 | 3300005458 | Ga0070681_10025159 | Ga0070681_100251592 | 140 |
| 123 | 3300005577 | Ga0068857_100376677 | Ga0068857_1003766772 | 140 |
| 124 | 3300009093 | Ga0105240_10831422 | Ga0105240_108314222 | 140 |
| 125 | 3300009551 | Ga0105238_10583747 | Ga0105238_105837471 | 140 |
| 126 | 3300022467 | Ga0224712_10247017 | Ga0224712_102470172 | 140 |
| 127 | 3300025912 | Ga0207707_10262448 | Ga0207707_102624481 | 140 |
| 128 | 3300025921 | Ga0207652_10042459 | Ga0207652_100424592 | 140 |
| 129 | 3300025939 | Ga0207665_10277974 | Ga0207665_102779741 | 140 |
| 130 | 3300026116 | Ga0207674_10459247 | Ga0207674_104592472 | 140 |
| 131 | 3300045976 | Ga0466967_0125944 | Ga0466967_0125944_103_525 | 140 |
| 132 | 3300048907 | Ga0496104_0744932 | Ga0496104_0744932_112_534 | 140 |
| 133 | 3300048915 | Ga0496112_0047612 | Ga0496112_0047612_2847_3269 | 140 |
| 134 | 3300048916 | Ga0496113_0150148 | Ga0496113_0150148_1088_1510 | 140 |
| 135 | 3300005329 | Ga0070683_100015441 | Ga0070683_1000154414 | 141 |
| 136 | 3300005436 | Ga0070713_100021870 | Ga0070713_1000218704 | 141 |
| 137 | 3300005436 | Ga0070713_100117512 | Ga0070713_1001175123 | 141 |
| 138 | 3300005436 | Ga0070713_101087825 | Ga0070713_1010878252 | 141 |
| 139 | 3300005535 | Ga0070684_100028447 | Ga0070684_1000284472 | 141 |
| 140 | 3300005539 | Ga0068853_100034787 | Ga0068853_1000347873 | 141 |
| 141 | 3300005616 | Ga0068852_100017759 | Ga0068852_1000177597 | 141 |
| 142 | 3300006028 | Ga0070717_10036116 | Ga0070717_100361163 | 141 |
| 143 | 3300009551 | Ga0105238_10217164 | Ga0105238_102171642 | 141 |
| 144 | 3300009551 | Ga0105238_10634819 | Ga0105238_106348191 | 141 |
| 145 | 3300010375 | Ga0105239_10545360 | Ga0105239_105453602 | 141 |
| 146 | 3300013296 | Ga0157374_10598141 | Ga0157374_105981412 | 141 |
| 147 | 3300025928 | Ga0207700_10004508 | Ga0207700_100045085 | 141 |
| 148 | 3300025928 | Ga0207700_10125809 | Ga0207700_101258094 | 141 |
| 149 | 3300025944 | Ga0207661_10011549 | Ga0207661_100115494 | 141 |
| 150 | 3300026023 | Ga0207677_10008853 | Ga0207677_100088534 | 141 |
| 151 | 3300026041 | Ga0207639_10109743 | Ga0207639_101097433 | 141 |
| 152 | 3300035172 | Ga0373955_0723086 | Ga0373955_0723086_35_460 | 141 |
| 153 | 3300005329 | Ga0070683_100321822 | Ga0070683_1003218222 | 142 |
| 154 | 3300005336 | Ga0070680_100562203 | Ga0070680_1005622032 | 142 |
| 155 | 3300005434 | Ga0070709_11159941 | Ga0070709_111599411 | 142 |
| 156 | 3300005435 | Ga0070714_100115097 | Ga0070714_1001150973 | 142 |
| 157 | 3300005435 | Ga0070714_100587806 | Ga0070714_1005878062 | 142 |
| 158 | 3300005435 | Ga0070714_100985186 | Ga0070714_1009851862 | 142 |
| 159 | 3300005436 | Ga0070713_100007913 | Ga0070713_1000079134 | 142 |
| 160 | 3300005436 | Ga0070713_100167558 | Ga0070713_1001675582 | 142 |
| 161 | 3300005436 | Ga0070713_101900074 | Ga0070713_1019000742 | 142 |
| 162 | 3300005437 | Ga0070710_10015469 | Ga0070710_100154692 | 142 |
| 163 | 3300005437 | Ga0070710_10213308 | Ga0070710_102133082 | 142 |
| 164 | 3300005437 | Ga0070710_10669067 | Ga0070710_106690671 | 142 |
| 165 | 3300005439 | Ga0070711_100333615 | Ga0070711_1003336152 | 142 |
| 166 | 3300005439 | Ga0070711_100905932 | Ga0070711_1009059322 | 142 |
| 167 | 3300005458 | Ga0070681_10059397 | Ga0070681_100593973 | 142 |
| 168 | 3300005458 | Ga0070681_10075854 | Ga0070681_100758542 | 142 |
| 169 | 3300005518 | Ga0070699_100212854 | Ga0070699_1002128542 | 142 |
| 170 | 3300005535 | Ga0070684_100485507 | Ga0070684_1004855072 | 142 |
| 171 | 3300005539 | Ga0068853_100027051 | Ga0068853_1000270513 | 142 |
| 172 | 3300005539 | Ga0068853_100906484 | Ga0068853_1009064841 | 142 |
| 173 | 3300005564 | Ga0070664_100638767 | Ga0070664_1006387672 | 142 |
| 174 | 3300005614 | Ga0068856_101897836 | Ga0068856_1018978361 | 142 |
| 175 | 3300005616 | Ga0068852_100288887 | Ga0068852_1002888873 | 142 |
| 176 | 3300005616 | Ga0068852_100646669 | Ga0068852_1006466692 | 142 |
| 177 | 3300005834 | Ga0068851_10271645 | Ga0068851_102716452 | 142 |
| 178 | 3300006028 | Ga0070717_10008710 | Ga0070717_100087107 | 142 |
| 179 | 3300006028 | Ga0070717_10044242 | Ga0070717_100442424 | 142 |
| 180 | 3300006028 | Ga0070717_10098596 | Ga0070717_100985962 | 142 |
| 181 | 3300006028 | Ga0070717_10131082 | Ga0070717_101310821 | 142 |
| 182 | 3300006028 | Ga0070717_10188056 | Ga0070717_101880562 | 142 |
| 183 | 3300006028 | Ga0070717_10274444 | Ga0070717_102744442 | 142 |
| 184 | 3300006163 | Ga0070715_10251404 | Ga0070715_102514042 | 142 |
| 185 | 3300006163 | Ga0070715_10516676 | Ga0070715_105166761 | 142 |
| 186 | 3300006163 | Ga0070715_10517877 | Ga0070715_105178771 | 142 |
| 187 | 3300006173 | Ga0070716_100091591 | Ga0070716_1000915913 | 142 |
| 188 | 3300006175 | Ga0070712_100153647 | Ga0070712_1001536472 | 142 |
| 189 | 3300006175 | Ga0070712_100298334 | Ga0070712_1002983341 | 142 |
| 190 | 3300006914 | Ga0075436_100285667 | Ga0075436_1002856672 | 142 |
| 191 | 3300009093 | Ga0105240_10352994 | Ga0105240_103529942 | 142 |
| 192 | 3300009093 | Ga0105240_11328501 | Ga0105240_113285012 | 142 |
| 193 | 3300009098 | Ga0105245_10076381 | Ga0105245_100763814 | 142 |
| 194 | 3300009174 | Ga0105241_10868752 | Ga0105241_108687521 | 142 |
| 195 | 3300009176 | Ga0105242_10048107 | Ga0105242_100481072 | 142 |
| 196 | 3300009545 | Ga0105237_10535473 | Ga0105237_105354732 | 142 |
| 197 | 3300009551 | Ga0105238_10040781 | Ga0105238_100407813 | 142 |
| 198 | 3300009551 | Ga0105238_10293852 | Ga0105238_102938522 | 142 |
| 199 | 3300010159 | Ga0099796_10054408 | Ga0099796_100544082 | 142 |
| 200 | 3300010375 | Ga0105239_11154712 | Ga0105239_111547121 | 142 |
| 201 | 3300010375 | Ga0105239_13279215 | Ga0105239_132792151 | 142 |
| 202 | 3300013105 | Ga0157369_10033391 | Ga0157369_100333914 | 142 |
| 203 | 3300013105 | Ga0157369_10511880 | Ga0157369_105118802 | 142 |
| 204 | 3300013306 | Ga0163162_10164268 | Ga0163162_101642683 | 142 |
| 205 | 3300013306 | Ga0163162_10616507 | Ga0163162_106165072 | 142 |
| 206 | 3300013307 | Ga0157372_10318396 | Ga0157372_103183962 | 142 |
| 207 | 3300020070 | Ga0206356_10955734 | Ga0206356_109557342 | 142 |
| 208 | 3300025898 | Ga0207692_10302885 | Ga0207692_103028851 | 142 |
| 209 | 3300025898 | Ga0207692_10386411 | Ga0207692_103864112 | 142 |
| 210 | 3300025898 | Ga0207692_10415514 | Ga0207692_104155142 | 142 |
| 211 | 3300025898 | Ga0207692_10899043 | Ga0207692_108990431 | 142 |
| 212 | 3300025906 | Ga0207699_10082386 | Ga0207699_100823862 | 142 |
| 213 | 3300025906 | Ga0207699_10260867 | Ga0207699_102608672 | 142 |
| 214 | 3300025912 | Ga0207707_10016112 | Ga0207707_100161126 | 142 |
| 215 | 3300025912 | Ga0207707_10104156 | Ga0207707_101041562 | 142 |
| 216 | 3300025913 | Ga0207695_10039822 | Ga0207695_100398224 | 142 |
| 217 | 3300025913 | Ga0207695_10184705 | Ga0207695_101847052 | 142 |
| 218 | 3300025913 | Ga0207695_10733430 | Ga0207695_107334302 | 142 |
| 219 | 3300025914 | Ga0207671_10417763 | Ga0207671_104177632 | 142 |
| 220 | 3300025915 | Ga0207693_10009654 | Ga0207693_100096542 | 142 |
| 221 | 3300025915 | Ga0207693_10051582 | Ga0207693_100515822 | 142 |
| 222 | 3300025916 | Ga0207663_10387895 | Ga0207663_103878952 | 142 |
| 223 | 3300025916 | Ga0207663_10562310 | Ga0207663_105623101 | 142 |
| 224 | 3300025921 | Ga0207652_10490444 | Ga0207652_104904442 | 142 |
| 225 | 3300025924 | Ga0207694_10049958 | Ga0207694_100499583 | 142 |
| 226 | 3300025927 | Ga0207687_10010313 | Ga0207687_100103133 | 142 |
| 227 | 3300025928 | Ga0207700_10014753 | Ga0207700_100147535 | 142 |
| 228 | 3300025928 | Ga0207700_10250427 | Ga0207700_102504272 | 142 |
| 229 | 3300025928 | Ga0207700_11335370 | Ga0207700_113353701 | 142 |
| 230 | 3300025929 | Ga0207664_10014614 | Ga0207664_100146143 | 142 |
| 231 | 3300025929 | Ga0207664_11280131 | Ga0207664_112801312 | 142 |
| 232 | 3300025934 | Ga0207686_10122515 | Ga0207686_101225152 | 142 |
| 233 | 3300025939 | Ga0207665_10008046 | Ga0207665_100080461 | 142 |
| 234 | 3300025944 | Ga0207661_10053542 | Ga0207661_100535422 | 142 |
| 235 | 3300025949 | Ga0207667_10035813 | Ga0207667_100358134 | 142 |
| 236 | 3300026041 | Ga0207639_10035635 | Ga0207639_100356353 | 142 |
| 237 | 3300026041 | Ga0207639_10433891 | Ga0207639_104338912 | 142 |
| 238 | 3300026142 | Ga0207698_10183927 | Ga0207698_101839272 | 142 |
| 239 | 3300026142 | Ga0207698_11672142 | Ga0207698_116721421 | 142 |
| 240 | 3300028800 | Ga0265338_11076188 | Ga0265338_110761881 | 142 |
| 241 | 3300035083 | Ga0373926_0024666 | Ga0373926_0024666_75_503 | 142 |
| 242 | 3300035111 | Ga0373923_0036493 | Ga0373923_0036493_10_438 | 142 |
| 243 | 3300035111 | Ga0373923_0422391 | Ga0373923_0422391_45_473 | 142 |
| 244 | 3300035113 | Ga0373936_0232557 | Ga0373936_0232557_97_525 | 142 |
| 245 | 3300035116 | Ga0373945_0017383 | Ga0373945_0017383_1408_1836 | 142 |
| 246 | 3300035120 | Ga0373957_0056071 | Ga0373957_0056071_694_1122 | 142 |
| 247 | 3300035170 | Ga0373943_0020972 | Ga0373943_0020972_920_1348 | 142 |
| 248 | 3300035171 | Ga0373946_0161122 | Ga0373946_0161122_540_968 | 142 |
| 249 | 3300035410 | Ga0373924_0000689 | Ga0373924_0000689_3892_4320 | 142 |
| 250 | 3300035410 | Ga0373924_0044873 | Ga0373924_0044873_877_1305 | 142 |
| 251 | 3300035692 | Ga0373935_0019561 | Ga0373935_0019561_1492_1920 | 142 |
| 252 | 3300035692 | Ga0373935_0059018 | Ga0373935_0059018_536_964 | 142 |
| 253 | 3300035692 | Ga0373935_0061760 | Ga0373935_0061760_1016_1444 | 142 |
| 254 | 3300035695 | Ga0373927_0010496 | Ga0373927_0010496_3676_4104 | 142 |
| 255 | 3300035695 | Ga0373927_0097253 | Ga0373927_0097253_519_947 | 142 |
| 256 | 3300035724 | Ga0373933_0290233 | Ga0373933_0290233_266_694 | 142 |
| 257 | 3300035724 | Ga0373933_0745222 | Ga0373933_0745222_145_573 | 142 |
| 258 | 3300035725 | Ga0373947_0021403 | Ga0373947_0021403_967_1395 | 142 |
| 259 | 3300035725 | Ga0373947_0021599 | Ga0373947_0021599_1828_2256 | 142 |
| 260 | 3300035725 | Ga0373947_0063220 | Ga0373947_0063220_864_1292 | 142 |
| 261 | 3300036401 | Ga0373937_0000422 | Ga0373937_0000422_32691_33119 | 142 |
| 262 | 3300036401 | Ga0373937_1020577 | Ga0373937_1020577_149_577 | 142 |
| 263 | 3300036401 | Ga0373937_1410046 | Ga0373937_1410046_149_577 | 142 |
| 264 | 3300037068 | Ga0373925_0134968 | Ga0373925_0134968_963_1391 | 142 |
| 265 | 3300037068 | Ga0373925_0495808 | Ga0373925_0495808_228_656 | 142 |
| 266 | 3300044694 | Ga0466963_0078669 | Ga0466963_0078669_1275_1703 | 142 |
| 267 | 3300045836 | Ga0466958_0080876 | Ga0466958_0080876_946_1374 | 142 |
| 268 | 3300045836 | Ga0466958_0466031 | Ga0466958_0466031_180_608 | 142 |
| 269 | 3300046462 | Ga0495651_0047467 | Ga0495651_0047467_2410_2838 | 142 |
| 270 | 3300046473 | Ga0495582_0193299 | Ga0495582_0193299_67_495 | 142 |
| 271 | 3300046475 | Ga0495639_0056476 | Ga0495639_0056476_982_1410 | 142 |
| 272 | 3300046511 | Ga0495608_0156069 | Ga0495608_0156069_796_1224 | 142 |
| 273 | 3300046516 | Ga0495628_0381903 | Ga0495628_0381903_403_831 | 142 |
| 274 | 3300046517 | Ga0495630_0708016 | Ga0495630_0708016_223_651 | 142 |
| 275 | 3300046531 | Ga0495665_0025405 | Ga0495665_0025405_1773_2201 | 142 |
| 276 | 3300046543 | Ga0495645_0288417 | Ga0495645_0288417_605_1033 | 142 |
| 277 | 3300046559 | Ga0495667_0091000 | Ga0495667_0091000_30_458 | 142 |
| 278 | 3300046663 | Ga0495635_0374940 | Ga0495635_0374940_415_843 | 142 |
| 279 | 3300046675 | Ga0495657_0034837 | Ga0495657_0034837_2138_2566 | 142 |
| 280 | 3300046678 | Ga0495599_0333307 | Ga0495599_0333307_238_666 | 142 |
| 281 | 3300046683 | Ga0495658_0136130 | Ga0495658_0136130_80_508 | 142 |
| 282 | 3300047317 | Ga0495604_0029312 | Ga0495604_0029312_1631_2059 | 142 |
| 283 | 3300047673 | Ga0495593_0310495 | Ga0495593_0310495_257_685 | 142 |
| 284 | 3300048089 | Ga0495614_0118364 | Ga0495614_0118364_277_705 | 142 |
| 285 | 3300048907 | Ga0496104_0022156 | Ga0496104_0022156_2333_2761 | 142 |
| 286 | 3300048907 | Ga0496104_0042223 | Ga0496104_0042223_1530_1958 | 142 |
| 287 | 3300048908 | Ga0496105_0005487 | Ga0496105_0005487_7297_7725 | 142 |
| 288 | 3300048913 | Ga0496110_0244182 | Ga0496110_0244182_870_1298 | 142 |
| 289 | 3300048913 | Ga0496110_0728251 | Ga0496110_0728251_130_558 | 142 |
| 290 | 3300048914 | Ga0496111_0000856 | Ga0496111_0000856_12000_12428 | 142 |
| 291 | 3300048915 | Ga0496112_0000986 | Ga0496112_0000986_9687_10115 | 142 |
| 292 | 3300048915 | Ga0496112_0512289 | Ga0496112_0512289_678_1106 | 142 |
| 293 | 3300048916 | Ga0496113_0001708 | Ga0496113_0001708_2845_3273 | 142 |
| 294 | 3300050514 | nmdc:mga08x19_297877_c1 | nmdc:mga08x19_297877_c1_291_719 | 142 |
| 295 | 3300053077 | Ga0495601_0007131 | Ga0495601_0007131_3387_3815 | 142 |
| 296 | 3300005518 | Ga0070699_100527762 | Ga0070699_1005277622 | 143 |
| 297 | 3300006175 | Ga0070712_100629585 | Ga0070712_1006295852 | 143 |
| 298 | 3300010159 | Ga0099796_10151068 | Ga0099796_101510682 | 143 |
| 299 | 3300022467 | Ga0224712_10214358 | Ga0224712_102143581 | 143 |
| 300 | 3300025912 | Ga0207707_10531635 | Ga0207707_105316351 | 143 |
| 301 | 3300025949 | Ga0207667_10481745 | Ga0207667_104817452 | 143 |
| 302 | 3300025949 | Ga0207667_11175990 | Ga0207667_111759902 | 143 |
| 303 | 3300048918 | Ga0496115_0030660 | Ga0496115_0030660_113_544 | 143 |
| 304 | 3300048906 | Ga0496103_0079899 | Ga0496103_0079899_1475_2035 | 144 |
| 305 | iso_pu_bacteria | 2884215851 | 2884216718 | 144 |
| 306 | 3300005547 | Ga0070693_100290227 | Ga0070693_1002902272 | 145 |
| 307 | 3300047319 | Ga0495674_0036935 | Ga0495674_0036935_16_657 | 145 |
| 308 | 3300025928 | Ga0207700_11725983 | Ga0207700_117259831 | 147 |
| 309 | 3300025939 | Ga0207665_10766319 | Ga0207665_107663191 | 147 |
| 310 | 3300005327 | Ga0070658_10014514 | Ga0070658_100145147 | 148 |
| 311 | 3300005327 | Ga0070658_10025306 | Ga0070658_100253061 | 148 |
| 312 | 3300005327 | Ga0070658_10071080 | Ga0070658_100710802 | 148 |
| 313 | 3300005327 | Ga0070658_10796204 | Ga0070658_107962042 | 148 |
| 314 | 3300005329 | Ga0070683_100170919 | Ga0070683_1001709192 | 148 |
| 315 | 3300005336 | Ga0070680_100189811 | Ga0070680_1001898112 | 148 |
| 316 | 3300005339 | Ga0070660_100069635 | Ga0070660_1000696354 | 148 |
| 317 | 3300005339 | Ga0070660_100141584 | Ga0070660_1001415842 | 148 |
| 318 | 3300005345 | Ga0070692_10743060 | Ga0070692_107430602 | 148 |
| 319 | 3300005355 | Ga0070671_100082244 | Ga0070671_1000822443 | 148 |
| 320 | 3300005364 | Ga0070673_100357127 | Ga0070673_1003571272 | 148 |
| 321 | 3300005435 | Ga0070714_100058532 | Ga0070714_1000585322 | 148 |
| 322 | 3300005436 | Ga0070713_100016290 | Ga0070713_1000162904 | 148 |
| 323 | 3300005439 | Ga0070711_100352284 | Ga0070711_1003522842 | 148 |
| 324 | 3300005456 | Ga0070678_100063876 | Ga0070678_1000638764 | 148 |
| 325 | 3300005458 | Ga0070681_10242035 | Ga0070681_102420352 | 148 |
| 326 | 3300005467 | Ga0070706_100934373 | Ga0070706_1009343731 | 148 |
| 327 | 3300005468 | Ga0070707_100754997 | Ga0070707_1007549972 | 148 |
| 328 | 3300005530 | Ga0070679_100108298 | Ga0070679_1001082983 | 148 |
| 329 | 3300005543 | Ga0070672_100353336 | Ga0070672_1003533361 | 148 |
| 330 | 3300005548 | Ga0070665_100019136 | Ga0070665_1000191362 | 148 |
| 331 | 3300005548 | Ga0070665_100253004 | Ga0070665_1002530041 | 148 |
| 332 | 3300005548 | Ga0070665_100253295 | Ga0070665_1002532951 | 148 |
| 333 | 3300005548 | Ga0070665_101128039 | Ga0070665_1011280392 | 148 |
| 334 | 3300005563 | Ga0068855_100006829 | Ga0068855_10000682916 | 148 |
| 335 | 3300005563 | Ga0068855_100015930 | Ga0068855_1000159304 | 148 |
| 336 | 3300005563 | Ga0068855_100169211 | Ga0068855_1001692113 | 148 |
| 337 | 3300005563 | Ga0068855_100335613 | Ga0068855_1003356132 | 148 |
| 338 | 3300005563 | Ga0068855_101801654 | Ga0068855_1018016542 | 148 |
| 339 | 3300005563 | Ga0068855_102493919 | Ga0068855_1024939191 | 148 |
| 340 | 3300005577 | Ga0068857_101768012 | Ga0068857_1017680122 | 148 |
| 341 | 3300005578 | Ga0068854_100130141 | Ga0068854_1001301413 | 148 |
| 342 | 3300005614 | Ga0068856_100217978 | Ga0068856_1002179783 | 148 |
| 343 | 3300005614 | Ga0068856_101023643 | Ga0068856_1010236432 | 148 |
| 344 | 3300005616 | Ga0068852_100018634 | Ga0068852_1000186342 | 148 |
| 345 | 3300005616 | Ga0068852_100220919 | Ga0068852_1002209193 | 148 |
| 346 | 3300005616 | Ga0068852_100735929 | Ga0068852_1007359292 | 148 |
| 347 | 3300005616 | Ga0068852_100742037 | Ga0068852_1007420372 | 148 |
| 348 | 3300005616 | Ga0068852_101549171 | Ga0068852_1015491711 | 148 |
| 349 | 3300005616 | Ga0068852_102318194 | Ga0068852_1023181941 | 148 |
| 350 | 3300005618 | Ga0068864_100133266 | Ga0068864_1001332662 | 148 |
| 351 | 3300005841 | Ga0068863_100098039 | Ga0068863_1000980393 | 148 |
| 352 | 3300009093 | Ga0105240_10000648 | Ga0105240_1000064817 | 148 |
| 353 | 3300009093 | Ga0105240_10880038 | Ga0105240_108800382 | 148 |
| 354 | 3300009174 | Ga0105241_10436862 | Ga0105241_104368622 | 148 |
| 355 | 3300009174 | Ga0105241_10662275 | Ga0105241_106622752 | 148 |
| 356 | 3300009177 | Ga0105248_10020720 | Ga0105248_100207206 | 148 |
| 357 | 3300009177 | Ga0105248_10111934 | Ga0105248_101119342 | 148 |
| 358 | 3300009177 | Ga0105248_11005751 | Ga0105248_110057512 | 148 |
| 359 | 3300009551 | Ga0105238_10017249 | Ga0105238_100172493 | 148 |
| 360 | 3300009551 | Ga0105238_10020194 | Ga0105238_100201949 | 148 |
| 361 | 3300013102 | Ga0157371_10126492 | Ga0157371_101264922 | 148 |
| 362 | 3300013104 | Ga0157370_10019731 | Ga0157370_100197314 | 148 |
| 363 | 3300013104 | Ga0157370_10055021 | Ga0157370_100550214 | 148 |
| 364 | 3300013104 | Ga0157370_10078401 | Ga0157370_100784012 | 148 |
| 365 | 3300013104 | Ga0157370_10290357 | Ga0157370_102903572 | 148 |
| 366 | 3300013105 | Ga0157369_10070093 | Ga0157369_100700932 | 148 |
| 367 | 3300013105 | Ga0157369_10116220 | Ga0157369_101162203 | 148 |
| 368 | 3300013105 | Ga0157369_10202247 | Ga0157369_102022472 | 148 |
| 369 | 3300013105 | Ga0157369_10318466 | Ga0157369_103184661 | 148 |
| 370 | 3300013105 | Ga0157369_10794403 | Ga0157369_107944032 | 148 |
| 371 | 3300013105 | Ga0157369_10889976 | Ga0157369_108899762 | 148 |
| 372 | 3300013105 | Ga0157369_10908100 | Ga0157369_109081002 | 148 |
| 373 | 3300013296 | Ga0157374_10137904 | Ga0157374_101379042 | 148 |
| 374 | 3300013296 | Ga0157374_10162701 | Ga0157374_101627012 | 148 |
| 375 | 3300013296 | Ga0157374_10246554 | Ga0157374_102465542 | 148 |
| 376 | 3300013296 | Ga0157374_10587645 | Ga0157374_105876452 | 148 |
| 377 | 3300013296 | Ga0157374_11572506 | Ga0157374_115725061 | 148 |
| 378 | 3300013306 | Ga0163162_10003188 | Ga0163162_1000318812 | 148 |
| 379 | 3300013306 | Ga0163162_10372895 | Ga0163162_103728952 | 148 |
| 380 | 3300013307 | Ga0157372_10062187 | Ga0157372_100621872 | 148 |
| 381 | 3300013307 | Ga0157372_10078978 | Ga0157372_100789785 | 148 |
| 382 | 3300013307 | Ga0157372_10186141 | Ga0157372_101861412 | 148 |
| 383 | 3300013307 | Ga0157372_10256629 | Ga0157372_102566292 | 148 |
| 384 | 3300013307 | Ga0157372_10387656 | Ga0157372_103876562 | 148 |
| 385 | 3300013308 | Ga0157375_10860920 | Ga0157375_108609202 | 148 |
| 386 | 3300014325 | Ga0163163_10777778 | Ga0163163_107777781 | 148 |
| 387 | 3300014968 | Ga0157379_10057230 | Ga0157379_100572303 | 148 |
| 388 | 3300014968 | Ga0157379_10104554 | Ga0157379_101045542 | 148 |
| 389 | 3300014969 | Ga0157376_10107552 | Ga0157376_101075523 | 148 |
| 390 | 3300014969 | Ga0157376_10247252 | Ga0157376_102472522 | 148 |
| 391 | 3300014969 | Ga0157376_10393800 | Ga0157376_103938002 | 148 |
| 392 | 3300020069 | Ga0197907_10327289 | Ga0197907_103272892 | 148 |
| 393 | 3300025909 | Ga0207705_10004549 | Ga0207705_100045494 | 148 |
| 394 | 3300025909 | Ga0207705_10028162 | Ga0207705_100281623 | 148 |
| 395 | 3300025909 | Ga0207705_10036049 | Ga0207705_100360493 | 148 |
| 396 | 3300025909 | Ga0207705_10434522 | Ga0207705_104345222 | 148 |
| 397 | 3300025913 | Ga0207695_10000448 | Ga0207695_1000044868 | 148 |
| 398 | 3300025913 | Ga0207695_10339143 | Ga0207695_103391432 | 148 |
| 399 | 3300025917 | Ga0207660_10383228 | Ga0207660_103832282 | 148 |
| 400 | 3300025919 | Ga0207657_10111548 | Ga0207657_101115482 | 148 |
| 401 | 3300025919 | Ga0207657_10131538 | Ga0207657_101315383 | 148 |
| 402 | 3300025920 | Ga0207649_10102438 | Ga0207649_101024382 | 148 |
| 403 | 3300025921 | Ga0207652_10120227 | Ga0207652_101202272 | 148 |
| 404 | 3300025924 | Ga0207694_10100014 | Ga0207694_101000142 | 148 |
| 405 | 3300025924 | Ga0207694_10116379 | Ga0207694_101163792 | 148 |
| 406 | 3300025924 | Ga0207694_10921030 | Ga0207694_109210302 | 148 |
| 407 | 3300025928 | Ga0207700_10538882 | Ga0207700_105388822 | 148 |
| 408 | 3300025929 | Ga0207664_10174077 | Ga0207664_101740772 | 148 |
| 409 | 3300025929 | Ga0207664_10489989 | Ga0207664_104899892 | 148 |
| 410 | 3300025931 | Ga0207644_10001821 | Ga0207644_100018216 | 148 |
| 411 | 3300025941 | Ga0207711_10051178 | Ga0207711_100511783 | 148 |
| 412 | 3300025941 | Ga0207711_10481118 | Ga0207711_104811182 | 148 |
| 413 | 3300025944 | Ga0207661_10773719 | Ga0207661_107737192 | 148 |
| 414 | 3300025949 | Ga0207667_10001856 | Ga0207667_100018563 | 148 |
| 415 | 3300025949 | Ga0207667_10018535 | Ga0207667_100185356 | 148 |
| 416 | 3300025949 | Ga0207667_10101174 | Ga0207667_101011743 | 148 |
| 417 | 3300025949 | Ga0207667_10181704 | Ga0207667_101817042 | 148 |
| 418 | 3300025981 | Ga0207640_10034309 | Ga0207640_100343093 | 148 |
| 419 | 3300026041 | Ga0207639_10020184 | Ga0207639_100201843 | 148 |
| 420 | 3300026067 | Ga0207678_10003811 | Ga0207678_100038118 | 148 |
| 421 | 3300026067 | Ga0207678_10283684 | Ga0207678_102836842 | 148 |
| 422 | 3300026078 | Ga0207702_10479236 | Ga0207702_104792362 | 148 |
| 423 | 3300026088 | Ga0207641_10125369 | Ga0207641_101253693 | 148 |
| 424 | 3300026095 | Ga0207676_10128554 | Ga0207676_101285543 | 148 |
| 425 | 3300026121 | Ga0207683_10304537 | Ga0207683_103045373 | 148 |
| 426 | 3300026142 | Ga0207698_10095546 | Ga0207698_100955462 | 148 |
| 427 | 3300026142 | Ga0207698_10350746 | Ga0207698_103507462 | 148 |
| 428 | 3300028379 | Ga0268266_10145491 | Ga0268266_101454912 | 148 |
| 429 | 3300028379 | Ga0268266_10212025 | Ga0268266_102120253 | 148 |
| 430 | 3300028379 | Ga0268266_10212283 | Ga0268266_102122833 | 148 |
| 431 | 3300033180 | Ga0307510_10081045 | Ga0307510_100810453 | 148 |
| 432 | 3300035725 | Ga0373947_0662834 | Ga0373947_0662834_196_642 | 148 |
| 433 | 3300037068 | Ga0373925_0335342 | Ga0373925_0335342_507_953 | 148 |
| 434 | 3300044684 | Ga0466966_0348255 | Ga0466966_0348255_299_745 | 148 |
| 435 | 3300044693 | Ga0466961_0228313 | Ga0466961_0228313_112_558 | 148 |
| 436 | 3300046455 | Ga0495603_0014346 | Ga0495603_0014346_1914_2360 | 148 |
| 437 | 3300046455 | Ga0495603_0131756 | Ga0495603_0131756_526_972 | 148 |
| 438 | 3300046459 | Ga0495629_0007401 | Ga0495629_0007401_6454_6900 | 148 |
| 439 | 3300046459 | Ga0495629_0026812 | Ga0495629_0026812_3581_4027 | 148 |
| 440 | 3300046462 | Ga0495651_0037581 | Ga0495651_0037581_3048_3494 | 148 |
| 441 | 3300046463 | Ga0495653_0003062 | Ga0495653_0003062_11215_11661 | 148 |
| 442 | 3300046471 | Ga0495650_0000009 | Ga0495650_0000009_240276_240722 | 148 |
| 443 | 3300046471 | Ga0495650_0007486 | Ga0495650_0007486_3135_3581 | 148 |
| 444 | 3300046472 | Ga0495580_0445265 | Ga0495580_0445265_45_491 | 148 |
| 445 | 3300046473 | Ga0495582_0005041 | Ga0495582_0005041_6878_7324 | 148 |
| 446 | 3300046473 | Ga0495582_0104293 | Ga0495582_0104293_198_644 | 148 |
| 447 | 3300046475 | Ga0495639_0002336 | Ga0495639_0002336_3866_4312 | 148 |
| 448 | 3300046476 | Ga0495662_0000859 | Ga0495662_0000859_8333_8779 | 148 |
| 449 | 3300046477 | Ga0495664_0057438 | Ga0495664_0057438_1353_1799 | 148 |
| 450 | 3300046492 | Ga0495585_0122016 | Ga0495585_0122016_597_1043 | 148 |
| 451 | 3300046499 | Ga0495594_0000950 | Ga0495594_0000950_6826_7272 | 148 |
| 452 | 3300046499 | Ga0495594_0021463 | Ga0495594_0021463_2643_3089 | 148 |
| 453 | 3300046501 | Ga0495607_0043684 | Ga0495607_0043684_39_485 | 148 |
| 454 | 3300046507 | Ga0495606_0075445 | Ga0495606_0075445_1558_2004 | 148 |
| 455 | 3300046507 | Ga0495606_0084270 | Ga0495606_0084270_123_569 | 148 |
| 456 | 3300046507 | Ga0495606_0424296 | Ga0495606_0424296_151_597 | 148 |
| 457 | 3300046511 | Ga0495608_0548364 | Ga0495608_0548364_103_549 | 148 |
| 458 | 3300046514 | Ga0495618_0171328 | Ga0495618_0171328_77_523 | 148 |
| 459 | 3300046517 | Ga0495630_0086310 | Ga0495630_0086310_700_1146 | 148 |
| 460 | 3300046523 | Ga0495644_0000936 | Ga0495644_0000936_5592_6038 | 148 |
| 461 | 3300046526 | Ga0495666_0000909 | Ga0495666_0000909_11812_12258 | 148 |
| 462 | 3300046528 | Ga0495642_0013648 | Ga0495642_0013648_722_1168 | 148 |
| 463 | 3300046528 | Ga0495642_0157834 | Ga0495642_0157834_340_786 | 148 |
| 464 | 3300046529 | Ga0495652_0008184 | Ga0495652_0008184_5389_5835 | 148 |
| 465 | 3300046531 | Ga0495665_0012132 | Ga0495665_0012132_4133_4579 | 148 |
| 466 | 3300046533 | Ga0495640_0004442 | Ga0495640_0004442_1532_1978 | 148 |
| 467 | 3300046535 | Ga0495586_0002177 | Ga0495586_0002177_9873_10319 | 148 |
| 468 | 3300046538 | Ga0495609_0011733 | Ga0495609_0011733_1155_1601 | 148 |
| 469 | 3300046543 | Ga0495645_0002766 | Ga0495645_0002766_3728_4174 | 148 |
| 470 | 3300046543 | Ga0495645_0082315 | Ga0495645_0082315_910_1359 | 148 |
| 471 | 3300046559 | Ga0495667_0018941 | Ga0495667_0018941_3321_3767 | 148 |
| 472 | 3300046642 | Ga0495634_0008753 | Ga0495634_0008753_2821_3267 | 148 |
| 473 | 3300046660 | Ga0495625_0001513 | Ga0495625_0001513_16238_16684 | 148 |
| 474 | 3300046660 | Ga0495625_0006994 | Ga0495625_0006994_5046_5492 | 148 |
| 475 | 3300046660 | Ga0495625_0074975 | Ga0495625_0074975_736_1182 | 148 |
| 476 | 3300046660 | Ga0495625_0618045 | Ga0495625_0618045_10_456 | 148 |
| 477 | 3300046663 | Ga0495635_0001183 | Ga0495635_0001183_77_523 | 148 |
| 478 | 3300046675 | Ga0495657_0206336 | Ga0495657_0206336_361_807 | 148 |
| 479 | 3300046678 | Ga0495599_0004552 | Ga0495599_0004552_2303_2749 | 148 |
| 480 | 3300046678 | Ga0495599_0415842 | Ga0495599_0415842_302_748 | 148 |
| 481 | 3300046680 | Ga0495646_0461510 | Ga0495646_0461510_27_473 | 148 |
| 482 | 3300046684 | Ga0495669_0000816 | Ga0495669_0000816_2362_2808 | 148 |
| 483 | 3300046689 | Ga0495613_0001246 | Ga0495613_0001246_13506_13952 | 148 |
| 484 | 3300046689 | Ga0495613_0040046 | Ga0495613_0040046_1704_2150 | 148 |
| 485 | 3300046690 | Ga0495624_0015784 | Ga0495624_0015784_3728_4174 | 148 |
| 486 | 3300046794 | Ga0495589_0284655 | Ga0495589_0284655_296_742 | 148 |
| 487 | 3300046809 | Ga0495600_0023564 | Ga0495600_0023564_879_1325 | 148 |
| 488 | 3300046809 | Ga0495600_0807402 | Ga0495600_0807402_62_508 | 148 |
| 489 | 3300047315 | Ga0495581_0007980 | Ga0495581_0007980_3821_4267 | 148 |
| 490 | 3300047315 | Ga0495581_0029917 | Ga0495581_0029917_318_764 | 148 |
| 491 | 3300047317 | Ga0495604_0000846 | Ga0495604_0000846_15729_16175 | 148 |
| 492 | 3300047317 | Ga0495604_0072759 | Ga0495604_0072759_1528_1974 | 148 |
| 493 | 3300047319 | Ga0495674_0046974 | Ga0495674_0046974_2205_2651 | 148 |
| 494 | 3300047319 | Ga0495674_0061705 | Ga0495674_0061705_1919_2365 | 148 |
| 495 | 3300047320 | Ga0495672_0002389 | Ga0495672_0002389_14527_14973 | 148 |
| 496 | 3300047320 | Ga0495672_0443603 | Ga0495672_0443603_77_523 | 148 |
| 497 | 3300047321 | Ga0495676_0020124 | Ga0495676_0020124_2598_3044 | 148 |
| 498 | 3300047322 | Ga0495680_0272694 | Ga0495680_0272694_319_765 | 148 |
| 499 | 3300047323 | Ga0495683_0039623 | Ga0495683_0039623_77_523 | 148 |
| 500 | 3300047444 | Ga0495675_0009912 | Ga0495675_0009912_5408_5854 | 148 |
| 501 | 3300047471 | Ga0495684_0115163 | Ga0495684_0115163_1533_1979 | 148 |
| 502 | 3300047472 | Ga0495686_0003013 | Ga0495686_0003013_575_1024 | 148 |
| 503 | 3300047472 | Ga0495686_0465816 | Ga0495686_0465816_23_469 | 148 |
| 504 | 3300047673 | Ga0495593_0081322 | Ga0495593_0081322_1139_1585 | 148 |
| 505 | 3300048088 | Ga0495602_0182120 | Ga0495602_0182120_960_1409 | 148 |
| 506 | 3300048089 | Ga0495614_0000493 | Ga0495614_0000493_13312_13758 | 148 |
| 507 | 3300048089 | Ga0495614_0016600 | Ga0495614_0016600_1784_2230 | 148 |
| 508 | 3300048907 | Ga0496104_0299897 | Ga0496104_0299897_100_546 | 148 |
| 509 | 3300048913 | Ga0496110_0487102 | Ga0496110_0487102_418_864 | 148 |
| 510 | 3300048915 | Ga0496112_0128687 | Ga0496112_0128687_1202_1648 | 148 |
| 511 | 3300048915 | Ga0496112_1073418 | Ga0496112_1073418_139_585 | 148 |
| 512 | 3300048917 | Ga0496114_1420226 | Ga0496114_1420226_14_460 | 148 |
| 513 | 3300048918 | Ga0496115_0145800 | Ga0496115_0145800_1154_1600 | 148 |
| 514 | 3300048929 | Ga0496126_0000004 | Ga0496126_0000004_289565_290011 | 148 |
| 515 | 3300048929 | Ga0496126_0260357 | Ga0496126_0260357_425_871 | 148 |
| 516 | 3300049460 | Ga0495682_0014348 | Ga0495682_0014348_639_1085 | 148 |
| 517 | 3300049460 | Ga0495682_0102222 | Ga0495682_0102222_211_657 | 148 |
| 518 | 3300049568 | Ga0501031_0003773 | Ga0501031_0003773_3361_3807 | 148 |
| 519 | 3300049569 | Ga0501032_0000447 | Ga0501032_0000447_13173_13619 | 148 |
| 520 | 3300049569 | Ga0501032_0323761 | Ga0501032_0323761_413_859 | 148 |
| 521 | 3300049570 | Ga0501033_0000977 | Ga0501033_0000977_17289_17735 | 148 |
| 522 | 3300049570 | Ga0501033_0247241 | Ga0501033_0247241_517_963 | 148 |
| 523 | 3300049571 | Ga0501034_0002362 | Ga0501034_0002362_9739_10185 | 148 |
| 524 | 3300049572 | Ga0501036_0000747 | Ga0501036_0000747_2363_2809 | 148 |
| 525 | 3300049572 | Ga0501036_0555361 | Ga0501036_0555361_101_547 | 148 |
| 526 | 3300049573 | Ga0501037_0003466 | Ga0501037_0003466_9011_9457 | 148 |
| 527 | 3300049573 | Ga0501037_0194717 | Ga0501037_0194717_390_836 | 148 |
| 528 | 3300049573 | Ga0501037_1133153 | Ga0501037_1133153_21_467 | 148 |
| 529 | 3300049574 | Ga0501038_0002758 | Ga0501038_0002758_12848_13294 | 148 |
| 530 | 3300049574 | Ga0501038_0071498 | Ga0501038_0071498_1141_1587 | 148 |
| 531 | 3300049579 | Ga0501043_0001025 | Ga0501043_0001025_9739_10185 | 148 |
| 532 | 3300049579 | Ga0501043_0443884 | Ga0501043_0443884_361_807 | 148 |
| 533 | 3300049580 | Ga0501046_0001776 | Ga0501046_0001776_19330_19776 | 148 |
| 534 | 3300049581 | Ga0501047_0005256 | Ga0501047_0005256_9320_9766 | 148 |
| 535 | 3300049581 | Ga0501047_0216470 | Ga0501047_0216470_1216_1662 | 148 |
| 536 | 3300049584 | Ga0501068_0283194 | Ga0501068_0283194_256_702 | 148 |
| 537 | 3300049586 | Ga0501070_0022776 | Ga0501070_0022776_2874_3320 | 148 |
| 538 | 3300049586 | Ga0501070_0135799 | Ga0501070_0135799_1476_1922 | 148 |
| 539 | 3300049589 | Ga0501073_0070325 | Ga0501073_0070325_546_992 | 148 |
| 540 | 3300049590 | Ga0501074_0041693 | Ga0501074_0041693_2111_2557 | 148 |
| 541 | 3300049742 | Ga0501080_0023120 | Ga0501080_0023120_2342_2788 | 148 |
| 542 | 3300049742 | Ga0501080_1208722 | Ga0501080_1208722_151_597 | 148 |
| 543 | 3300049822 | Ga0501035_0002312 | Ga0501035_0002312_9295_9741 | 148 |
| 544 | 3300049822 | Ga0501035_0133005 | Ga0501035_0133005_846_1292 | 148 |
| 545 | 3300049823 | Ga0501044_0057455 | Ga0501044_0057455_2726_3172 | 148 |
| 546 | 3300049823 | Ga0501044_0436715 | Ga0501044_0436715_324_770 | 148 |
| 547 | 3300049823 | Ga0501044_0783816 | Ga0501044_0783816_35_481 | 148 |
| 548 | 3300049824 | Ga0501045_0309035 | Ga0501045_0309035_114_560 | 148 |
| 549 | 3300053093 | Ga0500651_0000020 | Ga0500651_0000020_132666_133112 | 148 |
| 550 | 3300053119 | Ga0500595_000020 | Ga0500595_000020_148584_149030 | 148 |
| 551 | 3300053119 | Ga0500595_009804 | Ga0500595_009804_917_1363 | 148 |
| 552 | 3300055283 | Ga0500661_009937 | Ga0500661_009937_38_484 | 148 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ej9-assembly1.cif.gz_A | crystal structure of biotin protein ligase from methanococcus jannaschii | 0.8755 | 59 | 109 |
| 3sb2-assembly1.cif.gz_B | crystal structure of the rna chaperone hfq from herbaspirillum seropedicae smr1 | 0.7711 | 47 | 109 |
| 4jrk-assembly1.cif.gz_C-2 | crystal structure of escherichia coli hfq surface mutant | 0.7693 | 49 | 109 |
| 3qsu-assembly1.cif.gz_A | structure of staphylococcus aureus hfq in complex with a7 rna | 0.7603 | 48 | 110 |
| 4jli-assembly1.cif.gz_B-2 | crystal structure of escherichia coli hfq proximal pore mutant | 0.7555 | 50 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYW7_1_63_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.8485 | 58 | 112 | 2.30.30.100 |
| 2ej9A02 | Mainly Beta;Roll;SH3 type barrels.; | 0.8461 | 59 | 109 | 2.30.30.100 |
| af_Q2FYW9_1_64_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.8162 | 50 | 113 | 2.30.30.100 |
| af_Q2FYW9_1_64_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.7815 | 50 | 113 | 2.30.30.100 |
| 3qsuF00 | Mainly Beta;Roll;SH3 type barrels.; | 0.7728 | 48 | 110 | 2.30.30.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840DR02-F1-model_v4 | LSM domain protein | 0.8236 | 54 | 113 |
|
| AF-A0A1L8MKA6-F1-model_v4 | LSM domain protein | 0.8179 | 52 | 112 |
|
| AF-A0A6I1UI50-F1-model_v4 | Uncharacterized protein | 0.817 | 52 | 112 |
|
| AF-A0A2T4PJY5-F1-model_v4 | LSM domain protein | 0.8144 | 56 | 114 |
|
| AF-A0A2T4LLS1-F1-model_v4 | LSM domain protein | 0.8139 | 50 | 113 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar