F462663

General Info

Members Datasets Scaffolds Average Seq Length
551 213 1102 152

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0226109|Ga0501032_0226109_316_846
Length 176
Sequence VTRPEHYRVVACPGFPGDVRRTIGRVKAPELGRVTDRRPPYKYSALTRVWFSDTDAQGVVYYGRYLPYFDHARTEYHRHLGRLGIDGAEFVMRASTVEYHAPARFDDLLEIFARVGRLGRTSVTYDLCAVRVPDETLMVTATQTLVLVDLETRLPTVIPDAARRPIRAFEGADLAE

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
139 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
140 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
141 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
142 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
143 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 3.45
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 10.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0226109 3300049569 Bacteria 1217
2 ARcpr5oldR_c002055 3300000041 Bacteria 1910
3 ARCol0yngRDRAFT_1001209 3300000652 Bacteria 2181
4 JGI25406J46586_10019843 3300003203 Bacteria 2731
5 Ga0070683_100033450 3300005329 Bacteria 4688
6 Ga0070683_100857990 3300005329 Bacteria 871
7 Ga0070683_100863177 3300005329 Unclassified 868
8 Ga0070683_100958714 3300005329 Unclassified 821
9 Ga0070683_101348642 3300005329 Bacteria 685
10 Ga0070683_101383003 3300005329 Bacteria 676
11 Ga0070680_100009711 3300005336 Bacteria 7404
12 Ga0070680_100608927 3300005336 Bacteria 938
13 Ga0070682_100069407 3300005337 Bacteria 2250
14 Ga0070682_100665020 3300005337 Bacteria 831
15 Ga0070682_100716903 3300005337 Unclassified 804
16 Ga0068868_100664542 3300005338 Bacteria 929
17 Ga0068868_100879250 3300005338 Bacteria 813
18 Ga0068868_101422637 3300005338 Unclassified 647
19 Ga0070689_100374514 3300005340 Unclassified 1199
20 Ga0070691_10009059 3300005341 Bacteria 4553
21 Ga0070692_10071076 3300005345 Unclassified 1854
22 Ga0070692_10450353 3300005345 Bacteria 824
23 Ga0070669_100225487 3300005353 Bacteria 1483
24 Ga0070674_100006411 3300005356 Bacteria 6862
25 Ga0070674_100025564 3300005356 Bacteria 3846
26 Ga0070674_100133532 3300005356 Bacteria 1854
27 Ga0070674_100182113 3300005356 Bacteria 1610
28 Ga0070674_101136991 3300005356 Bacteria 691
29 Ga0070688_100145603 3300005365 Bacteria 1614
30 Ga0070659_100064116 3300005366 Bacteria 2907
31 Ga0070659_100316560 3300005366 Bacteria 1304
32 Ga0070667_100520663 3300005367 Unclassified 1091
33 Ga0070700_100092207 3300005441 Bacteria 1979
34 Ga0070700_100770630 3300005441 Bacteria 772
35 Ga0070700_101107351 3300005441 Bacteria 657
36 Ga0070694_100287763 3300005444 Bacteria 1255
37 Ga0070694_101018434 3300005444 Unclassified 688
38 Ga0070663_100164726 3300005455 Bacteria 1709
39 Ga0070678_100042685 3300005456 Bacteria 3226
40 Ga0070678_100084822 3300005456 Unclassified 2412
41 Ga0070678_100169673 3300005456 Bacteria 1776
42 Ga0070678_101087898 3300005456 Bacteria 738
43 Ga0070662_100154654 3300005457 Bacteria 1789
44 Ga0070662_100585971 3300005457 Bacteria 937
45 Ga0070681_10043363 3300005458 Bacteria 4507
46 Ga0070681_10062803 3300005458 Bacteria 3688
47 Ga0068867_100323760 3300005459 Bacteria 1278
48 Ga0070685_10454772 3300005466 Bacteria 898
49 Ga0070698_100617719 3300005471 Bacteria 1025
50 Ga0070698_100774403 3300005471 Bacteria 903
51 Ga0070699_100010466 3300005518 Bacteria 8025
52 Ga0070679_101430911 3300005530 Bacteria 638
53 Ga0070684_100009169 3300005535 Bacteria 7781
54 Ga0070684_100068922 3300005535 Bacteria 3110
55 Ga0070684_100437715 3300005535 Bacteria 1208
56 Ga0070684_102038836 3300005535 Bacteria 541
57 Ga0070672_100948338 3300005543 Unclassified 761
58 Ga0070672_101236336 3300005543 Bacteria 666
59 Ga0070695_100928892 3300005545 Bacteria 704
60 Ga0070695_100943276 3300005545 Bacteria 699
61 Ga0070696_100174813 3300005546 Bacteria 1590
62 Ga0070693_100083758 3300005547 Bacteria 1907
63 Ga0070693_100260662 3300005547 Bacteria 1153
64 Ga0070665_100497805 3300005548 Bacteria 1230
65 Ga0070665_100622213 3300005548 Bacteria 1093
66 Ga0070704_100248804 3300005549 Bacteria 1459
67 Ga0070704_100284384 3300005549 Bacteria 1372
68 Ga0070664_100307394 3300005564 Bacteria 1434
69 Ga0070664_100570402 3300005564 Bacteria 1048
70 Ga0070664_101592946 3300005564 Bacteria 619
71 Ga0068857_100954209 3300005577 Unclassified 824
72 Ga0068854_100317062 3300005578 Unclassified 1266
73 Ga0068856_100199061 3300005614 Bacteria 2018
74 Ga0070702_100386400 3300005615 Bacteria 997
75 Ga0070702_100726523 3300005615 Bacteria 760
76 Ga0070702_101192407 3300005615 Bacteria 613
77 Ga0068852_100391236 3300005616 Bacteria 1366
78 Ga0068852_100730019 3300005616 Bacteria 1002
79 Ga0068852_101383015 3300005616 Bacteria 726
80 Ga0068864_100531515 3300005618 Bacteria 1135
81 Ga0068864_100645735 3300005618 Bacteria 1030
82 Ga0068866_10128479 3300005718 Bacteria 1438
83 Ga0068861_100501876 3300005719 Bacteria 1097
84 Ga0068861_101391345 3300005719 Unclassified 685
85 Ga0068851_10457654 3300005834 Unclassified 759
86 Ga0068870_10001646 3300005840 Bacteria 9127
87 Ga0068870_11222579 3300005840 Bacteria 545
88 Ga0068863_100425112 3300005841 Bacteria 1302
89 Ga0081455_10058979 3300005937 Bacteria 3243
90 Ga0081538_10218729 3300005981 Bacteria 758
91 Ga0081539_10002469 3300005985 Bacteria 26025
92 Ga0075363_100147439 3300006048 Bacteria 1327
93 Ga0075364_10006824 3300006051 Bacteria 6737
94 Ga0075432_10001100 3300006058 Bacteria 8632
95 Ga0075432_10058074 3300006058 Bacteria 1374
96 Ga0075432_10061492 3300006058 Bacteria 1338
97 Ga0075367_10104743 3300006178 Bacteria 1732
98 Ga0097621_101166005 3300006237 Bacteria 725
99 Ga0068871_100220495 3300006358 Bacteria 1643
100 Ga0068871_100584718 3300006358 Bacteria 1014
101 Ga0075428_100014919 3300006844 Bacteria 8633
102 Ga0075428_100199123 3300006844 Bacteria 2166
103 Ga0075428_100408219 3300006844 Bacteria 1455
104 Ga0075428_100663305 3300006844 Bacteria 1112
105 Ga0075428_100749666 3300006844 Unclassified 1039
106 Ga0075430_100017003 3300006846 Bacteria 6194
107 Ga0075431_100001086 3300006847 Bacteria 24354
108 Ga0075431_100127061 3300006847 Bacteria 2630
109 Ga0075433_10067297 3300006852 Bacteria 3144
110 Ga0075434_100158571 3300006871 Bacteria 2282
111 Ga0075429_100554663 3300006880 Bacteria 1007
112 Ga0068865_100048351 3300006881 Bacteria 2927
113 Ga0111539_10017300 3300009094 Bacteria 8923
114 Ga0111539_10026264 3300009094 Bacteria 7122
115 Ga0111539_10126328 3300009094 Bacteria 2996
116 Ga0111539_10250758 3300009094 Bacteria 2061
117 Ga0111539_12860935 3300009094 Bacteria 559
118 Ga0105245_10020799 3300009098 Bacteria 5752
119 Ga0105245_10223619 3300009098 Unclassified 1818
120 Ga0105245_10299792 3300009098 Bacteria 1577
121 Ga0105245_10339498 3300009098 Bacteria 1485
122 Ga0105245_11010906 3300009098 Bacteria 876
123 Ga0105245_12068758 3300009098 Bacteria 623
124 Ga0114129_10001826 3300009147 Bacteria 28991
125 Ga0114129_10073310 3300009147 Bacteria 4769
126 Ga0114129_10075720 3300009147 Bacteria 4686
127 Ga0114129_10311829 3300009147 Bacteria 2094
128 Ga0114129_10493130 3300009147 Bacteria 1601
129 Ga0114129_10719549 3300009147 Bacteria 1281
130 Ga0114129_10996888 3300009147 Bacteria 1055
131 Ga0114129_11197245 3300009147 Unclassified 946
132 Ga0114129_12051259 3300009147 Bacteria 691
133 Ga0105243_10008779 3300009148 Bacteria 7740
134 Ga0105243_10053652 3300009148 Bacteria 3198
135 Ga0105243_10178456 3300009148 Bacteria 1845
136 Ga0105243_12517583 3300009148 Unclassified 554
137 Ga0105242_10066102 3300009176 Bacteria 2985
138 Ga0105242_10275915 3300009176 Bacteria 1525
139 Ga0105242_10867374 3300009176 Bacteria 900
140 Ga0105248_10131546 3300009177 Bacteria 2823
141 Ga0105237_10819548 3300009545 Bacteria 937
142 Ga0105249_10287664 3300009553 Bacteria 1644
143 Ga0105249_10360904 3300009553 Bacteria 1474
144 Ga0105239_10003394 3300010375 Bacteria 19536
145 Ga0105239_10033095 3300010375 Bacteria 5678
146 Ga0105239_10367305 3300010375 Bacteria 1626
147 Ga0105246_10044144 3300011119 Bacteria 3028
148 Ga0105246_10044685 3300011119 Bacteria 3012
149 Ga0105246_10105450 3300011119 Bacteria 2060
150 Ga0105246_10301165 3300011119 Bacteria 1294
151 Ga0105246_10362148 3300011119 Bacteria 1192
152 Ga0105246_11983876 3300011119 Unclassified 561
153 Ga0157338_1015551 3300012515 Bacteria 832
154 Ga0157371_10134777 3300013102 Bacteria 1758
155 Ga0157371_10247269 3300013102 Bacteria 1284
156 Ga0157374_10506689 3300013296 Bacteria 1212
157 Ga0157378_10250312 3300013297 Bacteria 1696
158 Ga0157378_11191938 3300013297 Bacteria 801
159 Ga0163162_12186641 3300013306 Unclassified 635
160 Ga0157372_10045510 3300013307 Bacteria 4869
161 Ga0157372_10891917 3300013307 Bacteria 1032
162 Ga0157375_10459653 3300013308 Bacteria 1438
163 Ga0157375_10657399 3300013308 Bacteria 1204
164 Ga0157375_11521508 3300013308 Bacteria 790
165 Ga0163163_10107982 3300014325 Bacteria 2810
166 Ga0163163_10294295 3300014325 Bacteria 1676
167 Ga0163163_10756306 3300014325 Bacteria 1035
168 Ga0157380_10007803 3300014326 Bacteria 7615
169 Ga0157380_10018078 3300014326 Bacteria 5230
170 Ga0157380_11546956 3300014326 Bacteria 717
171 Ga0157377_10506488 3300014745 Bacteria 845
172 Ga0157379_10278616 3300014968 Bacteria 1522
173 Ga0157379_10512720 3300014968 Bacteria 1112
174 Ga0157379_11058601 3300014968 Bacteria 775
175 Ga0157376_10301355 3300014969 Bacteria 1517
176 Ga0157376_12175674 3300014969 Unclassified 593
177 Ga0163161_10526168 3300017792 Bacteria 966
178 Ga0206356_10803345 3300020070 Bacteria 951
179 Ga0207656_10264249 3300025321 Unclassified 846
180 Ga0207688_10220169 3300025901 Bacteria 1143
181 Ga0207643_10009784 3300025908 Bacteria 5148
182 Ga0207643_10059785 3300025908 Bacteria 2175
183 Ga0207707_10097008 3300025912 Bacteria 2576
184 Ga0207660_10023845 3300025917 Bacteria 4136
185 Ga0207660_10283484 3300025917 Bacteria 1315
186 Ga0207657_10385388 3300025919 Bacteria 1103
187 Ga0207657_10688148 3300025919 Unclassified 795
188 Ga0207649_10651091 3300025920 Viruses 814
189 Ga0207652_10177260 3300025921 Bacteria 1914
190 Ga0207652_11306270 3300025921 Bacteria 628
191 Ga0207681_10599832 3300025923 Bacteria 910
192 Ga0207694_10452760 3300025924 Bacteria 1072
193 Ga0207659_10217228 3300025926 Bacteria 1535
194 Ga0207687_10011978 3300025927 Bacteria 5672
195 Ga0207687_10165215 3300025927 Bacteria 1702
196 Ga0207687_10315487 3300025927 Bacteria 1264
197 Ga0207687_10512174 3300025927 Viruses 1003
198 Ga0207690_10024221 3300025932 Bacteria 3799
199 Ga0207690_10307360 3300025932 Bacteria 1243
200 Ga0207690_11271782 3300025932 Bacteria 615
201 Ga0207706_10027022 3300025933 Bacteria 5134
202 Ga0207706_10170371 3300025933 Bacteria 1913
203 Ga0207686_10039686 3300025934 Bacteria 2858
204 Ga0207709_10240362 3300025935 Bacteria 1317
205 Ga0207709_10248911 3300025935 Bacteria 1297
206 Ga0207709_10426171 3300025935 Bacteria 1020
207 Ga0207670_10381578 3300025936 Unclassified 1123
208 Ga0207669_10019624 3300025937 Bacteria 3525
209 Ga0207669_10268057 3300025937 Bacteria 1281
210 Ga0207669_10785326 3300025937 Bacteria 789
211 Ga0207669_11049573 3300025937 Bacteria 686
212 Ga0207669_11333590 3300025937 Bacteria 610
213 Ga0207704_10161144 3300025938 Bacteria 1596
214 Ga0207704_10343633 3300025938 Bacteria 1159
215 Ga0207704_10459309 3300025938 Bacteria 1018
216 Ga0207704_10551785 3300025938 Bacteria 936
217 Ga0207691_10075567 3300025940 Bacteria 3038
218 Ga0207711_10332251 3300025941 Bacteria 1406
219 Ga0207711_10868074 3300025941 Bacteria 839
220 Ga0207661_10125631 3300025944 Bacteria 2190
221 Ga0207661_10189866 3300025944 Bacteria 1800
222 Ga0207661_10344270 3300025944 Bacteria 1344
223 Ga0207661_11274524 3300025944 Bacteria 676
224 Ga0207679_10023176 3300025945 Bacteria 4240
225 Ga0207679_10343514 3300025945 Bacteria 1299
226 Ga0207679_10357356 3300025945 Bacteria 1275
227 Ga0207679_10680243 3300025945 Bacteria 933
228 Ga0207651_10199920 3300025960 Bacteria 1601
229 Ga0207712_10770006 3300025961 Bacteria 844
230 Ga0207668_11113540 3300025972 Bacteria 708
231 Ga0207640_10282558 3300025981 Bacteria 1304
232 Ga0207640_11153777 3300025981 Unclassified 687
233 Ga0207658_10470812 3300025986 Unclassified 1115
234 Ga0207677_10281792 3300026023 Bacteria 1365
235 Ga0207677_10636372 3300026023 Bacteria 940
236 Ga0207708_10185161 3300026075 Bacteria 1654
237 Ga0207708_11012551 3300026075 Bacteria 722
238 Ga0207708_11104330 3300026075 Bacteria 691
239 Ga0207641_10363776 3300026088 Bacteria 1382
240 Ga0207648_10037995 3300026089 Bacteria 4238
241 Ga0207648_10057986 3300026089 Bacteria 3377
242 Ga0207676_10413983 3300026095 Bacteria 1263
243 Ga0207674_10243630 3300026116 Bacteria 1745
244 Ga0207674_10545549 3300026116 Bacteria 1120
245 Ga0207675_100915708 3300026118 Unclassified 893
246 Ga0207675_101087712 3300026118 Bacteria 819
247 Ga0207683_10011133 3300026121 Bacteria 7666
248 Ga0207683_10143846 3300026121 Bacteria 2149
249 Ga0207683_10347303 3300026121 Bacteria 1361
250 Ga0207683_10897618 3300026121 Bacteria 823
251 Ga0207683_11402530 3300026121 Bacteria 646
252 Ga0207698_10063915 3300026142 Bacteria 2883
253 Ga0207698_11061194 3300026142 Bacteria 822
254 Ga0207428_10000774 3300027907 Bacteria 36366
255 Ga0207428_10009350 3300027907 Bacteria 8793
256 Ga0207428_10069640 3300027907 Bacteria 2766
257 Ga0207428_10468633 3300027907 Bacteria 917
258 Ga0268266_11387715 3300028379 Bacteria 678
259 Ga0307405_10139505 3300031731 Bacteria 1688
260 Ga0307412_10447933 3300031911 Bacteria 1063
261 Ga0307409_100937336 3300031995 Bacteria 881
262 Ga0307416_100005741 3300032002 Bacteria 7682
263 Ga0307415_100018945 3300032126 Bacteria 4169
264 Ga0307415_100417889 3300032126 Bacteria 1150
265 Ga0373938_0104536 3300034957 Bacteria 715
266 Ga0373962_0219717 3300035242 Bacteria 650
267 Ga0395900_0122965 3300037418 Unclassified 2662
268 Ga0395905_1528586 3300037471 Bacteria 572
269 Ga0451807_2245918 3300041486 Bacteria 1504
270 Ga0451839_1211428 3300041496 Unclassified 739
271 Ga0451853_2783738 3300041512 Bacteria 2789
272 Ga0451853_3551878 3300041512 Bacteria 1078
273 Ga0439463_146073 3300042016 Bacteria 613
274 Ga0450920_012661 3300042122 Bacteria 1584
275 Ga0450923_050974 3300042125 Bacteria 889
276 Ga0450906_025782 3300042145 Unclassified 1044
277 Ga0450907_054929 3300042146 Bacteria 686
278 Ga0450918_026257 3300042531 Bacteria 1022
279 Ga0451576_1294480 3300045051 Unclassified 760
280 Ga0495603_0094273 3300046455 Bacteria 1749
281 Ga0495603_0190643 3300046455 Unclassified 1185
282 Ga0495584_0141898 3300046491 Unclassified 1220
283 Ga0495585_0208491 3300046492 Bacteria 992
284 Ga0495596_0074531 3300046500 Bacteria 1318
285 Ga0495596_0094250 3300046500 Bacteria 1162
286 Ga0495607_0391673 3300046501 Bacteria 634
287 Ga0495631_0430688 3300046518 Unclassified 562
288 Ga0495663_0044228 3300046525 Bacteria 1363
289 Ga0495656_0030715 3300046615 Bacteria 2174
290 Ga0495656_0219966 3300046615 Bacteria 949
291 Ga0495656_0381057 3300046615 Bacteria 735
292 Ga0495611_0125176 3300046648 Bacteria 1199
293 Ga0495588_0215327 3300046674 Unclassified 1014
294 Ga0495588_0501210 3300046674 Bacteria 636
295 Ga0495589_0239175 3300046794 Bacteria 850
296 Ga0495589_0405785 3300046794 Bacteria 625
297 Ga0495660_0275246 3300046810 Bacteria 772
298 Ga0495677_0059153 3300047445 Bacteria 1419
299 Ga0495677_0208177 3300047445 Bacteria 761
300 Ga0496101_0304855 3300048904 Bacteria 1248
301 Ga0496101_0464385 3300048904 Bacteria 999
302 Ga0496102_0734708 3300048905 Bacteria 910
303 Ga0496104_0737493 3300048907 Bacteria 892
304 Ga0496105_0445930 3300048908 Unclassified 1022
305 Ga0496106_1060521 3300048909 Bacteria 636
306 Ga0496108_0084724 3300048911 Bacteria 2690
307 Ga0496109_0065816 3300048912 Bacteria 3318
308 Ga0496109_0090739 3300048912 Bacteria 2826
309 Ga0496109_0156998 3300048912 Bacteria 2131
310 Ga0496110_0162094 3300048913 Bacteria 2027
311 Ga0496110_0351137 3300048913 Bacteria 1343
312 Ga0496111_0102308 3300048914 Bacteria 2106
313 Ga0496112_0169643 3300048915 Bacteria 2148
314 Ga0496113_0007808 3300048916 Bacteria 6914
315 Ga0496114_0222118 3300048917 Bacteria 1659
316 Ga0496114_1099460 3300048917 Bacteria 680
317 Ga0496114_1292027 3300048917 Bacteria 616
318 Ga0501031_0015412 3300049568 Bacteria 4963
319 Ga0501031_0027984 3300049568 Bacteria 3674
320 Ga0501031_0062650 3300049568 Bacteria 2423
321 Ga0501031_0117623 3300049568 Unclassified 1737
322 Ga0501032_0197492 3300049569 Bacteria 1313
323 Ga0501033_0041262 3300049570 Bacteria 3444
324 Ga0501033_0143283 3300049570 Unclassified 1727
325 Ga0501033_0231169 3300049570 Bacteria 1314
326 Ga0501033_0367785 3300049570 Bacteria 1006
327 Ga0501033_0654742 3300049570 Bacteria 717
328 Ga0501036_0013132 3300049572 Bacteria 6879
329 Ga0501036_0016878 3300049572 Bacteria 6099
330 Ga0501036_0035429 3300049572 Bacteria 4224
331 Ga0501036_0039167 3300049572 Bacteria 4013
332 Ga0501036_0148351 3300049572 Bacteria 1978
333 Ga0501036_0245316 3300049572 Bacteria 1502
334 Ga0501036_0494567 3300049572 Bacteria 1018
335 Ga0501036_0604673 3300049572 Bacteria 909
336 Ga0501036_0852081 3300049572 Unclassified 749
337 Ga0501037_0104053 3300049573 Bacteria 2047
338 Ga0501037_0115387 3300049573 Bacteria 1933
339 Ga0501037_0135379 3300049573 Bacteria 1764
340 Ga0501037_0445814 3300049573 Bacteria 883
341 Ga0501038_0024197 3300049574 Bacteria 5419
342 Ga0501038_0030096 3300049574 Bacteria 4807
343 Ga0501038_0040704 3300049574 Bacteria 4055
344 Ga0501038_0104097 3300049574 Bacteria 2359
345 Ga0501038_0154849 3300049574 Unclassified 1867
346 Ga0501038_0608985 3300049574 Unclassified 826
347 Ga0501038_1139447 3300049574 Bacteria 568
348 Ga0501039_0007990 3300049575 Bacteria 8061
349 Ga0501039_0037161 3300049575 Bacteria 3758
350 Ga0501039_0098091 3300049575 Bacteria 2286
351 Ga0501039_0115218 3300049575 Bacteria 2103
352 Ga0501039_0160924 3300049575 Bacteria 1764
353 Ga0501039_0307731 3300049575 Unclassified 1246
354 Ga0501040_0038227 3300049576 Bacteria 3262
355 Ga0501040_0050039 3300049576 Bacteria 2857
356 Ga0501040_0054282 3300049576 Bacteria 2747
357 Ga0501040_0101470 3300049576 Bacteria 2007
358 Ga0501040_0137584 3300049576 Bacteria 1719
359 Ga0501041_0006871 3300049577 Bacteria 6669
360 Ga0501041_0071958 3300049577 Bacteria 2123
361 Ga0501041_0075449 3300049577 Bacteria 2073
362 Ga0501041_0124291 3300049577 Bacteria 1605
363 Ga0501041_0638133 3300049577 Bacteria 680
364 Ga0501042_0005607 3300049578 Bacteria 8095
365 Ga0501042_0016744 3300049578 Bacteria 5040
366 Ga0501042_0020756 3300049578 Bacteria 4573
367 Ga0501042_0053620 3300049578 Bacteria 2877
368 Ga0501042_0099078 3300049578 Unclassified 2095
369 Ga0501042_0119380 3300049578 Bacteria 1898
370 Ga0501042_0160056 3300049578 Unclassified 1624
371 Ga0501042_0170789 3300049578 Bacteria 1569
372 Ga0501042_0409095 3300049578 Bacteria 983
373 Ga0501043_0058586 3300049579 Bacteria 3023
374 Ga0501043_0084391 3300049579 Bacteria 2496
375 Ga0501046_0017951 3300049580 Bacteria 5896
376 Ga0501048_0019577 3300049582 Bacteria 4964
377 Ga0501048_0020038 3300049582 Bacteria 4905
378 Ga0501048_0021892 3300049582 Bacteria 4678
379 Ga0501048_0069703 3300049582 Bacteria 2483
380 Ga0501048_0089466 3300049582 Bacteria 2172
381 Ga0501048_0090249 3300049582 Unclassified 2161
382 Ga0501048_0203708 3300049582 Bacteria 1403
383 Ga0501067_0012458 3300049583 Bacteria 4718
384 Ga0501068_0005459 3300049584 Bacteria 6960
385 Ga0501068_0008457 3300049584 Bacteria 5726
386 Ga0501068_0010609 3300049584 Bacteria 5181
387 Ga0501068_0080043 3300049584 Bacteria 2003
388 Ga0501069_0006879 3300049585 Bacteria 5946
389 Ga0501069_0076049 3300049585 Bacteria 1887
390 Ga0501069_0086151 3300049585 Bacteria 1773
391 Ga0501070_0060070 3300049586 Bacteria 3151
392 Ga0501070_0252801 3300049586 Bacteria 1441
393 Ga0501070_0653062 3300049586 Bacteria 835
394 Ga0501070_1402434 3300049586 Unclassified 531
395 Ga0501071_0002446 3300049587 Bacteria 11270
396 Ga0501071_0004373 3300049587 Bacteria 8965
397 Ga0501071_0004669 3300049587 Bacteria 8703
398 Ga0501071_0007747 3300049587 Bacteria 7082
399 Ga0501071_0009995 3300049587 Bacteria 6340
400 Ga0501071_0020672 3300049587 Bacteria 4577
401 Ga0501071_0282651 3300049587 Bacteria 1256
402 Ga0501071_0483118 3300049587 Bacteria 949
403 Ga0501071_0662208 3300049587 Bacteria 803
404 Ga0501072_0002373 3300049588 Bacteria 14127
405 Ga0501072_0003835 3300049588 Bacteria 11357
406 Ga0501072_0005411 3300049588 Bacteria 9720
407 Ga0501072_0187777 3300049588 Bacteria 1648
408 Ga0501072_0273222 3300049588 Bacteria 1344
409 Ga0501072_0299882 3300049588 Unclassified 1277
410 Ga0501072_0432025 3300049588 Bacteria 1043
411 Ga0501072_0560374 3300049588 Bacteria 902
412 Ga0501072_0998075 3300049588 Bacteria 653
413 Ga0501073_0032933 3300049589 Bacteria 3693
414 Ga0501073_0224533 3300049589 Bacteria 1297
415 Ga0501073_0417215 3300049589 Bacteria 927
416 Ga0501073_0522309 3300049589 Bacteria 820
417 Ga0501074_0001992 3300049590 Bacteria 14066
418 Ga0501074_0019549 3300049590 Bacteria 4917
419 Ga0501074_0022780 3300049590 Bacteria 4554
420 Ga0501074_0050731 3300049590 Bacteria 2995
421 Ga0501074_0084589 3300049590 Bacteria 2274
422 Ga0501074_0102131 3300049590 Unclassified 2052
423 Ga0501074_0288826 3300049590 Unclassified 1166
424 Ga0501074_0812064 3300049590 Unclassified 659
425 Ga0501075_0005154 3300049591 Bacteria 8938
426 Ga0501075_0026293 3300049591 Bacteria 4283
427 Ga0501075_0028456 3300049591 Bacteria 4125
428 Ga0501075_0070116 3300049591 Bacteria 2649
429 Ga0501075_0136939 3300049591 Bacteria 1865
430 Ga0501075_0569381 3300049591 Bacteria 864
431 Ga0501075_1127165 3300049591 Bacteria 595
432 Ga0501076_0003147 3300049592 Bacteria 11509
433 Ga0501076_0006735 3300049592 Bacteria 8337
434 Ga0501076_0073947 3300049592 Bacteria 2729
435 Ga0501076_0109782 3300049592 Bacteria 2229
436 Ga0501076_0116060 3300049592 Bacteria 2166
437 Ga0501076_0177738 3300049592 Bacteria 1735
438 Ga0501076_0215142 3300049592 Bacteria 1571
439 Ga0501076_0930155 3300049592 Bacteria 717
440 Ga0501076_1056166 3300049592 Bacteria 669
441 Ga0501076_1112724 3300049592 Bacteria 650
442 Ga0501076_1357418 3300049592 Unclassified 584
443 Ga0501077_0001220 3300049593 Bacteria 15544
444 Ga0501077_0003748 3300049593 Bacteria 9146
445 Ga0501077_0032845 3300049593 Bacteria 3305
446 Ga0501077_0051460 3300049593 Unclassified 2617
447 Ga0501077_0078961 3300049593 Bacteria 2085
448 Ga0501077_0292915 3300049593 Bacteria 1036
449 Ga0501079_0016902 3300049741 Bacteria 5572
450 Ga0501079_0021226 3300049741 Bacteria 4966
451 Ga0501079_0050081 3300049741 Bacteria 3225
452 Ga0501079_0120368 3300049741 Unclassified 2041
453 Ga0501079_0149193 3300049741 Bacteria 1823
454 Ga0501079_0184181 3300049741 Bacteria 1630
455 Ga0501079_0575870 3300049741 Bacteria 886
456 Ga0501079_0958961 3300049741 Bacteria 674
457 Ga0501080_0012741 3300049742 Bacteria 7713
458 Ga0501080_0017117 3300049742 Bacteria 6695
459 Ga0501080_0028920 3300049742 Bacteria 5159
460 Ga0501080_0033789 3300049742 Bacteria 4774
461 Ga0501080_0248941 3300049742 Bacteria 1621
462 Ga0501080_0339181 3300049742 Bacteria 1358
463 Ga0501080_0365261 3300049742 Unclassified 1302
464 Ga0501080_0397396 3300049742 Unclassified 1240
465 Ga0501080_1676339 3300049742 Bacteria 537
466 Ga0501081_0003619 3300049743 Bacteria 9886
467 Ga0501081_0008936 3300049743 Bacteria 6511
468 Ga0501081_0018785 3300049743 Bacteria 4591
469 Ga0501081_0100166 3300049743 Bacteria 2048
470 Ga0501081_0212733 3300049743 Bacteria 1404
471 Ga0501081_0220946 3300049743 Bacteria 1378
472 Ga0501081_0598177 3300049743 Bacteria 826
473 Ga0501081_0762892 3300049743 Bacteria 727
474 Ga0501083_0001561 3300049744 Bacteria 15662
475 Ga0501083_0096423 3300049744 Bacteria 1951
476 Ga0501083_0116725 3300049744 Bacteria 1752
477 Ga0501083_0337437 3300049744 Bacteria 980
478 Ga0501035_0008422 3300049822 Bacteria 9603
479 Ga0501035_0172120 3300049822 Bacteria 1870
480 Ga0501035_0180992 3300049822 Bacteria 1816
481 Ga0501035_0248293 3300049822 Bacteria 1512
482 Ga0501035_0350214 3300049822 Bacteria 1236
483 Ga0501035_0529068 3300049822 Unclassified 968
484 Ga0501044_0129374 3300049823 Bacteria 2520
485 Ga0501044_0150243 3300049823 Bacteria 2312
486 Ga0501044_0473623 3300049823 Unclassified 1156
487 Ga0501045_0006162 3300049824 Bacteria 8310
488 Ga0501045_0059250 3300049824 Bacteria 2804
489 Ga0501045_0087676 3300049824 Bacteria 2298
490 Ga0501045_0091347 3300049824 Bacteria 2250
491 Ga0501045_0124376 3300049824 Bacteria 1915
492 Ga0501045_0152018 3300049824 Bacteria 1722
493 Ga0501045_0210994 3300049824 Bacteria 1446
494 nmdc:mga00v17_59633_c2 3300050491 Bacteria 1920
495 nmdc:mga06z11_400472_c1 3300050494 Bacteria 826
496 nmdc:mga05p37_1614_c1 3300050507 Bacteria 26128
497 nmdc:mga05p37_231003_c1 3300050507 Bacteria 2229
498 nmdc:mga05p37_29992_c1 3300050507 Bacteria 6637
499 nmdc:mga05p37_525104_c1 3300050507 Bacteria 1353
500 nmdc:mga05p37_626901_c1 3300050507 Bacteria 1209
501 nmdc:mga05p37_63427_c2 3300050507 Bacteria 4075
502 nmdc:mga05p37_901659_c1 3300050507 Unclassified 953
503 nmdc:mga09592_144573_c1 3300050508 Bacteria 2051
504 nmdc:mga09592_350649_c1 3300050508 Bacteria 1277
505 nmdc:mga09592_75907_c1 3300050508 Bacteria 2858
506 nmdc:mga09592_858816_c1 3300050508 Bacteria 765
507 nmdc:mga0qj67_34479_c1 3300050509 Bacteria 3954
508 nmdc:mga06r32_1948_c1 3300050510 Bacteria 18394
509 nmdc:mga06r32_573817_c1 3300050510 Bacteria 1100
510 nmdc:mga06r32_93798_c1 3300050510 Bacteria 2936
511 nmdc:mga08y16_1039_c1 3300050511 Bacteria 27204
512 nmdc:mga08y16_1606139_c1 3300050511 Bacteria 608
513 nmdc:mga08y16_1892195_c1 3300050511 Bacteria 548
514 nmdc:mga08y16_315862_c1 3300050511 Bacteria 1609
515 nmdc:mga08y16_9477_c1 3300050511 Bacteria 10219
516 nmdc:mga08y16_98684_c1 3300050511 Bacteria 3041
517 nmdc:mga08x19_187406_c1 3300050514 Bacteria 1414
518 nmdc:mga0a205_173538_c1 3300050515 Bacteria 2052
519 nmdc:mga0a205_765595_c1 3300050515 Bacteria 814
520 nmdc:mga0a205_864851_c1 3300050515 Bacteria 751
521 Ga0495655_0051671 3300053083 Bacteria 1090
522 Ga0495655_0100499 3300053083 Bacteria 856
523 Ga0501084_0013577 3300054114 Bacteria 6739
524 Ga0501084_0034014 3300054114 Bacteria 4262
525 Ga0501084_0079619 3300054114 Bacteria 2746
526 Ga0501084_0089708 3300054114 Bacteria 2580
527 Ga0501084_0091415 3300054114 Bacteria 2555
528 Ga0501084_0134280 3300054114 Bacteria 2083
529 Ga0501084_0164635 3300054114 Bacteria 1871
530 Ga0501084_0305333 3300054114 Bacteria 1344
531 Ga0501084_0403420 3300054114 Bacteria 1155
532 Ga0501084_0718088 3300054114 Bacteria 842
533 Ga0501084_0978572 3300054114 Bacteria 711
534 Ga0590074_019132 3300059423 Bacteria 1174
535 Ga0501082_0014081 3300060353 Bacteria 6880
536 Ga0501082_0047400 3300060353 Bacteria 3703
537 Ga0501082_0053847 3300060353 Bacteria 3468
538 Ga0501082_0105230 3300060353 Bacteria 2441
539 Ga0501082_0131176 3300060353 Bacteria 2174
540 Ga0501082_0292853 3300060353 Bacteria 1417
541 Ga0501082_0346473 3300060353 Bacteria 1295
542 Ga0501082_1293148 3300060353 Bacteria 637
543 Ga0530510_0016597 3300061734 Bacteria 5213
544 Ga0530510_0027573 3300061734 Bacteria 4069
545 Ga0530510_0085041 3300061734 Bacteria 2304
546 Ga0530510_0095617 3300061734 Bacteria 2170
547 Ga0530510_0201460 3300061734 Bacteria 1478
548 Ga0530510_0256055 3300061734 Unclassified 1305
549 Ga0530510_0263291 3300061734 Bacteria 1286
550 Ga0530510_0325578 3300061734 Unclassified 1152
551 Ga0530510_1290215 3300061734 Bacteria 560
552 Ga0501032_0226109
553 ARcpr5oldR_c002055
554 ARCol0yngRDRAFT_1001209
555 JGI25406J46586_10019843
556 Ga0070683_100033450
557 Ga0070683_100857990
558 Ga0070683_100863177
559 Ga0070683_100958714
560 Ga0070683_101348642
561 Ga0070683_101383003
562 Ga0070680_100009711
563 Ga0070680_100608927
564 Ga0070682_100069407
565 Ga0070682_100665020
566 Ga0070682_100716903
567 Ga0068868_100664542
568 Ga0068868_100879250
569 Ga0068868_101422637
570 Ga0070689_100374514
571 Ga0070691_10009059
572 Ga0070692_10071076
573 Ga0070692_10450353
574 Ga0070669_100225487
575 Ga0070674_100006411
576 Ga0070674_100025564
577 Ga0070674_100133532
578 Ga0070674_100182113
579 Ga0070674_101136991
580 Ga0070688_100145603
581 Ga0070659_100064116
582 Ga0070659_100316560
583 Ga0070667_100520663
584 Ga0070700_100092207
585 Ga0070700_100770630
586 Ga0070700_101107351
587 Ga0070694_100287763
588 Ga0070694_101018434
589 Ga0070663_100164726
590 Ga0070678_100042685
591 Ga0070678_100084822
592 Ga0070678_100169673
593 Ga0070678_101087898
594 Ga0070662_100154654
595 Ga0070662_100585971
596 Ga0070681_10043363
597 Ga0070681_10062803
598 Ga0068867_100323760
599 Ga0070685_10454772
600 Ga0070698_100617719
601 Ga0070698_100774403
602 Ga0070699_100010466
603 Ga0070679_101430911
604 Ga0070684_100009169
605 Ga0070684_100068922
606 Ga0070684_100437715
607 Ga0070684_102038836
608 Ga0070672_100948338
609 Ga0070672_101236336
610 Ga0070695_100928892
611 Ga0070695_100943276
612 Ga0070696_100174813
613 Ga0070693_100083758
614 Ga0070693_100260662
615 Ga0070665_100497805
616 Ga0070665_100622213
617 Ga0070704_100248804
618 Ga0070704_100284384
619 Ga0070664_100307394
620 Ga0070664_100570402
621 Ga0070664_101592946
622 Ga0068857_100954209
623 Ga0068854_100317062
624 Ga0068856_100199061
625 Ga0070702_100386400
626 Ga0070702_100726523
627 Ga0070702_101192407
628 Ga0068852_100391236
629 Ga0068852_100730019
630 Ga0068852_101383015
631 Ga0068864_100531515
632 Ga0068864_100645735
633 Ga0068866_10128479
634 Ga0068861_100501876
635 Ga0068861_101391345
636 Ga0068851_10457654
637 Ga0068870_10001646
638 Ga0068870_11222579
639 Ga0068863_100425112
640 Ga0081455_10058979
641 Ga0081538_10218729
642 Ga0081539_10002469
643 Ga0075363_100147439
644 Ga0075364_10006824
645 Ga0075432_10001100
646 Ga0075432_10058074
647 Ga0075432_10061492
648 Ga0075367_10104743
649 Ga0097621_101166005
650 Ga0068871_100220495
651 Ga0068871_100584718
652 Ga0075428_100014919
653 Ga0075428_100199123
654 Ga0075428_100408219
655 Ga0075428_100663305
656 Ga0075428_100749666
657 Ga0075430_100017003
658 Ga0075431_100001086
659 Ga0075431_100127061
660 Ga0075433_10067297
661 Ga0075434_100158571
662 Ga0075429_100554663
663 Ga0068865_100048351
664 Ga0111539_10017300
665 Ga0111539_10026264
666 Ga0111539_10126328
667 Ga0111539_10250758
668 Ga0111539_12860935
669 Ga0105245_10020799
670 Ga0105245_10223619
671 Ga0105245_10299792
672 Ga0105245_10339498
673 Ga0105245_11010906
674 Ga0105245_12068758
675 Ga0114129_10001826
676 Ga0114129_10073310
677 Ga0114129_10075720
678 Ga0114129_10311829
679 Ga0114129_10493130
680 Ga0114129_10719549
681 Ga0114129_10996888
682 Ga0114129_11197245
683 Ga0114129_12051259
684 Ga0105243_10008779
685 Ga0105243_10053652
686 Ga0105243_10178456
687 Ga0105243_12517583
688 Ga0105242_10066102
689 Ga0105242_10275915
690 Ga0105242_10867374
691 Ga0105248_10131546
692 Ga0105237_10819548
693 Ga0105249_10287664
694 Ga0105249_10360904
695 Ga0105239_10003394
696 Ga0105239_10033095
697 Ga0105239_10367305
698 Ga0105246_10044144
699 Ga0105246_10044685
700 Ga0105246_10105450
701 Ga0105246_10301165
702 Ga0105246_10362148
703 Ga0105246_11983876
704 Ga0157338_1015551
705 Ga0157371_10134777
706 Ga0157371_10247269
707 Ga0157374_10506689
708 Ga0157378_10250312
709 Ga0157378_11191938
710 Ga0163162_12186641
711 Ga0157372_10045510
712 Ga0157372_10891917
713 Ga0157375_10459653
714 Ga0157375_10657399
715 Ga0157375_11521508
716 Ga0163163_10107982
717 Ga0163163_10294295
718 Ga0163163_10756306
719 Ga0157380_10007803
720 Ga0157380_10018078
721 Ga0157380_11546956
722 Ga0157377_10506488
723 Ga0157379_10278616
724 Ga0157379_10512720
725 Ga0157379_11058601
726 Ga0157376_10301355
727 Ga0157376_12175674
728 Ga0163161_10526168
729 Ga0206356_10803345
730 Ga0207656_10264249
731 Ga0207688_10220169
732 Ga0207643_10009784
733 Ga0207643_10059785
734 Ga0207707_10097008
735 Ga0207660_10023845
736 Ga0207660_10283484
737 Ga0207657_10385388
738 Ga0207657_10688148
739 Ga0207649_10651091
740 Ga0207652_10177260
741 Ga0207652_11306270
742 Ga0207681_10599832
743 Ga0207694_10452760
744 Ga0207659_10217228
745 Ga0207687_10011978
746 Ga0207687_10165215
747 Ga0207687_10315487
748 Ga0207687_10512174
749 Ga0207690_10024221
750 Ga0207690_10307360
751 Ga0207690_11271782
752 Ga0207706_10027022
753 Ga0207706_10170371
754 Ga0207686_10039686
755 Ga0207709_10240362
756 Ga0207709_10248911
757 Ga0207709_10426171
758 Ga0207670_10381578
759 Ga0207669_10019624
760 Ga0207669_10268057
761 Ga0207669_10785326
762 Ga0207669_11049573
763 Ga0207669_11333590
764 Ga0207704_10161144
765 Ga0207704_10343633
766 Ga0207704_10459309
767 Ga0207704_10551785
768 Ga0207691_10075567
769 Ga0207711_10332251
770 Ga0207711_10868074
771 Ga0207661_10125631
772 Ga0207661_10189866
773 Ga0207661_10344270
774 Ga0207661_11274524
775 Ga0207679_10023176
776 Ga0207679_10343514
777 Ga0207679_10357356
778 Ga0207679_10680243
779 Ga0207651_10199920
780 Ga0207712_10770006
781 Ga0207668_11113540
782 Ga0207640_10282558
783 Ga0207640_11153777
784 Ga0207658_10470812
785 Ga0207677_10281792
786 Ga0207677_10636372
787 Ga0207708_10185161
788 Ga0207708_11012551
789 Ga0207708_11104330
790 Ga0207641_10363776
791 Ga0207648_10037995
792 Ga0207648_10057986
793 Ga0207676_10413983
794 Ga0207674_10243630
795 Ga0207674_10545549
796 Ga0207675_100915708
797 Ga0207675_101087712
798 Ga0207683_10011133
799 Ga0207683_10143846
800 Ga0207683_10347303
801 Ga0207683_10897618
802 Ga0207683_11402530
803 Ga0207698_10063915
804 Ga0207698_11061194
805 Ga0207428_10000774
806 Ga0207428_10009350
807 Ga0207428_10069640
808 Ga0207428_10468633
809 Ga0268266_11387715
810 Ga0307405_10139505
811 Ga0307412_10447933
812 Ga0307409_100937336
813 Ga0307416_100005741
814 Ga0307415_100018945
815 Ga0307415_100417889
816 Ga0373938_0104536
817 Ga0373962_0219717
818 Ga0395900_0122965
819 Ga0395905_1528586
820 Ga0451807_2245918
821 Ga0451839_1211428
822 Ga0451853_2783738
823 Ga0451853_3551878
824 Ga0439463_146073
825 Ga0450920_012661
826 Ga0450923_050974
827 Ga0450906_025782
828 Ga0450907_054929
829 Ga0450918_026257
830 Ga0451576_1294480
831 Ga0495603_0094273
832 Ga0495603_0190643
833 Ga0495584_0141898
834 Ga0495585_0208491
835 Ga0495596_0074531
836 Ga0495596_0094250
837 Ga0495607_0391673
838 Ga0495631_0430688
839 Ga0495663_0044228
840 Ga0495656_0030715
841 Ga0495656_0219966
842 Ga0495656_0381057
843 Ga0495611_0125176
844 Ga0495588_0215327
845 Ga0495588_0501210
846 Ga0495589_0239175
847 Ga0495589_0405785
848 Ga0495660_0275246
849 Ga0495677_0059153
850 Ga0495677_0208177
851 Ga0496101_0304855
852 Ga0496101_0464385
853 Ga0496102_0734708
854 Ga0496104_0737493
855 Ga0496105_0445930
856 Ga0496106_1060521
857 Ga0496108_0084724
858 Ga0496109_0065816
859 Ga0496109_0090739
860 Ga0496109_0156998
861 Ga0496110_0162094
862 Ga0496110_0351137
863 Ga0496111_0102308
864 Ga0496112_0169643
865 Ga0496113_0007808
866 Ga0496114_0222118
867 Ga0496114_1099460
868 Ga0496114_1292027
869 Ga0501031_0015412
870 Ga0501031_0027984
871 Ga0501031_0062650
872 Ga0501031_0117623
873 Ga0501032_0197492
874 Ga0501033_0041262
875 Ga0501033_0143283
876 Ga0501033_0231169
877 Ga0501033_0367785
878 Ga0501033_0654742
879 Ga0501036_0013132
880 Ga0501036_0016878
881 Ga0501036_0035429
882 Ga0501036_0039167
883 Ga0501036_0148351
884 Ga0501036_0245316
885 Ga0501036_0494567
886 Ga0501036_0604673
887 Ga0501036_0852081
888 Ga0501037_0104053
889 Ga0501037_0115387
890 Ga0501037_0135379
891 Ga0501037_0445814
892 Ga0501038_0024197
893 Ga0501038_0030096
894 Ga0501038_0040704
895 Ga0501038_0104097
896 Ga0501038_0154849
897 Ga0501038_0608985
898 Ga0501038_1139447
899 Ga0501039_0007990
900 Ga0501039_0037161
901 Ga0501039_0098091
902 Ga0501039_0115218
903 Ga0501039_0160924
904 Ga0501039_0307731
905 Ga0501040_0038227
906 Ga0501040_0050039
907 Ga0501040_0054282
908 Ga0501040_0101470
909 Ga0501040_0137584
910 Ga0501041_0006871
911 Ga0501041_0071958
912 Ga0501041_0075449
913 Ga0501041_0124291
914 Ga0501041_0638133
915 Ga0501042_0005607
916 Ga0501042_0016744
917 Ga0501042_0020756
918 Ga0501042_0053620
919 Ga0501042_0099078
920 Ga0501042_0119380
921 Ga0501042_0160056
922 Ga0501042_0170789
923 Ga0501042_0409095
924 Ga0501043_0058586
925 Ga0501043_0084391
926 Ga0501046_0017951
927 Ga0501048_0019577
928 Ga0501048_0020038
929 Ga0501048_0021892
930 Ga0501048_0069703
931 Ga0501048_0089466
932 Ga0501048_0090249
933 Ga0501048_0203708
934 Ga0501067_0012458
935 Ga0501068_0005459
936 Ga0501068_0008457
937 Ga0501068_0010609
938 Ga0501068_0080043
939 Ga0501069_0006879
940 Ga0501069_0076049
941 Ga0501069_0086151
942 Ga0501070_0060070
943 Ga0501070_0252801
944 Ga0501070_0653062
945 Ga0501070_1402434
946 Ga0501071_0002446
947 Ga0501071_0004373
948 Ga0501071_0004669
949 Ga0501071_0007747
950 Ga0501071_0009995
951 Ga0501071_0020672
952 Ga0501071_0282651
953 Ga0501071_0483118
954 Ga0501071_0662208
955 Ga0501072_0002373
956 Ga0501072_0003835
957 Ga0501072_0005411
958 Ga0501072_0187777
959 Ga0501072_0273222
960 Ga0501072_0299882
961 Ga0501072_0432025
962 Ga0501072_0560374
963 Ga0501072_0998075
964 Ga0501073_0032933
965 Ga0501073_0224533
966 Ga0501073_0417215
967 Ga0501073_0522309
968 Ga0501074_0001992
969 Ga0501074_0019549
970 Ga0501074_0022780
971 Ga0501074_0050731
972 Ga0501074_0084589
973 Ga0501074_0102131
974 Ga0501074_0288826
975 Ga0501074_0812064
976 Ga0501075_0005154
977 Ga0501075_0026293
978 Ga0501075_0028456
979 Ga0501075_0070116
980 Ga0501075_0136939
981 Ga0501075_0569381
982 Ga0501075_1127165
983 Ga0501076_0003147
984 Ga0501076_0006735
985 Ga0501076_0073947
986 Ga0501076_0109782
987 Ga0501076_0116060
988 Ga0501076_0177738
989 Ga0501076_0215142
990 Ga0501076_0930155
991 Ga0501076_1056166
992 Ga0501076_1112724
993 Ga0501076_1357418
994 Ga0501077_0001220
995 Ga0501077_0003748
996 Ga0501077_0032845
997 Ga0501077_0051460
998 Ga0501077_0078961
999 Ga0501077_0292915
1000 Ga0501079_0016902
1001 Ga0501079_0021226
1002 Ga0501079_0050081
1003 Ga0501079_0120368
1004 Ga0501079_0149193
1005 Ga0501079_0184181
1006 Ga0501079_0575870
1007 Ga0501079_0958961
1008 Ga0501080_0012741
1009 Ga0501080_0017117
1010 Ga0501080_0028920
1011 Ga0501080_0033789
1012 Ga0501080_0248941
1013 Ga0501080_0339181
1014 Ga0501080_0365261
1015 Ga0501080_0397396
1016 Ga0501080_1676339
1017 Ga0501081_0003619
1018 Ga0501081_0008936
1019 Ga0501081_0018785
1020 Ga0501081_0100166
1021 Ga0501081_0212733
1022 Ga0501081_0220946
1023 Ga0501081_0598177
1024 Ga0501081_0762892
1025 Ga0501083_0001561
1026 Ga0501083_0096423
1027 Ga0501083_0116725
1028 Ga0501083_0337437
1029 Ga0501035_0008422
1030 Ga0501035_0172120
1031 Ga0501035_0180992
1032 Ga0501035_0248293
1033 Ga0501035_0350214
1034 Ga0501035_0529068
1035 Ga0501044_0129374
1036 Ga0501044_0150243
1037 Ga0501044_0473623
1038 Ga0501045_0006162
1039 Ga0501045_0059250
1040 Ga0501045_0087676
1041 Ga0501045_0091347
1042 Ga0501045_0124376
1043 Ga0501045_0152018
1044 Ga0501045_0210994
1045 nmdc:mga00v17_59633_c2
1046 nmdc:mga06z11_400472_c1
1047 nmdc:mga05p37_1614_c1
1048 nmdc:mga05p37_231003_c1
1049 nmdc:mga05p37_29992_c1
1050 nmdc:mga05p37_525104_c1
1051 nmdc:mga05p37_626901_c1
1052 nmdc:mga05p37_63427_c2
1053 nmdc:mga05p37_901659_c1
1054 nmdc:mga09592_144573_c1
1055 nmdc:mga09592_350649_c1
1056 nmdc:mga09592_75907_c1
1057 nmdc:mga09592_858816_c1
1058 nmdc:mga0qj67_34479_c1
1059 nmdc:mga06r32_1948_c1
1060 nmdc:mga06r32_573817_c1
1061 nmdc:mga06r32_93798_c1
1062 nmdc:mga08y16_1039_c1
1063 nmdc:mga08y16_1606139_c1
1064 nmdc:mga08y16_1892195_c1
1065 nmdc:mga08y16_315862_c1
1066 nmdc:mga08y16_9477_c1
1067 nmdc:mga08y16_98684_c1
1068 nmdc:mga08x19_187406_c1
1069 nmdc:mga0a205_173538_c1
1070 nmdc:mga0a205_765595_c1
1071 nmdc:mga0a205_864851_c1
1072 Ga0495655_0051671
1073 Ga0495655_0100499
1074 Ga0501084_0013577
1075 Ga0501084_0034014
1076 Ga0501084_0079619
1077 Ga0501084_0089708
1078 Ga0501084_0091415
1079 Ga0501084_0134280
1080 Ga0501084_0164635
1081 Ga0501084_0305333
1082 Ga0501084_0403420
1083 Ga0501084_0718088
1084 Ga0501084_0978572
1085 Ga0590074_019132
1086 Ga0501082_0014081
1087 Ga0501082_0047400
1088 Ga0501082_0053847
1089 Ga0501082_0105230
1090 Ga0501082_0131176
1091 Ga0501082_0292853
1092 Ga0501082_0346473
1093 Ga0501082_1293148
1094 Ga0530510_0016597
1095 Ga0530510_0027573
1096 Ga0530510_0085041
1097 Ga0530510_0095617
1098 Ga0530510_0201460
1099 Ga0530510_0256055
1100 Ga0530510_0263291
1101 Ga0530510_0325578
1102 Ga0530510_1290215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

57

138

0.94

PF13279

4HBT_2

Thioesterase-like superfamily

49

166

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9179 21 143
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9167 21 143
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9097 21 141
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.8984 21 126
2gf6-assembly1.cif.gz_A crystal structure of a putative thioesterase (sso2295) from sulfolobus solfataricus at 1.91 a resolution 0.8983 21 143
ID Description Score Start End Superfamily
af_A0A1D6I7U7_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9295 64 137 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9179 21 143 3.10.129.10
af_Q59ZH1_40_216_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9121 66 123 3.10.129.10
af_F4HX80_37_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9097 21 143 3.10.129.10
af_Q2FYS8_3_144_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9021 21 147 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7V9BBS9-F1-model_v4 Thioesterase family protein 0.9861 61 153
AF-A0A7V9BBS9-F1-model_v4 Thioesterase family protein 0.9757 61 153
AF-A0A538CWA5-F1-model_v4 Acyl-CoA thioesterase 0.9505 6 152 GO:0047617
AF-A0A538HH80-F1-model_v4 Acyl-CoA thioesterase 0.9428 15 153 GO:0047617
AF-A0A538LC64-F1-model_v4 Acyl-CoA thioesterase 0.934 15 145 GO:0047617

Map