F462694

General Info

Members Datasets Scaffolds Average Seq Length
552 244 551 143

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100058532|Ga0070714_1000585322
Length 149
Sequence MSIEAQEASRQEQLAQVNPDEQEVAAGREREQLEGWIPEMASEADVREALEKAFDYRGDITITRKDGSKVEGYVFDRRNGRSLDDSYVRVIPSGQQRTKLTVPYAEIAALAFTGRDTAAGKTFEAWVKKYWEKKAAGETNIQIEPEKLD

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 1.99
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 3.8
Rhizosphere 94.2
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10014514 3300005327 Bacteria 6322
2 Ga0070658_10025306 3300005327 Bacteria 4759
3 Ga0070658_10071080 3300005327 Bacteria 2850
4 Ga0070658_10796204 3300005327 Unclassified 821
5 Ga0070683_100015441 3300005329 Bacteria 6708
6 Ga0070683_100170919 3300005329 Bacteria 2063
7 Ga0070683_100321822 3300005329 Bacteria 1472
8 Ga0070683_101349983 3300005329 Unclassified 685
9 Ga0070666_10483981 3300005335 Bacteria 896
10 Ga0070680_100189811 3300005336 Bacteria 1731
11 Ga0070680_100562203 3300005336 Bacteria 978
12 Ga0070680_101128741 3300005336 Bacteria 677
13 Ga0070682_100929107 3300005337 Bacteria 717
14 Ga0070660_100069635 3300005339 Bacteria 2744
15 Ga0070660_100141584 3300005339 Bacteria 1930
16 Ga0070692_10743060 3300005345 Bacteria 664
17 Ga0070671_100082244 3300005355 Bacteria 2692
18 Ga0070673_100357127 3300005364 Bacteria 1298
19 Ga0070659_101553339 3300005366 Unclassified 590
20 Ga0070709_10606208 3300005434 Unclassified 843
21 Ga0070709_11159941 3300005434 Bacteria 620
22 Ga0070714_100058532 3300005435 Bacteria 3301
23 Ga0070714_100115097 3300005435 Bacteria 2386
24 Ga0070714_100587806 3300005435 Bacteria 1068
25 Ga0070714_100985186 3300005435 Unclassified 820
26 Ga0070713_100007913 3300005436 Bacteria 7504
27 Ga0070713_100016290 3300005436 Bacteria 5588
28 Ga0070713_100021870 3300005436 Bacteria 4930
29 Ga0070713_100117512 3300005436 Bacteria 2327
30 Ga0070713_100167558 3300005436 Bacteria 1965
31 Ga0070713_100477364 3300005436 Bacteria 1174
32 Ga0070713_101087825 3300005436 Bacteria 772
33 Ga0070713_101900074 3300005436 Unclassified 578
34 Ga0070710_10015469 3300005437 Bacteria 3864
35 Ga0070710_10213308 3300005437 Bacteria 1225
36 Ga0070710_10669067 3300005437 Unclassified 730
37 Ga0070710_11340319 3300005437 Bacteria 533
38 Ga0070711_100178493 3300005439 Bacteria 1624
39 Ga0070711_100333615 3300005439 Bacteria 1215
40 Ga0070711_100352284 3300005439 Bacteria 1184
41 Ga0070711_100905932 3300005439 Unclassified 753
42 Ga0070678_100063876 3300005456 Bacteria 2726
43 Ga0070678_100411302 3300005456 Unclassified 1177
44 Ga0070681_10025159 3300005458 Bacteria 5990
45 Ga0070681_10059397 3300005458 Bacteria 3804
46 Ga0070681_10072842 3300005458 Bacteria 3397
47 Ga0070681_10075854 3300005458 Bacteria 3322
48 Ga0070681_10242035 3300005458 Bacteria 1718
49 Ga0070706_100934373 3300005467 Unclassified 801
50 Ga0070707_100754997 3300005468 Unclassified 936
51 Ga0070699_100212854 3300005518 Bacteria 1721
52 Ga0070699_100527762 3300005518 Bacteria 1074
53 Ga0070679_100108298 3300005530 Bacteria 2765
54 Ga0070679_100202821 3300005530 Bacteria 1948
55 Ga0070679_100919151 3300005530 Bacteria 819
56 Ga0070679_101294282 3300005530 Unclassified 675
57 Ga0070684_100028447 3300005535 Bacteria 4728
58 Ga0070684_100485507 3300005535 Bacteria 1144
59 Ga0070684_102239044 3300005535 Bacteria 515
60 Ga0068853_100026875 3300005539 Bacteria 4835
61 Ga0068853_100027051 3300005539 Bacteria 4819
62 Ga0068853_100034787 3300005539 Bacteria 4277
63 Ga0068853_100906484 3300005539 Bacteria 847
64 Ga0070672_100353336 3300005543 Bacteria 1253
65 Ga0070693_100290227 3300005547 Bacteria 1099
66 Ga0070665_100019136 3300005548 Bacteria 6870
67 Ga0070665_100039408 3300005548 Bacteria 4751
68 Ga0070665_100253004 3300005548 Bacteria 1762
69 Ga0070665_100253295 3300005548 Bacteria 1761
70 Ga0070665_101128039 3300005548 Bacteria 795
71 Ga0068855_100006829 3300005563 Bacteria 13845
72 Ga0068855_100015930 3300005563 Bacteria 9044
73 Ga0068855_100045695 3300005563 Bacteria 5179
74 Ga0068855_100169211 3300005563 Bacteria 2475
75 Ga0068855_100335613 3300005563 Bacteria 1668
76 Ga0068855_100762172 3300005563 Bacteria 1031
77 Ga0068855_101801654 3300005563 Bacteria 622
78 Ga0068855_102493919 3300005563 Bacteria 515
79 Ga0070664_100087128 3300005564 Bacteria 2699
80 Ga0070664_100638767 3300005564 Bacteria 989
81 Ga0068857_100376677 3300005577 Bacteria 1317
82 Ga0068857_101768012 3300005577 Bacteria 605
83 Ga0068854_100130141 3300005578 Bacteria 1921
84 Ga0068854_101354883 3300005578 Bacteria 642
85 Ga0068854_101626006 3300005578 Unclassified 589
86 Ga0068856_100217978 3300005614 Bacteria 1923
87 Ga0068856_100487536 3300005614 Bacteria 1254
88 Ga0068856_101023643 3300005614 Bacteria 844
89 Ga0068856_101897836 3300005614 Unclassified 607
90 Ga0068852_100017759 3300005616 Bacteria 5589
91 Ga0068852_100018634 3300005616 Bacteria 5471
92 Ga0068852_100220919 3300005616 Bacteria 1802
93 Ga0068852_100288887 3300005616 Bacteria 1583
94 Ga0068852_100646669 3300005616 Unclassified 1064
95 Ga0068852_100735929 3300005616 Bacteria 998
96 Ga0068852_100742037 3300005616 Bacteria 994
97 Ga0068852_100917260 3300005616 Bacteria 893
98 Ga0068852_101549171 3300005616 Bacteria 685
99 Ga0068852_102318194 3300005616 Bacteria 558
100 Ga0068864_100133266 3300005618 Bacteria 2235
101 Ga0068851_10271645 3300005834 Bacteria 967
102 Ga0068863_100098039 3300005841 Bacteria 2784
103 Ga0068858_100071940 3300005842 Bacteria 3208
104 Ga0068858_100156242 3300005842 Bacteria 2146
105 Ga0068862_101053830 3300005844 Bacteria 806
106 Ga0070717_10008710 3300006028 Bacteria 7591
107 Ga0070717_10036116 3300006028 Bacteria 4005
108 Ga0070717_10044242 3300006028 Bacteria 3635
109 Ga0070717_10098596 3300006028 Bacteria 2477
110 Ga0070717_10125800 3300006028 Bacteria 2201
111 Ga0070717_10131082 3300006028 Unclassified 2156
112 Ga0070717_10188056 3300006028 Bacteria 1803
113 Ga0070717_10274444 3300006028 Unclassified 1494
114 Ga0070715_10251404 3300006163 Unclassified 924
115 Ga0070715_10516676 3300006163 Bacteria 686
116 Ga0070715_10517877 3300006163 Bacteria 686
117 Ga0070716_100091591 3300006173 Bacteria 1841
118 Ga0070712_100153647 3300006175 Bacteria 1770
119 Ga0070712_100298334 3300006175 Bacteria 1303
120 Ga0070712_100629585 3300006175 Bacteria 910
121 Ga0097621_101002836 3300006237 Unclassified 781
122 Ga0075434_100223189 3300006871 Bacteria 1904
123 Ga0075436_100285667 3300006914 Bacteria 1180
124 Ga0105240_10000648 3300009093 Bacteria 64281
125 Ga0105240_10053944 3300009093 Bacteria 5041
126 Ga0105240_10179932 3300009093 Bacteria 2496
127 Ga0105240_10352994 3300009093 Bacteria 1668
128 Ga0105240_10831422 3300009093 Unclassified 998
129 Ga0105240_10880038 3300009093 Bacteria 965
130 Ga0105240_11328501 3300009093 Bacteria 758
131 Ga0105240_11353663 3300009093 Unclassified 749
132 Ga0105245_10076381 3300009098 Bacteria 3051
133 Ga0105247_10572667 3300009101 Bacteria 833
134 Ga0105241_10158769 3300009174 Bacteria 1857
135 Ga0105241_10436862 3300009174 Bacteria 1155
136 Ga0105241_10662275 3300009174 Bacteria 949
137 Ga0105241_10868752 3300009174 Bacteria 835
138 Ga0105241_11340367 3300009174 Unclassified 683
139 Ga0105242_10048107 3300009176 Bacteria 3465
140 Ga0105248_10020720 3300009177 Bacteria 7285
141 Ga0105248_10111934 3300009177 Bacteria 3079
142 Ga0105248_10909507 3300009177 Unclassified 994
143 Ga0105248_11005751 3300009177 Bacteria 942
144 Ga0105237_10535473 3300009545 Bacteria 1178
145 Ga0105238_10017249 3300009551 Bacteria 7335
146 Ga0105238_10020194 3300009551 Bacteria 6781
147 Ga0105238_10040781 3300009551 Bacteria 4703
148 Ga0105238_10217164 3300009551 Bacteria 1888
149 Ga0105238_10293852 3300009551 Bacteria 1607
150 Ga0105238_10503174 3300009551 Unclassified 1213
151 Ga0105238_10583747 3300009551 Bacteria 1124
152 Ga0105238_10634819 3300009551 Bacteria 1077
153 Ga0105238_11857736 3300009551 Bacteria 635
154 Ga0105249_10056030 3300009553 Bacteria 3609
155 Ga0099796_10029684 3300010159 Bacteria 1767
156 Ga0099796_10054408 3300010159 Unclassified 1399
157 Ga0099796_10151068 3300010159 Unclassified 914
158 Ga0105239_10545360 3300010375 Bacteria 1320
159 Ga0105239_11082445 3300010375 Unclassified 922
160 Ga0105239_11154712 3300010375 Bacteria 892
161 Ga0105239_11207379 3300010375 Unclassified 872
162 Ga0105239_13279215 3300010375 Unclassified 527
163 Ga0157373_10053933 3300013100 Bacteria 2858
164 Ga0157371_10126492 3300013102 Bacteria 1818
165 Ga0157371_10161609 3300013102 Bacteria 1600
166 Ga0157370_10019731 3300013104 Bacteria 6748
167 Ga0157370_10055021 3300013104 Bacteria 3793
168 Ga0157370_10078401 3300013104 Bacteria 3111
169 Ga0157370_10254674 3300013104 Bacteria 1623
170 Ga0157370_10290357 3300013104 Bacteria 1510
171 Ga0157369_10015156 3300013105 Bacteria 8701
172 Ga0157369_10033391 3300013105 Bacteria 5655
173 Ga0157369_10070093 3300013105 Bacteria 3766
174 Ga0157369_10116220 3300013105 Bacteria 2841
175 Ga0157369_10202247 3300013105 Bacteria 2084
176 Ga0157369_10238339 3300013105 Bacteria 1900
177 Ga0157369_10318466 3300013105 Bacteria 1617
178 Ga0157369_10511880 3300013105 Bacteria 1242
179 Ga0157369_10794403 3300013105 Bacteria 972
180 Ga0157369_10889976 3300013105 Bacteria 913
181 Ga0157369_10908100 3300013105 Bacteria 903
182 Ga0157374_10137904 3300013296 Bacteria 2366
183 Ga0157374_10162701 3300013296 Bacteria 2174
184 Ga0157374_10246554 3300013296 Bacteria 1757
185 Ga0157374_10587645 3300013296 Bacteria 1123
186 Ga0157374_10598141 3300013296 Bacteria 1113
187 Ga0157374_11572506 3300013296 Bacteria 681
188 Ga0163162_10003188 3300013306 Bacteria 15682
189 Ga0163162_10164268 3300013306 Bacteria 2344
190 Ga0163162_10372895 3300013306 Bacteria 1560
191 Ga0163162_10616507 3300013306 Bacteria 1210
192 Ga0157372_10046392 3300013307 Bacteria 4823
193 Ga0157372_10062187 3300013307 Bacteria 4182
194 Ga0157372_10078978 3300013307 Bacteria 3720
195 Ga0157372_10186141 3300013307 Bacteria 2405
196 Ga0157372_10256629 3300013307 Bacteria 2029
197 Ga0157372_10318396 3300013307 Bacteria 1811
198 Ga0157372_10387656 3300013307 Bacteria 1628
199 Ga0157375_10860920 3300013308 Bacteria 1052
200 Ga0163163_10777778 3300014325 Bacteria 1021
201 Ga0182008_10658141 3300014497 Unclassified 594
202 Ga0157379_10057230 3300014968 Bacteria 3484
203 Ga0157379_10104554 3300014968 Bacteria 2541
204 Ga0157376_10032731 3300014969 Bacteria 4177
205 Ga0157376_10107552 3300014969 Bacteria 2449
206 Ga0157376_10247252 3300014969 Bacteria 1664
207 Ga0157376_10393800 3300014969 Bacteria 1338
208 Ga0182007_10068098 3300015262 Unclassified 1166
209 Ga0197907_10327289 3300020069 Bacteria 594
210 Ga0197907_10726330 3300020069 Bacteria 2103
211 Ga0206356_10955734 3300020070 Bacteria 2115
212 Ga0206349_1929961 3300020075 Bacteria 1223
213 Ga0206351_10082539 3300020077 Bacteria 3179
214 Ga0206352_11306157 3300020078 Bacteria 1925
215 Ga0206350_11455148 3300020080 Bacteria 3114
216 Ga0206354_10894720 3300020081 Bacteria 1403
217 Ga0154015_1576844 3300020610 Bacteria 2673
218 Ga0213872_10002855 3300021361 Bacteria 9870
219 Ga0213872_10017431 3300021361 Bacteria 3319
220 Ga0213876_10409092 3300021384 Unclassified 722
221 Ga0213875_10022515 3300021388 Bacteria 3013
222 Ga0213871_10000715 3300021441 Bacteria 4863
223 Ga0213871_10002116 3300021441 Bacteria 3580
224 Ga0224712_10214358 3300022467 Bacteria 879
225 Ga0224712_10247017 3300022467 Bacteria 823
226 Ga0207692_10302885 3300025898 Bacteria 973
227 Ga0207692_10386411 3300025898 Unclassified 870
228 Ga0207692_10415514 3300025898 Bacteria 841
229 Ga0207692_10899043 3300025898 Unclassified 582
230 Ga0207710_10572372 3300025900 Bacteria 589
231 Ga0207699_10082386 3300025906 Bacteria 1998
232 Ga0207699_10260867 3300025906 Bacteria 1198
233 Ga0207705_10004549 3300025909 Bacteria 10470
234 Ga0207705_10028162 3300025909 Bacteria 4006
235 Ga0207705_10036049 3300025909 Bacteria 3540
236 Ga0207705_10434522 3300025909 Bacteria 1017
237 Ga0207654_11116162 3300025911 Unclassified 574
238 Ga0207707_10016112 3300025912 Bacteria 6517
239 Ga0207707_10104156 3300025912 Bacteria 2480
240 Ga0207707_10262448 3300025912 Bacteria 1498
241 Ga0207707_10531635 3300025912 Bacteria 1000
242 Ga0207695_10000448 3300025913 Bacteria 89964
243 Ga0207695_10039822 3300025913 Bacteria 5048
244 Ga0207695_10184705 3300025913 Bacteria 2005
245 Ga0207695_10246912 3300025913 Bacteria 1685
246 Ga0207695_10339143 3300025913 Bacteria 1391
247 Ga0207695_10733430 3300025913 Unclassified 868
248 Ga0207695_11122290 3300025913 Unclassified 666
249 Ga0207671_10417763 3300025914 Bacteria 1067
250 Ga0207693_10009654 3300025915 Bacteria 7857
251 Ga0207693_10051582 3300025915 Bacteria 3228
252 Ga0207663_10387895 3300025916 Bacteria 1065
253 Ga0207663_10562310 3300025916 Unclassified 893
254 Ga0207660_10383228 3300025917 Bacteria 1130
255 Ga0207660_10657374 3300025917 Unclassified 855
256 Ga0207657_10111548 3300025919 Bacteria 2258
257 Ga0207657_10131538 3300025919 Bacteria 2050
258 Ga0207649_10102438 3300025920 Bacteria 1897
259 Ga0207652_10042459 3300025921 Bacteria 3871
260 Ga0207652_10120227 3300025921 Bacteria 2337
261 Ga0207652_10177633 3300025921 Bacteria 1912
262 Ga0207652_10490444 3300025921 Bacteria 1106
263 Ga0207694_10049958 3300025924 Bacteria 3238
264 Ga0207694_10100014 3300025924 Bacteria 2297
265 Ga0207694_10116379 3300025924 Bacteria 2131
266 Ga0207694_10921030 3300025924 Bacteria 739
267 Ga0207694_11042744 3300025924 Unclassified 692
268 Ga0207687_10010313 3300025927 Bacteria 6105
269 Ga0207700_10004508 3300025928 Bacteria 8224
270 Ga0207700_10014753 3300025928 Bacteria 5130
271 Ga0207700_10125809 3300025928 Bacteria 2085
272 Ga0207700_10250427 3300025928 Bacteria 1513
273 Ga0207700_10538882 3300025928 Bacteria 1035
274 Ga0207700_11335370 3300025928 Unclassified 638
275 Ga0207700_11725983 3300025928 Unclassified 552
276 Ga0207664_10014614 3300025929 Bacteria 5677
277 Ga0207664_10174077 3300025929 Bacteria 1844
278 Ga0207664_10489989 3300025929 Bacteria 1100
279 Ga0207664_11280131 3300025929 Unclassified 652
280 Ga0207644_10001821 3300025931 Bacteria 13834
281 Ga0207686_10122515 3300025934 Bacteria 1772
282 Ga0207665_10008046 3300025939 Bacteria 6956
283 Ga0207665_10277974 3300025939 Bacteria 1245
284 Ga0207665_10766319 3300025939 Unclassified 761
285 Ga0207711_10051178 3300025941 Bacteria 3537
286 Ga0207711_10481118 3300025941 Bacteria 1157
287 Ga0207661_10011549 3300025944 Bacteria 6404
288 Ga0207661_10053542 3300025944 Bacteria 3230
289 Ga0207661_10773719 3300025944 Bacteria 884
290 Ga0207679_10799052 3300025945 Bacteria 860
291 Ga0207667_10001856 3300025949 Bacteria 26550
292 Ga0207667_10018535 3300025949 Bacteria 7804
293 Ga0207667_10035213 3300025949 Bacteria 5371
294 Ga0207667_10035813 3300025949 Bacteria 5323
295 Ga0207667_10101174 3300025949 Bacteria 2973
296 Ga0207667_10181704 3300025949 Bacteria 2160
297 Ga0207667_10215264 3300025949 Bacteria 1969
298 Ga0207667_10481745 3300025949 Bacteria 1259
299 Ga0207667_11014084 3300025949 Bacteria 817
300 Ga0207667_11175990 3300025949 Unclassified 747
301 Ga0207712_10073878 3300025961 Unclassified 2460
302 Ga0207712_10418088 3300025961 Bacteria 1130
303 Ga0207640_10034309 3300025981 Bacteria 3166
304 Ga0207658_11105513 3300025986 Unclassified 724
305 Ga0207677_10008853 3300026023 Bacteria 5643
306 Ga0207639_10009836 3300026041 Bacteria 6607
307 Ga0207639_10020184 3300026041 Bacteria 4767
308 Ga0207639_10035635 3300026041 Bacteria 3683
309 Ga0207639_10109743 3300026041 Bacteria 2246
310 Ga0207639_10433891 3300026041 Bacteria 1190
311 Ga0207678_10003811 3300026067 Bacteria 13571
312 Ga0207678_10283684 3300026067 Bacteria 1422
313 Ga0207702_10296845 3300026078 Unclassified 1532
314 Ga0207702_10359215 3300026078 Bacteria 1396
315 Ga0207702_10479236 3300026078 Bacteria 1210
316 Ga0207641_10125369 3300026088 Bacteria 2298
317 Ga0207676_10128554 3300026095 Bacteria 2150
318 Ga0207674_10459247 3300026116 Bacteria 1231
319 Ga0207674_11320965 3300026116 Bacteria 691
320 Ga0207683_10090415 3300026121 Bacteria 2726
321 Ga0207683_10304537 3300026121 Bacteria 1458
322 Ga0207698_10095546 3300026142 Bacteria 2447
323 Ga0207698_10183927 3300026142 Bacteria 1854
324 Ga0207698_10337596 3300026142 Unclassified 1418
325 Ga0207698_10350746 3300026142 Bacteria 1394
326 Ga0207698_11672142 3300026142 Unclassified 652
327 Ga0268266_10055386 3300028379 Bacteria 3409
328 Ga0268266_10145491 3300028379 Bacteria 2130
329 Ga0268266_10212025 3300028379 Bacteria 1776
330 Ga0268266_10212283 3300028379 Bacteria 1775
331 Ga0265338_11076188 3300028800 Unclassified 542
332 Ga0265325_10002276 3300031241 Bacteria 13017
333 Ga0265325_10037820 3300031241 Bacteria 2549
334 Ga0265340_10087147 3300031247 Bacteria 1463
335 Ga0265331_10030349 3300031250 Bacteria 2691
336 Ga0265327_10020558 3300031251 Bacteria 4016
337 Ga0265316_10030584 3300031344 Bacteria 4411
338 Ga0265316_10206174 3300031344 Bacteria 1456
339 Ga0265316_11134329 3300031344 Bacteria 542
340 Ga0265313_10016509 3300031595 Bacteria 4241
341 Ga0265313_10065697 3300031595 Bacteria 1684
342 Ga0265342_10029865 3300031712 Bacteria 3382
343 Ga0265342_10032270 3300031712 Bacteria 3231
344 Ga0265342_10524162 3300031712 Bacteria 603
345 Ga0307510_10081045 3300033180 Bacteria 3150
346 Ga0373926_0024666 3300035083 Bacteria 2095
347 Ga0373923_0036493 3300035111 Bacteria 2006
348 Ga0373923_0422391 3300035111 Unclassified 644
349 Ga0373936_0232557 3300035113 Unclassified 820
350 Ga0373945_0017383 3300035116 Bacteria 2435
351 Ga0373957_0056071 3300035120 Bacteria 1516
352 Ga0373943_0020972 3300035170 Bacteria 3017
353 Ga0373946_0161122 3300035171 Bacteria 1053
354 Ga0373955_0723086 3300035172 Unclassified 611
355 Ga0373924_0000689 3300035410 Bacteria 10503
356 Ga0373924_0044873 3300035410 Bacteria 1817
357 Ga0373935_0019561 3300035692 Bacteria 4128
358 Ga0373935_0059018 3300035692 Bacteria 2451
359 Ga0373935_0061760 3300035692 Bacteria 2399
360 Ga0373927_0010496 3300035695 Bacteria 6174
361 Ga0373927_0097253 3300035695 Bacteria 1913
362 Ga0373933_0290233 3300035724 Bacteria 1058
363 Ga0373933_0745222 3300035724 Unclassified 644
364 Ga0373947_0021403 3300035725 Bacteria 3742
365 Ga0373947_0021599 3300035725 Bacteria 3726
366 Ga0373947_0063220 3300035725 Bacteria 2254
367 Ga0373947_0662834 3300035725 Bacteria 712
368 Ga0373937_0000422 3300036401 Bacteria 39461
369 Ga0373937_1020577 3300036401 Bacteria 776
370 Ga0373937_1410046 3300036401 Unclassified 644
371 Ga0373925_0134968 3300037068 Bacteria 1927
372 Ga0373925_0335342 3300037068 Bacteria 1226
373 Ga0373925_0495808 3300037068 Bacteria 1002
374 Ga0395898_0307293 3300037466 Bacteria 1513
375 Ga0395905_0271535 3300037471 Bacteria 1582
376 Ga0436364_0902927 3300037853 Bacteria 2600
377 Ga0436365_1896276 3300039437 Bacteria 938
378 Ga0436360_0061507 3300039438 Bacteria 9012
379 Ga0436360_0497221 3300039438 Bacteria 4928
380 Ga0436360_0546638 3300039438 Unclassified 1244
381 Ga0436361_0274684 3300039447 Bacteria 26616
382 Ga0436361_0464047 3300039447 Bacteria 78853
383 Ga0436361_0509515 3300039447 Bacteria 7573
384 Ga0436361_0893033 3300039447 Bacteria 5203
385 Ga0466966_0348255 3300044684 Bacteria 890
386 Ga0466961_0228313 3300044693 Bacteria 1146
387 Ga0466963_0078669 3300044694 Bacteria 2230
388 Ga0466958_0080876 3300045836 Bacteria 1999
389 Ga0466958_0466031 3300045836 Bacteria 819
390 Ga0466967_0125944 3300045976 Bacteria 2373
391 Ga0495603_0014346 3300046455 Bacteria 4792
392 Ga0495603_0131756 3300046455 Bacteria 1455
393 Ga0495629_0007401 3300046459 Bacteria 8090
394 Ga0495629_0026812 3300046459 Bacteria 4092
395 Ga0495629_0395884 3300046459 Bacteria 939
396 Ga0495651_0037581 3300046462 Bacteria 3770
397 Ga0495651_0047467 3300046462 Bacteria 3320
398 Ga0495653_0003062 3300046463 Bacteria 13404
399 Ga0495650_0000009 3300046471 Bacteria 653845
400 Ga0495650_0007486 3300046471 Bacteria 6549
401 Ga0495580_0101673 3300046472 Unclassified 1999
402 Ga0495580_0445265 3300046472 Bacteria 869
403 Ga0495580_0608808 3300046472 Unclassified 721
404 Ga0495582_0005041 3300046473 Bacteria 7402
405 Ga0495582_0104293 3300046473 Bacteria 1589
406 Ga0495582_0193299 3300046473 Bacteria 1161
407 Ga0495639_0002336 3300046475 Bacteria 8291
408 Ga0495639_0056476 3300046475 Bacteria 1792
409 Ga0495662_0000859 3300046476 Bacteria 14828
410 Ga0495664_0057438 3300046477 Bacteria 2315
411 Ga0495585_0122016 3300046492 Bacteria 1378
412 Ga0495594_0000950 3300046499 Bacteria 15038
413 Ga0495594_0021463 3300046499 Bacteria 3447
414 Ga0495607_0043684 3300046501 Bacteria 2648
415 Ga0495606_0075445 3300046507 Bacteria 2110
416 Ga0495606_0084270 3300046507 Bacteria 1969
417 Ga0495606_0424296 3300046507 Unclassified 687
418 Ga0495608_0156069 3300046511 Bacteria 1453
419 Ga0495608_0548364 3300046511 Bacteria 697
420 Ga0495618_0171328 3300046514 Bacteria 1381
421 Ga0495628_0381903 3300046516 Bacteria 1031
422 Ga0495630_0086310 3300046517 Bacteria 2370
423 Ga0495630_0708016 3300046517 Bacteria 770
424 Ga0495644_0000936 3300046523 Bacteria 12112
425 Ga0495666_0000909 3300046526 Bacteria 13866
426 Ga0495642_0013648 3300046528 Bacteria 3146
427 Ga0495642_0157834 3300046528 Bacteria 983
428 Ga0495652_0008184 3300046529 Bacteria 9562
429 Ga0495665_0012132 3300046531 Bacteria 4666
430 Ga0495665_0025405 3300046531 Bacteria 3182
431 Ga0495640_0004442 3300046533 Bacteria 11187
432 Ga0495586_0002177 3300046535 Bacteria 10649
433 Ga0495609_0011733 3300046538 Bacteria 4167
434 Ga0495645_0002766 3300046543 Bacteria 11912
435 Ga0495645_0082315 3300046543 Bacteria 2309
436 Ga0495645_0288417 3300046543 Bacteria 1077
437 Ga0495667_0018941 3300046559 Bacteria 4646
438 Ga0495667_0091000 3300046559 Bacteria 1976
439 Ga0495634_0008753 3300046642 Bacteria 7501
440 Ga0495634_0033642 3300046642 Bacteria 3521
441 Ga0495611_0286024 3300046648 Bacteria 761
442 Ga0495625_0001513 3300046660 Bacteria 27875
443 Ga0495625_0006994 3300046660 Bacteria 9941
444 Ga0495625_0074975 3300046660 Bacteria 2368
445 Ga0495625_0618045 3300046660 Bacteria 649
446 Ga0495635_0001183 3300046663 Bacteria 17382
447 Ga0495635_0374940 3300046663 Bacteria 947
448 Ga0495657_0034837 3300046675 Bacteria 3494
449 Ga0495657_0206336 3300046675 Bacteria 1196
450 Ga0495599_0004552 3300046678 Bacteria 8220
451 Ga0495599_0333307 3300046678 Bacteria 912
452 Ga0495599_0415842 3300046678 Bacteria 799
453 Ga0495646_0461510 3300046680 Bacteria 655
454 Ga0495658_0136130 3300046683 Bacteria 1499
455 Ga0495669_0000816 3300046684 Bacteria 13252
456 Ga0495669_0638949 3300046684 Unclassified 517
457 Ga0495613_0001246 3300046689 Bacteria 19420
458 Ga0495613_0040046 3300046689 Bacteria 3472
459 Ga0495624_0015784 3300046690 Bacteria 5089
460 Ga0495589_0284655 3300046794 Bacteria 768
461 Ga0495589_0443132 3300046794 Unclassified 594
462 Ga0495600_0023564 3300046809 Bacteria 3960
463 Ga0495600_0807402 3300046809 Bacteria 558
464 Ga0495581_0007980 3300047315 Bacteria 6131
465 Ga0495581_0029917 3300047315 Bacteria 3157
466 Ga0495604_0000846 3300047317 Bacteria 25544
467 Ga0495604_0029312 3300047317 Bacteria 4378
468 Ga0495604_0072759 3300047317 Bacteria 2597
469 Ga0495674_0036935 3300047319 Bacteria 4391
470 Ga0495674_0046974 3300047319 Bacteria 3830
471 Ga0495674_0061705 3300047319 Bacteria 3266
472 Ga0495672_0002389 3300047320 Bacteria 17348
473 Ga0495672_0443603 3300047320 Bacteria 586
474 Ga0495676_0020124 3300047321 Bacteria 5865
475 Ga0495680_0272694 3300047322 Bacteria 1194
476 Ga0495680_0309451 3300047322 Unclassified 1107
477 Ga0495683_0039623 3300047323 Bacteria 2381
478 Ga0495675_0009912 3300047444 Bacteria 5939
479 Ga0495684_0115163 3300047471 Bacteria 2027
480 Ga0495686_0003013 3300047472 Bacteria 14964
481 Ga0495686_0465816 3300047472 Bacteria 669
482 Ga0495593_0081322 3300047673 Bacteria 1675
483 Ga0495593_0310495 3300047673 Unclassified 788
484 Ga0495602_0182120 3300048088 Bacteria 1619
485 Ga0495614_0000493 3300048089 Bacteria 16151
486 Ga0495614_0016600 3300048089 Bacteria 3203
487 Ga0495614_0118364 3300048089 Unclassified 1167
488 Ga0496103_0079899 3300048906 Bacteria 2056
489 Ga0496104_0022156 3300048907 Bacteria 5838
490 Ga0496104_0042223 3300048907 Bacteria 4278
491 Ga0496104_0299897 3300048907 Bacteria 1519
492 Ga0496104_0744932 3300048907 Bacteria 887
493 Ga0496105_0005487 3300048908 Bacteria 9623
494 Ga0496110_0244182 3300048913 Bacteria 1634
495 Ga0496110_0487102 3300048913 Bacteria 1123
496 Ga0496110_0728251 3300048913 Bacteria 894
497 Ga0496111_0000856 3300048914 Bacteria 16481
498 Ga0496112_0000986 3300048915 Bacteria 20797
499 Ga0496112_0047612 3300048915 Bacteria 4207
500 Ga0496112_0128687 3300048915 Bacteria 2503
501 Ga0496112_0512289 3300048915 Unclassified 1135
502 Ga0496112_1073418 3300048915 Bacteria 724
503 Ga0496113_0001708 3300048916 Bacteria 12430
504 Ga0496113_0150148 3300048916 Bacteria 1838
505 Ga0496114_1420226 3300048917 Bacteria 581
506 Ga0496115_0007118 3300048918 Bacteria 8215
507 Ga0496115_0030660 3300048918 Bacteria 4232
508 Ga0496115_0145800 3300048918 Bacteria 1954
509 Ga0496126_0000004 3300048929 Bacteria 925026
510 Ga0496126_0260357 3300048929 Bacteria 1443
511 Ga0495682_0014348 3300049460 Bacteria 3006
512 Ga0495682_0102222 3300049460 Bacteria 1028
513 Ga0501031_0003773 3300049568 Bacteria 9746
514 Ga0501032_0000447 3300049569 Bacteria 33626
515 Ga0501032_0323761 3300049569 Bacteria 994
516 Ga0501033_0000977 3300049570 Bacteria 25956
517 Ga0501033_0247241 3300049570 Bacteria 1265
518 Ga0501034_0002362 3300049571 Bacteria 22927
519 Ga0501036_0000747 3300049572 Bacteria 24088
520 Ga0501036_0555361 3300049572 Bacteria 954
521 Ga0501037_0003466 3300049573 Bacteria 11452
522 Ga0501037_0194717 3300049573 Bacteria 1434
523 Ga0501037_1133153 3300049573 Bacteria 506
524 Ga0501038_0002758 3300049574 Bacteria 16359
525 Ga0501038_0071498 3300049574 Bacteria 2943
526 Ga0501043_0001025 3300049579 Bacteria 24570
527 Ga0501043_0443884 3300049579 Bacteria 976
528 Ga0501046_0001776 3300049580 Bacteria 20596
529 Ga0501047_0005256 3300049581 Bacteria 12164
530 Ga0501047_0216470 3300049581 Bacteria 1772
531 Ga0501068_0283194 3300049584 Bacteria 1059
532 Ga0501070_0022776 3300049586 Bacteria 5244
533 Ga0501070_0135799 3300049586 Bacteria 2031
534 Ga0501073_0070325 3300049589 Bacteria 2438
535 Ga0501074_0041693 3300049590 Bacteria 3323
536 Ga0501080_0023120 3300049742 Bacteria 5764
537 Ga0501080_1208722 3300049742 Bacteria 650
538 Ga0501035_0002312 3300049822 Bacteria 18805
539 Ga0501035_0133005 3300049822 Bacteria 2167
540 Ga0501044_0001863 3300049823 Bacteria 24450
541 Ga0501044_0057455 3300049823 Bacteria 3992
542 Ga0501044_0436715 3300049823 Bacteria 1217
543 Ga0501044_0783816 3300049823 Bacteria 833
544 Ga0501045_0309035 3300049824 Bacteria 1177
545 nmdc:mga0n895_457559_c1 3300050512 Unclassified 1288
546 nmdc:mga08x19_297877_c1 3300050514 Bacteria 1120
547 Ga0495601_0007131 3300053077 Bacteria 6550
548 Ga0500651_0000020 3300053093 Bacteria 141936
549 Ga0500595_000020 3300053119 Bacteria 165019
550 Ga0500595_009804 3300053119 Bacteria 3847
551 Ga0500661_009937 3300055283 Bacteria 1735

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100026875 Ga0068853_1000268755 131
2 3300005563 Ga0068855_100045695 Ga0068855_1000456954 131
3 3300005564 Ga0070664_100087128 Ga0070664_1000871282 131
4 3300005616 Ga0068852_100917260 Ga0068852_1009172602 131
5 3300025945 Ga0207679_10799052 Ga0207679_107990522 131
6 3300025949 Ga0207667_10035213 Ga0207667_100352134 131
7 3300026041 Ga0207639_10009836 Ga0207639_100098365 131
8 3300026078 Ga0207702_10296845 Ga0207702_102968452 131
9 3300026142 Ga0207698_10337596 Ga0207698_103375962 131
10 3300037471 Ga0395905_0271535 Ga0395905_0271535_559_954 131
11 3300046472 Ga0495580_0101673 Ga0495580_0101673_937_1344 131
12 3300005336 Ga0070680_101128741 Ga0070680_1011287411 132
13 3300005337 Ga0070682_100929107 Ga0070682_1009291072 132
14 3300005436 Ga0070713_100477364 Ga0070713_1004773642 132
15 3300005458 Ga0070681_10072842 Ga0070681_100728424 132
16 3300005530 Ga0070679_100202821 Ga0070679_1002028212 132
17 3300005530 Ga0070679_100919151 Ga0070679_1009191512 132
18 3300005530 Ga0070679_101294282 Ga0070679_1012942822 132
19 3300005535 Ga0070684_102239044 Ga0070684_1022390441 132
20 3300005548 Ga0070665_100039408 Ga0070665_1000394083 132
21 3300005563 Ga0068855_100762172 Ga0068855_1007621722 132
22 3300005578 Ga0068854_101354883 Ga0068854_1013548831 132
23 3300005842 Ga0068858_100071940 Ga0068858_1000719402 132
24 3300009093 Ga0105240_10053944 Ga0105240_100539442 132
25 3300009093 Ga0105240_10179932 Ga0105240_101799323 132
26 3300009093 Ga0105240_11353663 Ga0105240_113536631 132
27 3300009174 Ga0105241_11340367 Ga0105241_113403671 132
28 3300009551 Ga0105238_10503174 Ga0105238_105031743 132
29 3300010375 Ga0105239_11082445 Ga0105239_110824451 132
30 3300013102 Ga0157371_10161609 Ga0157371_101616093 132
31 3300013104 Ga0157370_10254674 Ga0157370_102546743 132
32 3300013105 Ga0157369_10238339 Ga0157369_102383391 132
33 3300013307 Ga0157372_10046392 Ga0157372_100463924 132
34 3300020069 Ga0197907_10726330 Ga0197907_107263303 132
35 3300020075 Ga0206349_1929961 Ga0206349_19299612 132
36 3300020077 Ga0206351_10082539 Ga0206351_100825392 132
37 3300020078 Ga0206352_11306157 Ga0206352_113061573 132
38 3300020080 Ga0206350_11455148 Ga0206350_114551482 132
39 3300020081 Ga0206354_10894720 Ga0206354_108947202 132
40 3300020610 Ga0154015_1576844 Ga0154015_15768443 132
41 3300025911 Ga0207654_11116162 Ga0207654_111161621 132
42 3300025913 Ga0207695_10246912 Ga0207695_102469122 132
43 3300025913 Ga0207695_11122290 Ga0207695_111222901 132
44 3300025917 Ga0207660_10657374 Ga0207660_106573742 132
45 3300025921 Ga0207652_10177633 Ga0207652_101776333 132
46 3300025949 Ga0207667_10215264 Ga0207667_102152642 132
47 3300025949 Ga0207667_11014084 Ga0207667_110140841 132
48 3300025961 Ga0207712_10418088 Ga0207712_104180881 132
49 3300026078 Ga0207702_10359215 Ga0207702_103592152 132
50 3300026116 Ga0207674_11320965 Ga0207674_113209651 132
51 3300028379 Ga0268266_10055386 Ga0268266_100553864 132
52 3300037466 Ga0395898_0307293 Ga0395898_0307293_715_1113 132
53 3300049823 Ga0501044_0001863 Ga0501044_0001863_7162_7563 133
54 3300005329 Ga0070683_101349983 Ga0070683_1013499832 134
55 3300005578 Ga0068854_101626006 Ga0068854_1016260061 134
56 3300005614 Ga0068856_100487536 Ga0068856_1004875362 134
57 3300009174 Ga0105241_10158769 Ga0105241_101587692 134
58 3300009551 Ga0105238_11857736 Ga0105238_118577361 134
59 3300014497 Ga0182008_10658141 Ga0182008_106581412 134
60 3300014969 Ga0157376_10032731 Ga0157376_100327314 134
61 3300015262 Ga0182007_10068098 Ga0182007_100680982 134
62 3300005844 Ga0068862_101053830 Ga0068862_1010538302 135
63 3300006237 Ga0097621_101002836 Ga0097621_1010028362 135
64 3300009101 Ga0105247_10572667 Ga0105247_105726672 135
65 3300009177 Ga0105248_10909507 Ga0105248_109095071 135
66 3300009553 Ga0105249_10056030 Ga0105249_100560303 135
67 3300010159 Ga0099796_10029684 Ga0099796_100296841 135
68 3300021388 Ga0213875_10022515 Ga0213875_100225152 135
69 3300025900 Ga0207710_10572372 Ga0207710_105723722 135
70 3300025961 Ga0207712_10073878 Ga0207712_100738783 135
71 3300025986 Ga0207658_11105513 Ga0207658_111055131 135
72 3300037853 Ga0436364_0902927 Ga0436364_0902927_1532_1939 135
73 3300005335 Ga0070666_10483981 Ga0070666_104839811 136
74 3300005366 Ga0070659_101553339 Ga0070659_1015533391 136
75 3300005437 Ga0070710_11340319 Ga0070710_113403191 136
76 3300005439 Ga0070711_100178493 Ga0070711_1001784932 136
77 3300005456 Ga0070678_100411302 Ga0070678_1004113022 136
78 3300006028 Ga0070717_10125800 Ga0070717_101258002 136
79 3300010375 Ga0105239_11207379 Ga0105239_112073792 136
80 3300013100 Ga0157373_10053933 Ga0157373_100539333 136
81 3300013105 Ga0157369_10015156 Ga0157369_100151562 136
82 3300021384 Ga0213876_10409092 Ga0213876_104090922 136
83 3300025924 Ga0207694_11042744 Ga0207694_110427441 136
84 3300026121 Ga0207683_10090415 Ga0207683_100904154 136
85 3300031344 Ga0265316_11134329 Ga0265316_111343291 136
86 3300031712 Ga0265342_10029865 Ga0265342_100298652 136
87 3300039437 Ga0436365_1896276 Ga0436365_1896276_459_869 136
88 3300048918 Ga0496115_0007118 Ga0496115_0007118_4508_4918 136
89 3300006871 Ga0075434_100223189 Ga0075434_1002231891 137
90 3300021361 Ga0213872_10002855 Ga0213872_100028552 137
91 3300021361 Ga0213872_10017431 Ga0213872_100174312 137
92 3300021441 Ga0213871_10000715 Ga0213871_100007152 137
93 3300021441 Ga0213871_10002116 Ga0213871_100021163 137
94 3300039438 Ga0436360_0061507 Ga0436360_0061507_6041_6454 137
95 3300039438 Ga0436360_0497221 Ga0436360_0497221_1130_1543 137
96 3300039447 Ga0436361_0274684 Ga0436361_0274684_17270_17683 137
97 3300039447 Ga0436361_0464047 Ga0436361_0464047_41925_42338 137
98 3300039447 Ga0436361_0509515 Ga0436361_0509515_5408_5821 137
99 3300039447 Ga0436361_0893033 Ga0436361_0893033_158_571 137
100 3300050512 nmdc:mga0n895_457559_c1 nmdc:mga0n895_457559_c1_89_502 137
101 3300005434 Ga0070709_10606208 Ga0070709_106062082 138
102 3300005842 Ga0068858_100156242 Ga0068858_1001562423 139
103 3300031241 Ga0265325_10002276 Ga0265325_100022766 139
104 3300031241 Ga0265325_10037820 Ga0265325_100378201 139
105 3300031247 Ga0265340_10087147 Ga0265340_100871472 139
106 3300031250 Ga0265331_10030349 Ga0265331_100303492 139
107 3300031251 Ga0265327_10020558 Ga0265327_100205585 139
108 3300031344 Ga0265316_10030584 Ga0265316_100305843 139
109 3300031344 Ga0265316_10206174 Ga0265316_102061742 139
110 3300031595 Ga0265313_10016509 Ga0265313_100165093 139
111 3300031595 Ga0265313_10065697 Ga0265313_100656971 139
112 3300031712 Ga0265342_10032270 Ga0265342_100322704 139
113 3300031712 Ga0265342_10524162 Ga0265342_105241621 139
114 3300039438 Ga0436360_0546638 Ga0436360_0546638_22_441 139
115 3300046459 Ga0495629_0395884 Ga0495629_0395884_459_878 139
116 3300046472 Ga0495580_0608808 Ga0495580_0608808_249_668 139
117 3300046642 Ga0495634_0033642 Ga0495634_0033642_12_494 139
118 3300046648 Ga0495611_0286024 Ga0495611_0286024_89_508 139
119 3300046684 Ga0495669_0638949 Ga0495669_0638949_25_507 139
120 3300046794 Ga0495589_0443132 Ga0495589_0443132_12_494 139
121 3300047322 Ga0495680_0309451 Ga0495680_0309451_12_494 139
122 3300005458 Ga0070681_10025159 Ga0070681_100251592 140
123 3300005577 Ga0068857_100376677 Ga0068857_1003766772 140
124 3300009093 Ga0105240_10831422 Ga0105240_108314222 140
125 3300009551 Ga0105238_10583747 Ga0105238_105837471 140
126 3300022467 Ga0224712_10247017 Ga0224712_102470172 140
127 3300025912 Ga0207707_10262448 Ga0207707_102624481 140
128 3300025921 Ga0207652_10042459 Ga0207652_100424592 140
129 3300025939 Ga0207665_10277974 Ga0207665_102779741 140
130 3300026116 Ga0207674_10459247 Ga0207674_104592472 140
131 3300045976 Ga0466967_0125944 Ga0466967_0125944_103_525 140
132 3300048907 Ga0496104_0744932 Ga0496104_0744932_112_534 140
133 3300048915 Ga0496112_0047612 Ga0496112_0047612_2847_3269 140
134 3300048916 Ga0496113_0150148 Ga0496113_0150148_1088_1510 140
135 3300005329 Ga0070683_100015441 Ga0070683_1000154414 141
136 3300005436 Ga0070713_100021870 Ga0070713_1000218704 141
137 3300005436 Ga0070713_100117512 Ga0070713_1001175123 141
138 3300005436 Ga0070713_101087825 Ga0070713_1010878252 141
139 3300005535 Ga0070684_100028447 Ga0070684_1000284472 141
140 3300005539 Ga0068853_100034787 Ga0068853_1000347873 141
141 3300005616 Ga0068852_100017759 Ga0068852_1000177597 141
142 3300006028 Ga0070717_10036116 Ga0070717_100361163 141
143 3300009551 Ga0105238_10217164 Ga0105238_102171642 141
144 3300009551 Ga0105238_10634819 Ga0105238_106348191 141
145 3300010375 Ga0105239_10545360 Ga0105239_105453602 141
146 3300013296 Ga0157374_10598141 Ga0157374_105981412 141
147 3300025928 Ga0207700_10004508 Ga0207700_100045085 141
148 3300025928 Ga0207700_10125809 Ga0207700_101258094 141
149 3300025944 Ga0207661_10011549 Ga0207661_100115494 141
150 3300026023 Ga0207677_10008853 Ga0207677_100088534 141
151 3300026041 Ga0207639_10109743 Ga0207639_101097433 141
152 3300035172 Ga0373955_0723086 Ga0373955_0723086_35_460 141
153 3300005329 Ga0070683_100321822 Ga0070683_1003218222 142
154 3300005336 Ga0070680_100562203 Ga0070680_1005622032 142
155 3300005434 Ga0070709_11159941 Ga0070709_111599411 142
156 3300005435 Ga0070714_100115097 Ga0070714_1001150973 142
157 3300005435 Ga0070714_100587806 Ga0070714_1005878062 142
158 3300005435 Ga0070714_100985186 Ga0070714_1009851862 142
159 3300005436 Ga0070713_100007913 Ga0070713_1000079134 142
160 3300005436 Ga0070713_100167558 Ga0070713_1001675582 142
161 3300005436 Ga0070713_101900074 Ga0070713_1019000742 142
162 3300005437 Ga0070710_10015469 Ga0070710_100154692 142
163 3300005437 Ga0070710_10213308 Ga0070710_102133082 142
164 3300005437 Ga0070710_10669067 Ga0070710_106690671 142
165 3300005439 Ga0070711_100333615 Ga0070711_1003336152 142
166 3300005439 Ga0070711_100905932 Ga0070711_1009059322 142
167 3300005458 Ga0070681_10059397 Ga0070681_100593973 142
168 3300005458 Ga0070681_10075854 Ga0070681_100758542 142
169 3300005518 Ga0070699_100212854 Ga0070699_1002128542 142
170 3300005535 Ga0070684_100485507 Ga0070684_1004855072 142
171 3300005539 Ga0068853_100027051 Ga0068853_1000270513 142
172 3300005539 Ga0068853_100906484 Ga0068853_1009064841 142
173 3300005564 Ga0070664_100638767 Ga0070664_1006387672 142
174 3300005614 Ga0068856_101897836 Ga0068856_1018978361 142
175 3300005616 Ga0068852_100288887 Ga0068852_1002888873 142
176 3300005616 Ga0068852_100646669 Ga0068852_1006466692 142
177 3300005834 Ga0068851_10271645 Ga0068851_102716452 142
178 3300006028 Ga0070717_10008710 Ga0070717_100087107 142
179 3300006028 Ga0070717_10044242 Ga0070717_100442424 142
180 3300006028 Ga0070717_10098596 Ga0070717_100985962 142
181 3300006028 Ga0070717_10131082 Ga0070717_101310821 142
182 3300006028 Ga0070717_10188056 Ga0070717_101880562 142
183 3300006028 Ga0070717_10274444 Ga0070717_102744442 142
184 3300006163 Ga0070715_10251404 Ga0070715_102514042 142
185 3300006163 Ga0070715_10516676 Ga0070715_105166761 142
186 3300006163 Ga0070715_10517877 Ga0070715_105178771 142
187 3300006173 Ga0070716_100091591 Ga0070716_1000915913 142
188 3300006175 Ga0070712_100153647 Ga0070712_1001536472 142
189 3300006175 Ga0070712_100298334 Ga0070712_1002983341 142
190 3300006914 Ga0075436_100285667 Ga0075436_1002856672 142
191 3300009093 Ga0105240_10352994 Ga0105240_103529942 142
192 3300009093 Ga0105240_11328501 Ga0105240_113285012 142
193 3300009098 Ga0105245_10076381 Ga0105245_100763814 142
194 3300009174 Ga0105241_10868752 Ga0105241_108687521 142
195 3300009176 Ga0105242_10048107 Ga0105242_100481072 142
196 3300009545 Ga0105237_10535473 Ga0105237_105354732 142
197 3300009551 Ga0105238_10040781 Ga0105238_100407813 142
198 3300009551 Ga0105238_10293852 Ga0105238_102938522 142
199 3300010159 Ga0099796_10054408 Ga0099796_100544082 142
200 3300010375 Ga0105239_11154712 Ga0105239_111547121 142
201 3300010375 Ga0105239_13279215 Ga0105239_132792151 142
202 3300013105 Ga0157369_10033391 Ga0157369_100333914 142
203 3300013105 Ga0157369_10511880 Ga0157369_105118802 142
204 3300013306 Ga0163162_10164268 Ga0163162_101642683 142
205 3300013306 Ga0163162_10616507 Ga0163162_106165072 142
206 3300013307 Ga0157372_10318396 Ga0157372_103183962 142
207 3300020070 Ga0206356_10955734 Ga0206356_109557342 142
208 3300025898 Ga0207692_10302885 Ga0207692_103028851 142
209 3300025898 Ga0207692_10386411 Ga0207692_103864112 142
210 3300025898 Ga0207692_10415514 Ga0207692_104155142 142
211 3300025898 Ga0207692_10899043 Ga0207692_108990431 142
212 3300025906 Ga0207699_10082386 Ga0207699_100823862 142
213 3300025906 Ga0207699_10260867 Ga0207699_102608672 142
214 3300025912 Ga0207707_10016112 Ga0207707_100161126 142
215 3300025912 Ga0207707_10104156 Ga0207707_101041562 142
216 3300025913 Ga0207695_10039822 Ga0207695_100398224 142
217 3300025913 Ga0207695_10184705 Ga0207695_101847052 142
218 3300025913 Ga0207695_10733430 Ga0207695_107334302 142
219 3300025914 Ga0207671_10417763 Ga0207671_104177632 142
220 3300025915 Ga0207693_10009654 Ga0207693_100096542 142
221 3300025915 Ga0207693_10051582 Ga0207693_100515822 142
222 3300025916 Ga0207663_10387895 Ga0207663_103878952 142
223 3300025916 Ga0207663_10562310 Ga0207663_105623101 142
224 3300025921 Ga0207652_10490444 Ga0207652_104904442 142
225 3300025924 Ga0207694_10049958 Ga0207694_100499583 142
226 3300025927 Ga0207687_10010313 Ga0207687_100103133 142
227 3300025928 Ga0207700_10014753 Ga0207700_100147535 142
228 3300025928 Ga0207700_10250427 Ga0207700_102504272 142
229 3300025928 Ga0207700_11335370 Ga0207700_113353701 142
230 3300025929 Ga0207664_10014614 Ga0207664_100146143 142
231 3300025929 Ga0207664_11280131 Ga0207664_112801312 142
232 3300025934 Ga0207686_10122515 Ga0207686_101225152 142
233 3300025939 Ga0207665_10008046 Ga0207665_100080461 142
234 3300025944 Ga0207661_10053542 Ga0207661_100535422 142
235 3300025949 Ga0207667_10035813 Ga0207667_100358134 142
236 3300026041 Ga0207639_10035635 Ga0207639_100356353 142
237 3300026041 Ga0207639_10433891 Ga0207639_104338912 142
238 3300026142 Ga0207698_10183927 Ga0207698_101839272 142
239 3300026142 Ga0207698_11672142 Ga0207698_116721421 142
240 3300028800 Ga0265338_11076188 Ga0265338_110761881 142
241 3300035083 Ga0373926_0024666 Ga0373926_0024666_75_503 142
242 3300035111 Ga0373923_0036493 Ga0373923_0036493_10_438 142
243 3300035111 Ga0373923_0422391 Ga0373923_0422391_45_473 142
244 3300035113 Ga0373936_0232557 Ga0373936_0232557_97_525 142
245 3300035116 Ga0373945_0017383 Ga0373945_0017383_1408_1836 142
246 3300035120 Ga0373957_0056071 Ga0373957_0056071_694_1122 142
247 3300035170 Ga0373943_0020972 Ga0373943_0020972_920_1348 142
248 3300035171 Ga0373946_0161122 Ga0373946_0161122_540_968 142
249 3300035410 Ga0373924_0000689 Ga0373924_0000689_3892_4320 142
250 3300035410 Ga0373924_0044873 Ga0373924_0044873_877_1305 142
251 3300035692 Ga0373935_0019561 Ga0373935_0019561_1492_1920 142
252 3300035692 Ga0373935_0059018 Ga0373935_0059018_536_964 142
253 3300035692 Ga0373935_0061760 Ga0373935_0061760_1016_1444 142
254 3300035695 Ga0373927_0010496 Ga0373927_0010496_3676_4104 142
255 3300035695 Ga0373927_0097253 Ga0373927_0097253_519_947 142
256 3300035724 Ga0373933_0290233 Ga0373933_0290233_266_694 142
257 3300035724 Ga0373933_0745222 Ga0373933_0745222_145_573 142
258 3300035725 Ga0373947_0021403 Ga0373947_0021403_967_1395 142
259 3300035725 Ga0373947_0021599 Ga0373947_0021599_1828_2256 142
260 3300035725 Ga0373947_0063220 Ga0373947_0063220_864_1292 142
261 3300036401 Ga0373937_0000422 Ga0373937_0000422_32691_33119 142
262 3300036401 Ga0373937_1020577 Ga0373937_1020577_149_577 142
263 3300036401 Ga0373937_1410046 Ga0373937_1410046_149_577 142
264 3300037068 Ga0373925_0134968 Ga0373925_0134968_963_1391 142
265 3300037068 Ga0373925_0495808 Ga0373925_0495808_228_656 142
266 3300044694 Ga0466963_0078669 Ga0466963_0078669_1275_1703 142
267 3300045836 Ga0466958_0080876 Ga0466958_0080876_946_1374 142
268 3300045836 Ga0466958_0466031 Ga0466958_0466031_180_608 142
269 3300046462 Ga0495651_0047467 Ga0495651_0047467_2410_2838 142
270 3300046473 Ga0495582_0193299 Ga0495582_0193299_67_495 142
271 3300046475 Ga0495639_0056476 Ga0495639_0056476_982_1410 142
272 3300046511 Ga0495608_0156069 Ga0495608_0156069_796_1224 142
273 3300046516 Ga0495628_0381903 Ga0495628_0381903_403_831 142
274 3300046517 Ga0495630_0708016 Ga0495630_0708016_223_651 142
275 3300046531 Ga0495665_0025405 Ga0495665_0025405_1773_2201 142
276 3300046543 Ga0495645_0288417 Ga0495645_0288417_605_1033 142
277 3300046559 Ga0495667_0091000 Ga0495667_0091000_30_458 142
278 3300046663 Ga0495635_0374940 Ga0495635_0374940_415_843 142
279 3300046675 Ga0495657_0034837 Ga0495657_0034837_2138_2566 142
280 3300046678 Ga0495599_0333307 Ga0495599_0333307_238_666 142
281 3300046683 Ga0495658_0136130 Ga0495658_0136130_80_508 142
282 3300047317 Ga0495604_0029312 Ga0495604_0029312_1631_2059 142
283 3300047673 Ga0495593_0310495 Ga0495593_0310495_257_685 142
284 3300048089 Ga0495614_0118364 Ga0495614_0118364_277_705 142
285 3300048907 Ga0496104_0022156 Ga0496104_0022156_2333_2761 142
286 3300048907 Ga0496104_0042223 Ga0496104_0042223_1530_1958 142
287 3300048908 Ga0496105_0005487 Ga0496105_0005487_7297_7725 142
288 3300048913 Ga0496110_0244182 Ga0496110_0244182_870_1298 142
289 3300048913 Ga0496110_0728251 Ga0496110_0728251_130_558 142
290 3300048914 Ga0496111_0000856 Ga0496111_0000856_12000_12428 142
291 3300048915 Ga0496112_0000986 Ga0496112_0000986_9687_10115 142
292 3300048915 Ga0496112_0512289 Ga0496112_0512289_678_1106 142
293 3300048916 Ga0496113_0001708 Ga0496113_0001708_2845_3273 142
294 3300050514 nmdc:mga08x19_297877_c1 nmdc:mga08x19_297877_c1_291_719 142
295 3300053077 Ga0495601_0007131 Ga0495601_0007131_3387_3815 142
296 3300005518 Ga0070699_100527762 Ga0070699_1005277622 143
297 3300006175 Ga0070712_100629585 Ga0070712_1006295852 143
298 3300010159 Ga0099796_10151068 Ga0099796_101510682 143
299 3300022467 Ga0224712_10214358 Ga0224712_102143581 143
300 3300025912 Ga0207707_10531635 Ga0207707_105316351 143
301 3300025949 Ga0207667_10481745 Ga0207667_104817452 143
302 3300025949 Ga0207667_11175990 Ga0207667_111759902 143
303 3300048918 Ga0496115_0030660 Ga0496115_0030660_113_544 143
304 3300048906 Ga0496103_0079899 Ga0496103_0079899_1475_2035 144
305 iso_pu_bacteria 2884215851 2884216718 144
306 3300005547 Ga0070693_100290227 Ga0070693_1002902272 145
307 3300047319 Ga0495674_0036935 Ga0495674_0036935_16_657 145
308 3300025928 Ga0207700_11725983 Ga0207700_117259831 147
309 3300025939 Ga0207665_10766319 Ga0207665_107663191 147
310 3300005327 Ga0070658_10014514 Ga0070658_100145147 148
311 3300005327 Ga0070658_10025306 Ga0070658_100253061 148
312 3300005327 Ga0070658_10071080 Ga0070658_100710802 148
313 3300005327 Ga0070658_10796204 Ga0070658_107962042 148
314 3300005329 Ga0070683_100170919 Ga0070683_1001709192 148
315 3300005336 Ga0070680_100189811 Ga0070680_1001898112 148
316 3300005339 Ga0070660_100069635 Ga0070660_1000696354 148
317 3300005339 Ga0070660_100141584 Ga0070660_1001415842 148
318 3300005345 Ga0070692_10743060 Ga0070692_107430602 148
319 3300005355 Ga0070671_100082244 Ga0070671_1000822443 148
320 3300005364 Ga0070673_100357127 Ga0070673_1003571272 148
321 3300005435 Ga0070714_100058532 Ga0070714_1000585322 148
322 3300005436 Ga0070713_100016290 Ga0070713_1000162904 148
323 3300005439 Ga0070711_100352284 Ga0070711_1003522842 148
324 3300005456 Ga0070678_100063876 Ga0070678_1000638764 148
325 3300005458 Ga0070681_10242035 Ga0070681_102420352 148
326 3300005467 Ga0070706_100934373 Ga0070706_1009343731 148
327 3300005468 Ga0070707_100754997 Ga0070707_1007549972 148
328 3300005530 Ga0070679_100108298 Ga0070679_1001082983 148
329 3300005543 Ga0070672_100353336 Ga0070672_1003533361 148
330 3300005548 Ga0070665_100019136 Ga0070665_1000191362 148
331 3300005548 Ga0070665_100253004 Ga0070665_1002530041 148
332 3300005548 Ga0070665_100253295 Ga0070665_1002532951 148
333 3300005548 Ga0070665_101128039 Ga0070665_1011280392 148
334 3300005563 Ga0068855_100006829 Ga0068855_10000682916 148
335 3300005563 Ga0068855_100015930 Ga0068855_1000159304 148
336 3300005563 Ga0068855_100169211 Ga0068855_1001692113 148
337 3300005563 Ga0068855_100335613 Ga0068855_1003356132 148
338 3300005563 Ga0068855_101801654 Ga0068855_1018016542 148
339 3300005563 Ga0068855_102493919 Ga0068855_1024939191 148
340 3300005577 Ga0068857_101768012 Ga0068857_1017680122 148
341 3300005578 Ga0068854_100130141 Ga0068854_1001301413 148
342 3300005614 Ga0068856_100217978 Ga0068856_1002179783 148
343 3300005614 Ga0068856_101023643 Ga0068856_1010236432 148
344 3300005616 Ga0068852_100018634 Ga0068852_1000186342 148
345 3300005616 Ga0068852_100220919 Ga0068852_1002209193 148
346 3300005616 Ga0068852_100735929 Ga0068852_1007359292 148
347 3300005616 Ga0068852_100742037 Ga0068852_1007420372 148
348 3300005616 Ga0068852_101549171 Ga0068852_1015491711 148
349 3300005616 Ga0068852_102318194 Ga0068852_1023181941 148
350 3300005618 Ga0068864_100133266 Ga0068864_1001332662 148
351 3300005841 Ga0068863_100098039 Ga0068863_1000980393 148
352 3300009093 Ga0105240_10000648 Ga0105240_1000064817 148
353 3300009093 Ga0105240_10880038 Ga0105240_108800382 148
354 3300009174 Ga0105241_10436862 Ga0105241_104368622 148
355 3300009174 Ga0105241_10662275 Ga0105241_106622752 148
356 3300009177 Ga0105248_10020720 Ga0105248_100207206 148
357 3300009177 Ga0105248_10111934 Ga0105248_101119342 148
358 3300009177 Ga0105248_11005751 Ga0105248_110057512 148
359 3300009551 Ga0105238_10017249 Ga0105238_100172493 148
360 3300009551 Ga0105238_10020194 Ga0105238_100201949 148
361 3300013102 Ga0157371_10126492 Ga0157371_101264922 148
362 3300013104 Ga0157370_10019731 Ga0157370_100197314 148
363 3300013104 Ga0157370_10055021 Ga0157370_100550214 148
364 3300013104 Ga0157370_10078401 Ga0157370_100784012 148
365 3300013104 Ga0157370_10290357 Ga0157370_102903572 148
366 3300013105 Ga0157369_10070093 Ga0157369_100700932 148
367 3300013105 Ga0157369_10116220 Ga0157369_101162203 148
368 3300013105 Ga0157369_10202247 Ga0157369_102022472 148
369 3300013105 Ga0157369_10318466 Ga0157369_103184661 148
370 3300013105 Ga0157369_10794403 Ga0157369_107944032 148
371 3300013105 Ga0157369_10889976 Ga0157369_108899762 148
372 3300013105 Ga0157369_10908100 Ga0157369_109081002 148
373 3300013296 Ga0157374_10137904 Ga0157374_101379042 148
374 3300013296 Ga0157374_10162701 Ga0157374_101627012 148
375 3300013296 Ga0157374_10246554 Ga0157374_102465542 148
376 3300013296 Ga0157374_10587645 Ga0157374_105876452 148
377 3300013296 Ga0157374_11572506 Ga0157374_115725061 148
378 3300013306 Ga0163162_10003188 Ga0163162_1000318812 148
379 3300013306 Ga0163162_10372895 Ga0163162_103728952 148
380 3300013307 Ga0157372_10062187 Ga0157372_100621872 148
381 3300013307 Ga0157372_10078978 Ga0157372_100789785 148
382 3300013307 Ga0157372_10186141 Ga0157372_101861412 148
383 3300013307 Ga0157372_10256629 Ga0157372_102566292 148
384 3300013307 Ga0157372_10387656 Ga0157372_103876562 148
385 3300013308 Ga0157375_10860920 Ga0157375_108609202 148
386 3300014325 Ga0163163_10777778 Ga0163163_107777781 148
387 3300014968 Ga0157379_10057230 Ga0157379_100572303 148
388 3300014968 Ga0157379_10104554 Ga0157379_101045542 148
389 3300014969 Ga0157376_10107552 Ga0157376_101075523 148
390 3300014969 Ga0157376_10247252 Ga0157376_102472522 148
391 3300014969 Ga0157376_10393800 Ga0157376_103938002 148
392 3300020069 Ga0197907_10327289 Ga0197907_103272892 148
393 3300025909 Ga0207705_10004549 Ga0207705_100045494 148
394 3300025909 Ga0207705_10028162 Ga0207705_100281623 148
395 3300025909 Ga0207705_10036049 Ga0207705_100360493 148
396 3300025909 Ga0207705_10434522 Ga0207705_104345222 148
397 3300025913 Ga0207695_10000448 Ga0207695_1000044868 148
398 3300025913 Ga0207695_10339143 Ga0207695_103391432 148
399 3300025917 Ga0207660_10383228 Ga0207660_103832282 148
400 3300025919 Ga0207657_10111548 Ga0207657_101115482 148
401 3300025919 Ga0207657_10131538 Ga0207657_101315383 148
402 3300025920 Ga0207649_10102438 Ga0207649_101024382 148
403 3300025921 Ga0207652_10120227 Ga0207652_101202272 148
404 3300025924 Ga0207694_10100014 Ga0207694_101000142 148
405 3300025924 Ga0207694_10116379 Ga0207694_101163792 148
406 3300025924 Ga0207694_10921030 Ga0207694_109210302 148
407 3300025928 Ga0207700_10538882 Ga0207700_105388822 148
408 3300025929 Ga0207664_10174077 Ga0207664_101740772 148
409 3300025929 Ga0207664_10489989 Ga0207664_104899892 148
410 3300025931 Ga0207644_10001821 Ga0207644_100018216 148
411 3300025941 Ga0207711_10051178 Ga0207711_100511783 148
412 3300025941 Ga0207711_10481118 Ga0207711_104811182 148
413 3300025944 Ga0207661_10773719 Ga0207661_107737192 148
414 3300025949 Ga0207667_10001856 Ga0207667_100018563 148
415 3300025949 Ga0207667_10018535 Ga0207667_100185356 148
416 3300025949 Ga0207667_10101174 Ga0207667_101011743 148
417 3300025949 Ga0207667_10181704 Ga0207667_101817042 148
418 3300025981 Ga0207640_10034309 Ga0207640_100343093 148
419 3300026041 Ga0207639_10020184 Ga0207639_100201843 148
420 3300026067 Ga0207678_10003811 Ga0207678_100038118 148
421 3300026067 Ga0207678_10283684 Ga0207678_102836842 148
422 3300026078 Ga0207702_10479236 Ga0207702_104792362 148
423 3300026088 Ga0207641_10125369 Ga0207641_101253693 148
424 3300026095 Ga0207676_10128554 Ga0207676_101285543 148
425 3300026121 Ga0207683_10304537 Ga0207683_103045373 148
426 3300026142 Ga0207698_10095546 Ga0207698_100955462 148
427 3300026142 Ga0207698_10350746 Ga0207698_103507462 148
428 3300028379 Ga0268266_10145491 Ga0268266_101454912 148
429 3300028379 Ga0268266_10212025 Ga0268266_102120253 148
430 3300028379 Ga0268266_10212283 Ga0268266_102122833 148
431 3300033180 Ga0307510_10081045 Ga0307510_100810453 148
432 3300035725 Ga0373947_0662834 Ga0373947_0662834_196_642 148
433 3300037068 Ga0373925_0335342 Ga0373925_0335342_507_953 148
434 3300044684 Ga0466966_0348255 Ga0466966_0348255_299_745 148
435 3300044693 Ga0466961_0228313 Ga0466961_0228313_112_558 148
436 3300046455 Ga0495603_0014346 Ga0495603_0014346_1914_2360 148
437 3300046455 Ga0495603_0131756 Ga0495603_0131756_526_972 148
438 3300046459 Ga0495629_0007401 Ga0495629_0007401_6454_6900 148
439 3300046459 Ga0495629_0026812 Ga0495629_0026812_3581_4027 148
440 3300046462 Ga0495651_0037581 Ga0495651_0037581_3048_3494 148
441 3300046463 Ga0495653_0003062 Ga0495653_0003062_11215_11661 148
442 3300046471 Ga0495650_0000009 Ga0495650_0000009_240276_240722 148
443 3300046471 Ga0495650_0007486 Ga0495650_0007486_3135_3581 148
444 3300046472 Ga0495580_0445265 Ga0495580_0445265_45_491 148
445 3300046473 Ga0495582_0005041 Ga0495582_0005041_6878_7324 148
446 3300046473 Ga0495582_0104293 Ga0495582_0104293_198_644 148
447 3300046475 Ga0495639_0002336 Ga0495639_0002336_3866_4312 148
448 3300046476 Ga0495662_0000859 Ga0495662_0000859_8333_8779 148
449 3300046477 Ga0495664_0057438 Ga0495664_0057438_1353_1799 148
450 3300046492 Ga0495585_0122016 Ga0495585_0122016_597_1043 148
451 3300046499 Ga0495594_0000950 Ga0495594_0000950_6826_7272 148
452 3300046499 Ga0495594_0021463 Ga0495594_0021463_2643_3089 148
453 3300046501 Ga0495607_0043684 Ga0495607_0043684_39_485 148
454 3300046507 Ga0495606_0075445 Ga0495606_0075445_1558_2004 148
455 3300046507 Ga0495606_0084270 Ga0495606_0084270_123_569 148
456 3300046507 Ga0495606_0424296 Ga0495606_0424296_151_597 148
457 3300046511 Ga0495608_0548364 Ga0495608_0548364_103_549 148
458 3300046514 Ga0495618_0171328 Ga0495618_0171328_77_523 148
459 3300046517 Ga0495630_0086310 Ga0495630_0086310_700_1146 148
460 3300046523 Ga0495644_0000936 Ga0495644_0000936_5592_6038 148
461 3300046526 Ga0495666_0000909 Ga0495666_0000909_11812_12258 148
462 3300046528 Ga0495642_0013648 Ga0495642_0013648_722_1168 148
463 3300046528 Ga0495642_0157834 Ga0495642_0157834_340_786 148
464 3300046529 Ga0495652_0008184 Ga0495652_0008184_5389_5835 148
465 3300046531 Ga0495665_0012132 Ga0495665_0012132_4133_4579 148
466 3300046533 Ga0495640_0004442 Ga0495640_0004442_1532_1978 148
467 3300046535 Ga0495586_0002177 Ga0495586_0002177_9873_10319 148
468 3300046538 Ga0495609_0011733 Ga0495609_0011733_1155_1601 148
469 3300046543 Ga0495645_0002766 Ga0495645_0002766_3728_4174 148
470 3300046543 Ga0495645_0082315 Ga0495645_0082315_910_1359 148
471 3300046559 Ga0495667_0018941 Ga0495667_0018941_3321_3767 148
472 3300046642 Ga0495634_0008753 Ga0495634_0008753_2821_3267 148
473 3300046660 Ga0495625_0001513 Ga0495625_0001513_16238_16684 148
474 3300046660 Ga0495625_0006994 Ga0495625_0006994_5046_5492 148
475 3300046660 Ga0495625_0074975 Ga0495625_0074975_736_1182 148
476 3300046660 Ga0495625_0618045 Ga0495625_0618045_10_456 148
477 3300046663 Ga0495635_0001183 Ga0495635_0001183_77_523 148
478 3300046675 Ga0495657_0206336 Ga0495657_0206336_361_807 148
479 3300046678 Ga0495599_0004552 Ga0495599_0004552_2303_2749 148
480 3300046678 Ga0495599_0415842 Ga0495599_0415842_302_748 148
481 3300046680 Ga0495646_0461510 Ga0495646_0461510_27_473 148
482 3300046684 Ga0495669_0000816 Ga0495669_0000816_2362_2808 148
483 3300046689 Ga0495613_0001246 Ga0495613_0001246_13506_13952 148
484 3300046689 Ga0495613_0040046 Ga0495613_0040046_1704_2150 148
485 3300046690 Ga0495624_0015784 Ga0495624_0015784_3728_4174 148
486 3300046794 Ga0495589_0284655 Ga0495589_0284655_296_742 148
487 3300046809 Ga0495600_0023564 Ga0495600_0023564_879_1325 148
488 3300046809 Ga0495600_0807402 Ga0495600_0807402_62_508 148
489 3300047315 Ga0495581_0007980 Ga0495581_0007980_3821_4267 148
490 3300047315 Ga0495581_0029917 Ga0495581_0029917_318_764 148
491 3300047317 Ga0495604_0000846 Ga0495604_0000846_15729_16175 148
492 3300047317 Ga0495604_0072759 Ga0495604_0072759_1528_1974 148
493 3300047319 Ga0495674_0046974 Ga0495674_0046974_2205_2651 148
494 3300047319 Ga0495674_0061705 Ga0495674_0061705_1919_2365 148
495 3300047320 Ga0495672_0002389 Ga0495672_0002389_14527_14973 148
496 3300047320 Ga0495672_0443603 Ga0495672_0443603_77_523 148
497 3300047321 Ga0495676_0020124 Ga0495676_0020124_2598_3044 148
498 3300047322 Ga0495680_0272694 Ga0495680_0272694_319_765 148
499 3300047323 Ga0495683_0039623 Ga0495683_0039623_77_523 148
500 3300047444 Ga0495675_0009912 Ga0495675_0009912_5408_5854 148
501 3300047471 Ga0495684_0115163 Ga0495684_0115163_1533_1979 148
502 3300047472 Ga0495686_0003013 Ga0495686_0003013_575_1024 148
503 3300047472 Ga0495686_0465816 Ga0495686_0465816_23_469 148
504 3300047673 Ga0495593_0081322 Ga0495593_0081322_1139_1585 148
505 3300048088 Ga0495602_0182120 Ga0495602_0182120_960_1409 148
506 3300048089 Ga0495614_0000493 Ga0495614_0000493_13312_13758 148
507 3300048089 Ga0495614_0016600 Ga0495614_0016600_1784_2230 148
508 3300048907 Ga0496104_0299897 Ga0496104_0299897_100_546 148
509 3300048913 Ga0496110_0487102 Ga0496110_0487102_418_864 148
510 3300048915 Ga0496112_0128687 Ga0496112_0128687_1202_1648 148
511 3300048915 Ga0496112_1073418 Ga0496112_1073418_139_585 148
512 3300048917 Ga0496114_1420226 Ga0496114_1420226_14_460 148
513 3300048918 Ga0496115_0145800 Ga0496115_0145800_1154_1600 148
514 3300048929 Ga0496126_0000004 Ga0496126_0000004_289565_290011 148
515 3300048929 Ga0496126_0260357 Ga0496126_0260357_425_871 148
516 3300049460 Ga0495682_0014348 Ga0495682_0014348_639_1085 148
517 3300049460 Ga0495682_0102222 Ga0495682_0102222_211_657 148
518 3300049568 Ga0501031_0003773 Ga0501031_0003773_3361_3807 148
519 3300049569 Ga0501032_0000447 Ga0501032_0000447_13173_13619 148
520 3300049569 Ga0501032_0323761 Ga0501032_0323761_413_859 148
521 3300049570 Ga0501033_0000977 Ga0501033_0000977_17289_17735 148
522 3300049570 Ga0501033_0247241 Ga0501033_0247241_517_963 148
523 3300049571 Ga0501034_0002362 Ga0501034_0002362_9739_10185 148
524 3300049572 Ga0501036_0000747 Ga0501036_0000747_2363_2809 148
525 3300049572 Ga0501036_0555361 Ga0501036_0555361_101_547 148
526 3300049573 Ga0501037_0003466 Ga0501037_0003466_9011_9457 148
527 3300049573 Ga0501037_0194717 Ga0501037_0194717_390_836 148
528 3300049573 Ga0501037_1133153 Ga0501037_1133153_21_467 148
529 3300049574 Ga0501038_0002758 Ga0501038_0002758_12848_13294 148
530 3300049574 Ga0501038_0071498 Ga0501038_0071498_1141_1587 148
531 3300049579 Ga0501043_0001025 Ga0501043_0001025_9739_10185 148
532 3300049579 Ga0501043_0443884 Ga0501043_0443884_361_807 148
533 3300049580 Ga0501046_0001776 Ga0501046_0001776_19330_19776 148
534 3300049581 Ga0501047_0005256 Ga0501047_0005256_9320_9766 148
535 3300049581 Ga0501047_0216470 Ga0501047_0216470_1216_1662 148
536 3300049584 Ga0501068_0283194 Ga0501068_0283194_256_702 148
537 3300049586 Ga0501070_0022776 Ga0501070_0022776_2874_3320 148
538 3300049586 Ga0501070_0135799 Ga0501070_0135799_1476_1922 148
539 3300049589 Ga0501073_0070325 Ga0501073_0070325_546_992 148
540 3300049590 Ga0501074_0041693 Ga0501074_0041693_2111_2557 148
541 3300049742 Ga0501080_0023120 Ga0501080_0023120_2342_2788 148
542 3300049742 Ga0501080_1208722 Ga0501080_1208722_151_597 148
543 3300049822 Ga0501035_0002312 Ga0501035_0002312_9295_9741 148
544 3300049822 Ga0501035_0133005 Ga0501035_0133005_846_1292 148
545 3300049823 Ga0501044_0057455 Ga0501044_0057455_2726_3172 148
546 3300049823 Ga0501044_0436715 Ga0501044_0436715_324_770 148
547 3300049823 Ga0501044_0783816 Ga0501044_0783816_35_481 148
548 3300049824 Ga0501045_0309035 Ga0501045_0309035_114_560 148
549 3300053093 Ga0500651_0000020 Ga0500651_0000020_132666_133112 148
550 3300053119 Ga0500595_000020 Ga0500595_000020_148584_149030 148
551 3300053119 Ga0500595_009804 Ga0500595_009804_917_1363 148
552 3300055283 Ga0500661_009937 Ga0500661_009937_38_484 148

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ej9-assembly1.cif.gz_A crystal structure of biotin protein ligase from methanococcus jannaschii 0.8755 59 109
3sb2-assembly1.cif.gz_B crystal structure of the rna chaperone hfq from herbaspirillum seropedicae smr1 0.7711 47 109
4jrk-assembly1.cif.gz_C-2 crystal structure of escherichia coli hfq surface mutant 0.7693 49 109
3qsu-assembly1.cif.gz_A structure of staphylococcus aureus hfq in complex with a7 rna 0.7603 48 110
4jli-assembly1.cif.gz_B-2 crystal structure of escherichia coli hfq proximal pore mutant 0.7555 50 113
ID Description Score Start End Superfamily
af_Q2FYW7_1_63_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8485 58 112 2.30.30.100
2ej9A02 Mainly Beta;Roll;SH3 type barrels.; 0.8461 59 109 2.30.30.100
af_Q2FYW9_1_64_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8162 50 113 2.30.30.100
af_Q2FYW9_1_64_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.7815 50 113 2.30.30.100
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.7728 48 110 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A840DR02-F1-model_v4 LSM domain protein 0.8236 54 113
AF-A0A1L8MKA6-F1-model_v4 LSM domain protein 0.8179 52 112
AF-A0A6I1UI50-F1-model_v4 Uncharacterized protein 0.817 52 112
AF-A0A2T4PJY5-F1-model_v4 LSM domain protein 0.8144 56 114
AF-A0A2T4LLS1-F1-model_v4 LSM domain protein 0.8139 50 113

Feature Viewer

pLDDT pTM Quality
77.23 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map