F462591

General Info

Members Datasets Scaffolds Average Seq Length
551 252 1102 275

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100185761|Ga0097621_1001857612
Length 320
Sequence MQLLVPRTEELPELPVPVTRAGLANLLAWLWICQERPVPTPEAPVPRNKXXXHSKNNGNDQAAVPLKNKEYERELRKLQTKLVQMQEWVRATRAKVVIVFEGRDAAGKGGVIHRILERVSPRVFRHVALPAPTDREKSQLYAQRYIIHMPAAGEVIIFDRSWYNRALVEHVMEFCTDKQYADFMRMVPGFEGLLKNNGIILVKYWFEVSEKEQHRRFLRRIEDPMRRWKLSPMDLESHRRWYDYSRARDAMFAATDTPQSPWYVVQTDDKARARLNCISHLLNVVPWKEIPQEKVNLPKRQKPKGYKAPDWNYRWIPEKY

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
246 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
247 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
248 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
249 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
250 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
251 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
252 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0.18
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 1.27
Rhizoplane 7.44
Rhizosphere 88.57
Stem 0
Stem Tuber 0
Unclassified 4.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100185761 3300006237 Unclassified 1798
2 JGI25404J52841_10019971 3300003659 Bacteria 1451
3 Ga0070676_10000101 3300005328 Bacteria 30545
4 Ga0070676_10002705 3300005328 Bacteria 9137
5 Ga0070676_10007846 3300005328 Bacteria 5738
6 Ga0070683_100021245 3300005329 Bacteria 5790
7 Ga0070690_100000316 3300005330 Bacteria 24882
8 Ga0070670_100034394 3300005331 Bacteria 4360
9 Ga0070677_10004536 3300005333 Bacteria 4535
10 Ga0070677_10011959 3300005333 Bacteria 3004
11 Ga0068869_100019436 3300005334 Bacteria 4642
12 Ga0070666_10009585 3300005335 Bacteria 6043
13 Ga0070666_10019223 3300005335 Bacteria 4407
14 Ga0070680_100021494 3300005336 Bacteria 5129
15 Ga0070680_100216987 3300005336 Bacteria 1614
16 Ga0070682_100000741 3300005337 Bacteria 19505
17 Ga0070682_100059855 3300005337 Bacteria 2407
18 Ga0070682_100266537 3300005337 Bacteria 1242
19 Ga0068868_100127543 3300005338 Bacteria 2080
20 Ga0070660_100185246 3300005339 Bacteria 1685
21 Ga0070689_100003624 3300005340 Bacteria 10297
22 Ga0070689_100048959 3300005340 Bacteria 3261
23 Ga0070687_100006552 3300005343 Bacteria 4780
24 Ga0070661_100001050 3300005344 Bacteria 19539
25 Ga0070661_100090642 3300005344 Bacteria 2264
26 Ga0070668_100003368 3300005347 Bacteria 11789
27 Ga0070668_100065381 3300005347 Bacteria 2821
28 Ga0070669_100000736 3300005353 Bacteria 23856
29 Ga0070669_100017301 3300005353 Bacteria 5142
30 Ga0070669_100081382 3300005353 Bacteria 2412
31 Ga0070675_100007885 3300005354 Bacteria 8254
32 Ga0070675_100010135 3300005354 Bacteria 7350
33 Ga0070674_100219230 3300005356 Bacteria 1479
34 Ga0070674_100307543 3300005356 Bacteria 1266
35 Ga0070673_100009134 3300005364 Bacteria 6639
36 Ga0070688_100000908 3300005365 Bacteria 14783
37 Ga0070659_100009584 3300005366 Bacteria 7118
38 Ga0070659_100131413 3300005366 Bacteria 2034
39 Ga0070659_100282996 3300005366 Bacteria 1380
40 Ga0070667_100000911 3300005367 Bacteria 27330
41 Ga0070667_100270931 3300005367 Bacteria 1522
42 Ga0070667_100403538 3300005367 Bacteria 1244
43 Ga0070709_10002775 3300005434 Bacteria 9464
44 Ga0070709_10033821 3300005434 Bacteria 3094
45 Ga0070709_10081930 3300005434 Bacteria 2107
46 Ga0070714_100004834 3300005435 Bacteria 10226
47 Ga0070714_100019717 3300005435 Bacteria 5499
48 Ga0070714_100099511 3300005435 Bacteria 2559
49 Ga0070714_100234619 3300005435 Bacteria 1691
50 Ga0070714_100303333 3300005435 Bacteria 1489
51 Ga0070713_100000630 3300005436 Bacteria 22493
52 Ga0070713_100094526 3300005436 Bacteria 2577
53 Ga0070713_100107789 3300005436 Bacteria 2424
54 Ga0070713_100183380 3300005436 Bacteria 1882
55 Ga0070713_100229766 3300005436 Bacteria 1686
56 Ga0070710_10001617 3300005437 Bacteria 10635
57 Ga0070710_10023188 3300005437 Bacteria 3258
58 Ga0070710_10234957 3300005437 Bacteria 1172
59 Ga0070710_10304258 3300005437 Bacteria 1041
60 Ga0070711_100015086 3300005439 Bacteria 4883
61 Ga0070711_100025501 3300005439 Bacteria 3869
62 Ga0070711_100120105 3300005439 Bacteria 1942
63 Ga0070711_100191440 3300005439 Bacteria 1572
64 Ga0070711_100345360 3300005439 Bacteria 1195
65 Ga0070700_100000459 3300005441 Bacteria 20451
66 Ga0070663_100000852 3300005455 Bacteria 16523
67 Ga0070678_100005813 3300005456 Bacteria 7177
68 Ga0070678_100426560 3300005456 Bacteria 1157
69 Ga0070662_100001503 3300005457 Bacteria 14349
70 Ga0070662_100013482 3300005457 Bacteria 5439
71 Ga0070681_10000040 3300005458 Bacteria 92043
72 Ga0070681_10086737 3300005458 Bacteria 3083
73 Ga0068867_100018950 3300005459 Bacteria 4899
74 Ga0068867_100048593 3300005459 Bacteria 3122
75 Ga0068867_100216363 3300005459 Bacteria 1541
76 Ga0070685_10047804 3300005466 Bacteria 2462
77 Ga0070685_10087251 3300005466 Bacteria 1882
78 Ga0070706_100001802 3300005467 Bacteria 22190
79 Ga0070706_100006607 3300005467 Bacteria 10940
80 Ga0070706_100013807 3300005467 Bacteria 7468
81 Ga0070706_100015247 3300005467 Bacteria 7095
82 Ga0070707_100020357 3300005468 Bacteria 6258
83 Ga0070698_100040621 3300005471 Bacteria 4780
84 Ga0070698_100128413 3300005471 Bacteria 2491
85 Ga0070699_100007216 3300005518 Bacteria 9667
86 Ga0070679_100001695 3300005530 Bacteria 19860
87 Ga0070679_100075536 3300005530 Bacteria 3359
88 Ga0070684_100017328 3300005535 Bacteria 5909
89 Ga0070684_100030307 3300005535 Bacteria 4595
90 Ga0070697_100053685 3300005536 Bacteria 3276
91 Ga0068853_100014364 3300005539 Bacteria 6483
92 Ga0068853_100397068 3300005539 Bacteria 1290
93 Ga0070672_100000298 3300005543 Bacteria 28086
94 Ga0070672_100027102 3300005543 Bacteria 4272
95 Ga0070672_100283433 3300005543 Bacteria 1401
96 Ga0070686_100000989 3300005544 Bacteria 16399
97 Ga0070686_100004160 3300005544 Bacteria 7962
98 Ga0070686_100030995 3300005544 Bacteria 3266
99 Ga0070695_100140845 3300005545 Bacteria 1672
100 Ga0070696_100183355 3300005546 Bacteria 1554
101 Ga0070693_100041185 3300005547 Bacteria 2597
102 Ga0070693_100233104 3300005547 Bacteria 1212
103 Ga0070665_100006728 3300005548 Bacteria 11683
104 Ga0068855_100000096 3300005563 Bacteria 106521
105 Ga0068855_100008121 3300005563 Bacteria 12684
106 Ga0068855_100019518 3300005563 Bacteria 8144
107 Ga0068855_100625717 3300005563 Bacteria 1158
108 Ga0070664_100001668 3300005564 Bacteria 17764
109 Ga0070664_100014281 3300005564 Bacteria 6476
110 Ga0070664_100097401 3300005564 Bacteria 2554
111 Ga0070664_100220418 3300005564 Bacteria 1697
112 Ga0068857_100054179 3300005577 Bacteria 3559
113 Ga0068857_100299181 3300005577 Bacteria 1483
114 Ga0068854_100000511 3300005578 Bacteria 23621
115 Ga0068854_100004868 3300005578 Bacteria 8472
116 Ga0068854_100020413 3300005578 Bacteria 4482
117 Ga0068854_100117557 3300005578 Bacteria 2014
118 Ga0068856_100000756 3300005614 Bacteria 35122
119 Ga0068856_100004750 3300005614 Bacteria 13482
120 Ga0068856_100005937 3300005614 Bacteria 12021
121 Ga0068856_100008332 3300005614 Bacteria 10100
122 Ga0068856_100022293 3300005614 Bacteria 6157
123 Ga0068852_100009195 3300005616 Bacteria 7322
124 Ga0068852_100081927 3300005616 Bacteria 2866
125 Ga0068852_100678119 3300005616 Bacteria 1040
126 Ga0068859_100002596 3300005617 Bacteria 18386
127 Ga0068859_100005789 3300005617 Bacteria 12557
128 Ga0068859_100007474 3300005617 Bacteria 11092
129 Ga0068859_100014631 3300005617 Bacteria 7882
130 Ga0068864_100006459 3300005618 Bacteria 9604
131 Ga0068864_100054036 3300005618 Bacteria 3466
132 Ga0068866_10002832 3300005718 Bacteria 7147
133 Ga0068866_10188937 3300005718 Bacteria 1222
134 Ga0068851_10002982 3300005834 Bacteria 7478
135 Ga0068863_100000830 3300005841 Bacteria 31001
136 Ga0068863_100000951 3300005841 Bacteria 29079
137 Ga0068863_100082372 3300005841 Bacteria 3049
138 Ga0068858_100001155 3300005842 Bacteria 27330
139 Ga0068858_100006190 3300005842 Bacteria 11669
140 Ga0068858_100006823 3300005842 Bacteria 11107
141 Ga0068858_100023747 3300005842 Bacteria 5712
142 Ga0068858_100042971 3300005842 Bacteria 4191
143 Ga0068858_100046652 3300005842 Bacteria 4016
144 Ga0068860_100000796 3300005843 Bacteria 35406
145 Ga0068860_100021617 3300005843 Bacteria 6229
146 Ga0068862_100025568 3300005844 Bacteria 4957
147 Ga0081538_10007935 3300005981 Bacteria 9085
148 Ga0081540_1000086 3300005983 Bacteria 99615
149 Ga0070717_10000492 3300006028 Bacteria 25105
150 Ga0070717_10000947 3300006028 Bacteria 19311
151 Ga0070717_10055780 3300006028 Bacteria 3261
152 Ga0075365_10022846 3300006038 Bacteria 3924
153 Ga0070715_10005882 3300006163 Bacteria 4129
154 Ga0070716_100017097 3300006173 Bacteria 3754
155 Ga0070716_100029051 3300006173 Bacteria 2985
156 Ga0070716_100060060 3300006173 Bacteria 2194
157 Ga0070716_100113702 3300006173 Unclassified 1682
158 Ga0070712_100005241 3300006175 Bacteria 8019
159 Ga0070712_100011522 3300006175 Bacteria 5609
160 Ga0070712_100017619 3300006175 Bacteria 4626
161 Ga0070712_100120682 3300006175 Unclassified 1972
162 Ga0070712_100413186 3300006175 Unclassified 1117
163 Ga0075367_10108288 3300006178 Bacteria 1703
164 Ga0097621_100001314 3300006237 Bacteria 17096
165 Ga0097621_100002377 3300006237 Bacteria 12896
166 Ga0097621_100004753 3300006237 Bacteria 9498
167 Ga0097621_100005174 3300006237 Bacteria 9165
168 Ga0097621_100006541 3300006237 Bacteria 8279
169 Ga0097621_100041120 3300006237 Bacteria 3719
170 Ga0097621_100392444 3300006237 Bacteria 1241
171 Ga0068871_100000226 3300006358 Bacteria 39929
172 Ga0068871_100001612 3300006358 Bacteria 15186
173 Ga0068871_100002435 3300006358 Bacteria 12720
174 Ga0068871_100025860 3300006358 Bacteria 4573
175 Ga0068865_100032599 3300006881 Bacteria 3482
176 Ga0068865_100070967 3300006881 Bacteria 2469
177 Ga0097620_100002596 3300006931 Bacteria 18386
178 Ga0097620_100005789 3300006931 Bacteria 12557
179 Ga0097620_100007475 3300006931 Bacteria 11092
180 Ga0097620_100014631 3300006931 Bacteria 7882
181 Ga0075435_100118279 3300007076 Bacteria 2209
182 Ga0075435_100225571 3300007076 Bacteria 1591
183 Ga0099795_10023321 3300007788 Bacteria 2053
184 Ga0105251_10089360 3300009011 Bacteria 1417
185 Ga0105244_10137302 3300009036 Bacteria 1178
186 Ga0105240_10000820 3300009093 Bacteria 56524
187 Ga0105240_10002935 3300009093 Bacteria 26898
188 Ga0105240_10070607 3300009093 Bacteria 4320
189 Ga0105240_10105397 3300009093 Bacteria 3423
190 Ga0111539_10393846 3300009094 Bacteria 1613
191 Ga0111539_10755047 3300009094 Bacteria 1132
192 Ga0111539_10897954 3300009094 Bacteria 1031
193 Ga0105245_10004827 3300009098 Bacteria 11885
194 Ga0105245_10012267 3300009098 Bacteria 7456
195 Ga0105247_10001142 3300009101 Bacteria 19668
196 Ga0105247_10204729 3300009101 Bacteria 1328
197 Ga0114129_10901665 3300009147 Bacteria 1120
198 Ga0105243_10005098 3300009148 Bacteria 10309
199 Ga0105243_10186796 3300009148 Bacteria 1807
200 Ga0105241_10022224 3300009174 Unclassified 4697
201 Ga0105241_10147583 3300009174 Bacteria 1921
202 Ga0105241_10585235 3300009174 Bacteria 1006
203 Ga0105248_10003754 3300009177 Bacteria 16832
204 Ga0105248_10004230 3300009177 Bacteria 15879
205 Ga0105248_10011571 3300009177 Bacteria 9720
206 Ga0105248_10026078 3300009177 Bacteria 6503
207 Ga0105248_10073281 3300009177 Bacteria 3849
208 Ga0105248_10298890 3300009177 Unclassified 1813
209 Ga0105237_10029342 3300009545 Bacteria 5593
210 Ga0105237_10289705 3300009545 Bacteria 1640
211 Ga0105237_10538786 3300009545 Unclassified 1174
212 Ga0105238_10000548 3300009551 Bacteria 39283
213 Ga0105238_10024369 3300009551 Bacteria 6168
214 Ga0105238_10121197 3300009551 Bacteria 2595
215 Ga0105238_10172436 3300009551 Bacteria 2139
216 Ga0105249_10016745 3300009553 Bacteria 6505
217 Ga0105032_101960 3300009979 Bacteria 1860
218 Ga0105239_10031370 3300010375 Bacteria 5846
219 Ga0105239_10037990 3300010375 Bacteria 5276
220 Ga0105239_10122614 3300010375 Bacteria 2888
221 Ga0105239_10152972 3300010375 Bacteria 2575
222 Ga0105246_10016586 3300011119 Bacteria 4665
223 Ga0105246_10103764 3300011119 Bacteria 2075
224 Ga0157373_10033694 3300013100 Bacteria 3682
225 Ga0157371_10271057 3300013102 Bacteria 1225
226 Ga0157371_10289852 3300013102 Bacteria 1183
227 Ga0157369_10000041 3300013105 Bacteria 181798
228 Ga0157369_10001859 3300013105 Bacteria 25438
229 Ga0157369_10054472 3300013105 Bacteria 4319
230 Ga0157369_10168208 3300013105 Bacteria 2311
231 Ga0157374_10000078 3300013296 Bacteria 97051
232 Ga0157374_10004157 3300013296 Bacteria 12146
233 Ga0157374_10004200 3300013296 Bacteria 12102
234 Ga0157374_10098935 3300013296 Bacteria 2793
235 Ga0157374_10164640 3300013296 Bacteria 2161
236 Ga0157378_10002970 3300013297 Bacteria 15072
237 Ga0157378_10005309 3300013297 Bacteria 11312
238 Ga0157378_10013891 3300013297 Bacteria 7042
239 Ga0157378_10020009 3300013297 Bacteria 5884
240 Ga0157378_10078362 3300013297 Bacteria 2980
241 Ga0157378_10202937 3300013297 Unclassified 1876
242 Ga0163162_10008849 3300013306 Bacteria 9789
243 Ga0163162_10009457 3300013306 Bacteria 9478
244 Ga0163162_10013536 3300013306 Bacteria 7965
245 Ga0163162_10024609 3300013306 Bacteria 5945
246 Ga0163162_10115293 3300013306 Bacteria 2787
247 Ga0163162_10302070 3300013306 Bacteria 1733
248 Ga0157372_10000431 3300013307 Bacteria 46220
249 Ga0157372_10006059 3300013307 Bacteria 12846
250 Ga0157372_10008205 3300013307 Bacteria 11100
251 Ga0157372_10011026 3300013307 Bacteria 9620
252 Ga0157372_10146428 3300013307 Bacteria 2724
253 Ga0157372_10226307 3300013307 Unclassified 2168
254 Ga0157372_10267779 3300013307 Bacteria 1985
255 Ga0157372_10318689 3300013307 Bacteria 1810
256 Ga0157375_10001027 3300013308 Bacteria 24079
257 Ga0157375_10003850 3300013308 Bacteria 13020
258 Ga0157375_10026976 3300013308 Bacteria 5363
259 Ga0163163_10011593 3300014325 Bacteria 8007
260 Ga0163163_10232067 3300014325 Bacteria 1894
261 Ga0157380_10000360 3300014326 Bacteria 27339
262 Ga0157380_10179907 3300014326 Bacteria 1857
263 Ga0157380_10627594 3300014326 Bacteria 1068
264 Ga0182008_10025824 3300014497 Bacteria 2982
265 Ga0157377_10126241 3300014745 Unclassified 1557
266 Ga0157379_10004258 3300014968 Bacteria 12219
267 Ga0157379_10005735 3300014968 Bacteria 10682
268 Ga0157379_10059545 3300014968 Bacteria 3414
269 Ga0157379_10158179 3300014968 Unclassified 2045
270 Ga0157379_10183967 3300014968 Bacteria 1888
271 Ga0157376_10015161 3300014969 Bacteria 5813
272 Ga0157376_10017042 3300014969 Bacteria 5532
273 Ga0157376_10125928 3300014969 Bacteria 2279
274 Ga0163161_10011240 3300017792 Bacteria 6203
275 Ga0207697_10000796 3300025315 Bacteria 17885
276 Ga0207656_10138913 3300025321 Bacteria 1144
277 Ga0207655_1003545 3300025728 Bacteria 11558
278 Ga0207713_1076030 3300025735 Bacteria 1223
279 Ga0207692_10075187 3300025898 Bacteria 1791
280 Ga0207692_10084588 3300025898 Bacteria 1705
281 Ga0207692_10233931 3300025898 Unclassified 1094
282 Ga0207680_10003866 3300025903 Bacteria 7056
283 Ga0207680_10025629 3300025903 Bacteria 3255
284 Ga0207680_10059983 3300025903 Bacteria 2314
285 Ga0207699_10040480 3300025906 Bacteria 2685
286 Ga0207699_10042899 3300025906 Bacteria 2624
287 Ga0207699_10072613 3300025906 Bacteria 2108
288 Ga0207645_10002303 3300025907 Bacteria 15085
289 Ga0207645_10005194 3300025907 Bacteria 9506
290 Ga0207645_10027038 3300025907 Bacteria 3707
291 Ga0207684_10001829 3300025910 Bacteria 22210
292 Ga0207684_10026227 3300025910 Bacteria 4968
293 Ga0207684_10285922 3300025910 Bacteria 1422
294 Ga0207654_10005026 3300025911 Bacteria 6683
295 Ga0207654_10041014 3300025911 Unclassified 2611
296 Ga0207654_10335345 3300025911 Bacteria 1037
297 Ga0207707_10000194 3300025912 Bacteria 64241
298 Ga0207707_10082632 3300025912 Bacteria 2804
299 Ga0207695_10014360 3300025913 Bacteria 9389
300 Ga0207695_10024621 3300025913 Bacteria 6764
301 Ga0207695_10166608 3300025913 Bacteria 2131
302 Ga0207695_10281579 3300025913 Bacteria 1556
303 Ga0207671_10245967 3300025914 Bacteria 1406
304 Ga0207693_10000286 3300025915 Bacteria 47012
305 Ga0207693_10004130 3300025915 Bacteria 12327
306 Ga0207693_10004585 3300025915 Bacteria 11658
307 Ga0207693_10005273 3300025915 Bacteria 10812
308 Ga0207693_10026242 3300025915 Bacteria 4611
309 Ga0207693_10134477 3300025915 Unclassified 1944
310 Ga0207693_10250572 3300025915 Bacteria 1389
311 Ga0207663_10001808 3300025916 Bacteria 10102
312 Ga0207663_10034135 3300025916 Bacteria 3039
313 Ga0207663_10034220 3300025916 Bacteria 3036
314 Ga0207663_10082853 3300025916 Bacteria 2105
315 Ga0207663_10271278 3300025916 Bacteria 1257
316 Ga0207660_10186237 3300025917 Bacteria 1615
317 Ga0207662_10009401 3300025918 Bacteria 5377
318 Ga0207657_10002061 3300025919 Bacteria 21741
319 Ga0207649_10052895 3300025920 Bacteria 2521
320 Ga0207652_10329020 3300025921 Bacteria 1380
321 Ga0207646_10000469 3300025922 Bacteria 53872
322 Ga0207646_10295955 3300025922 Bacteria 1462
323 Ga0207681_10000592 3300025923 Bacteria 24653
324 Ga0207681_10045669 3300025923 Bacteria 2942
325 Ga0207681_10070861 3300025923 Bacteria 2429
326 Ga0207694_10002301 3300025924 Bacteria 15627
327 Ga0207694_10016132 3300025924 Bacteria 5638
328 Ga0207650_10023555 3300025925 Bacteria 4367
329 Ga0207659_10011409 3300025926 Bacteria 5613
330 Ga0207659_10013840 3300025926 Bacteria 5184
331 Ga0207687_10000114 3300025927 Bacteria 57692
332 Ga0207687_10038307 3300025927 Bacteria 3276
333 Ga0207687_10465816 3300025927 Bacteria 1050
334 Ga0207700_10006699 3300025928 Bacteria 6990
335 Ga0207700_10009057 3300025928 Bacteria 6197
336 Ga0207700_10025316 3300025928 Bacteria 4119
337 Ga0207700_10155322 3300025928 Bacteria 1895
338 Ga0207700_10506440 3300025928 Bacteria 1069
339 Ga0207664_10000770 3300025929 Bacteria 21696
340 Ga0207664_10008332 3300025929 Bacteria 7224
341 Ga0207664_10108670 3300025929 Bacteria 2303
342 Ga0207664_10242042 3300025929 Bacteria 1571
343 Ga0207644_10042148 3300025931 Bacteria 3233
344 Ga0207644_10186048 3300025931 Bacteria 1631
345 Ga0207644_10237814 3300025931 Bacteria 1449
346 Ga0207690_10120148 3300025932 Bacteria 1907
347 Ga0207706_10000142 3300025933 Bacteria 78326
348 Ga0207706_10002518 3300025933 Bacteria 17874
349 Ga0207686_10092439 3300025934 Bacteria 2000
350 Ga0207709_10029484 3300025935 Bacteria 3184
351 Ga0207709_10031995 3300025935 Bacteria 3078
352 Ga0207670_10000059 3300025936 Bacteria 78072
353 Ga0207670_10035026 3300025936 Bacteria 3252
354 Ga0207669_10001832 3300025937 Bacteria 9000
355 Ga0207669_10100828 3300025937 Bacteria 1908
356 Ga0207704_10106491 3300025938 Bacteria 1884
357 Ga0207665_10001827 3300025939 Bacteria 14322
358 Ga0207665_10005832 3300025939 Bacteria 8196
359 Ga0207665_10028515 3300025939 Bacteria 3688
360 Ga0207665_10053282 3300025939 Bacteria 2727
361 Ga0207665_10080241 3300025939 Bacteria 2244
362 Ga0207665_10158681 3300025939 Bacteria 1625
363 Ga0207665_10167730 3300025939 Bacteria 1583
364 Ga0207691_10029438 3300025940 Bacteria 5137
365 Ga0207691_10118401 3300025940 Bacteria 2349
366 Ga0207711_10005720 3300025941 Bacteria 10489
367 Ga0207711_10013309 3300025941 Bacteria 6836
368 Ga0207711_10059275 3300025941 Bacteria 3296
369 Ga0207711_10309287 3300025941 Bacteria 1459
370 Ga0207711_10450658 3300025941 Bacteria 1198
371 Ga0207689_10006195 3300025942 Bacteria 10596
372 Ga0207689_10068787 3300025942 Bacteria 2910
373 Ga0207689_10272965 3300025942 Bacteria 1400
374 Ga0207679_10010543 3300025945 Bacteria 5956
375 Ga0207679_10031660 3300025945 Bacteria 3704
376 Ga0207679_10157870 3300025945 Bacteria 1854
377 Ga0207679_10173185 3300025945 Bacteria 1779
378 Ga0207667_10000821 3300025949 Bacteria 40162
379 Ga0207667_10002541 3300025949 Bacteria 22699
380 Ga0207667_10005864 3300025949 Bacteria 14958
381 Ga0207667_10041670 3300025949 Bacteria 4882
382 Ga0207712_10006834 3300025961 Bacteria 7199
383 Ga0207712_10066351 3300025961 Bacteria 2580
384 Ga0207668_10004797 3300025972 Bacteria 7960
385 Ga0207668_10011986 3300025972 Bacteria 5291
386 Ga0207640_10005281 3300025981 Bacteria 7035
387 Ga0207640_10057358 3300025981 Bacteria 2561
388 Ga0207640_10131896 3300025981 Bacteria 1808
389 Ga0207640_10472374 3300025981 Bacteria 1038
390 Ga0207658_10000510 3300025986 Bacteria 35545
391 Ga0207658_10048610 3300025986 Bacteria 3111
392 Ga0207658_10203914 3300025986 Bacteria 1653
393 Ga0207677_10002896 3300026023 Bacteria 9062
394 Ga0207677_10006776 3300026023 Bacteria 6294
395 Ga0207703_10001422 3300026035 Bacteria 21834
396 Ga0207703_10008453 3300026035 Bacteria 8134
397 Ga0207703_10009168 3300026035 Bacteria 7790
398 Ga0207703_10017852 3300026035 Bacteria 5541
399 Ga0207703_10051158 3300026035 Bacteria 3347
400 Ga0207703_10059442 3300026035 Bacteria 3122
401 Ga0207703_10069427 3300026035 Unclassified 2906
402 Ga0207639_10023769 3300026041 Bacteria 4427
403 Ga0207639_10040460 3300026041 Bacteria 3479
404 Ga0207639_10128502 3300026041 Bacteria 2094
405 Ga0207678_10000039 3300026067 Bacteria 101198
406 Ga0207678_10083605 3300026067 Bacteria 2731
407 Ga0207708_10000274 3300026075 Bacteria 40319
408 Ga0207702_10000275 3300026078 Bacteria 59296
409 Ga0207702_10004239 3300026078 Bacteria 12805
410 Ga0207702_10007064 3300026078 Bacteria 9602
411 Ga0207702_10142268 3300026078 Bacteria 2172
412 Ga0207641_10001218 3300026088 Bacteria 25753
413 Ga0207641_10010148 3300026088 Bacteria 7746
414 Ga0207641_10014501 3300026088 Bacteria 6459
415 Ga0207641_10025030 3300026088 Unclassified 4922
416 Ga0207648_10001492 3300026089 Bacteria 25769
417 Ga0207648_10007986 3300026089 Bacteria 10322
418 Ga0207676_10008441 3300026095 Bacteria 7324
419 Ga0207676_10099084 3300026095 Bacteria 2411
420 Ga0207674_10004700 3300026116 Bacteria 16372
421 Ga0207674_10038466 3300026116 Bacteria 4963
422 Ga0207675_100001773 3300026118 Bacteria 21566
423 Ga0207683_10002047 3300026121 Bacteria 17847
424 Ga0207683_10068440 3300026121 Bacteria 3134
425 Ga0207683_10149833 3300026121 Bacteria 2105
426 Ga0207698_10009126 3300026142 Bacteria 6303
427 Ga0207698_10015206 3300026142 Bacteria 5149
428 Ga0207698_10032781 3300026142 Bacteria 3768
429 Ga0268266_10005246 3300028379 Bacteria 12168
430 Ga0268265_10326946 3300028380 Bacteria 1391
431 Ga0268264_10007395 3300028381 Bacteria 9168
432 Ga0268264_10035895 3300028381 Bacteria 4082
433 Ga0265760_10091153 3300031090 Bacteria 954
434 Ga0307408_100122032 3300031548 Bacteria 2020
435 Ga0307410_10060147 3300031852 Bacteria 2596
436 Ga0307407_10012672 3300031903 Bacteria 4062
437 Ga0373950_0039980 3300034818 Bacteria 895
438 Ga0373934_0054135 3300035086 Bacteria 1593
439 Ga0373952_0008724 3300035092 Bacteria 1928
440 Ga0373923_0016392 3300035111 Bacteria 2814
441 Ga0373936_0028470 3300035113 Bacteria 2196
442 Ga0373941_0073799 3300035115 Bacteria 1138
443 Ga0373954_0057340 3300035118 Unclassified 1834
444 Ga0373956_0012483 3300035119 Bacteria 3523
445 Ga0373943_0094834 3300035170 Bacteria 1551
446 Ga0373943_0258554 3300035170 Bacteria 980
447 Ga0373946_0022055 3300035171 Unclassified 2476
448 Ga0373955_0281479 3300035172 Bacteria 1001
449 Ga0373931_0031651 3300035691 Bacteria 2731
450 Ga0373931_0088260 3300035691 Bacteria 1723
451 Ga0373931_0172313 3300035691 Unclassified 1276
452 Ga0373927_0000189 3300035695 Bacteria 49133
453 Ga0373927_0159532 3300035695 Unclassified 1477
454 Ga0373933_0028504 3300035724 Bacteria 3222
455 Ga0373947_0042546 3300035725 Unclassified 2711
456 Ga0373937_0123869 3300036401 Bacteria 2410
457 Ga0373925_0001487 3300037068 Bacteria 20123
458 Ga0373925_0001494 3300037068 Bacteria 20080
459 Ga0373925_0021475 3300037068 Bacteria 4704
460 Ga0373925_0051715 3300037068 Unclassified 3067
461 Ga0395899_0089819 3300037312 Bacteria 2228
462 Ga0395900_0015389 3300037418 Bacteria 7796
463 Ga0395900_0055835 3300037418 Bacteria 4066
464 Ga0395901_0039977 3300038443 Bacteria 4855
465 Ga0451793_0709325 3300041452 Bacteria 1870
466 Ga0451853_2281844 3300041512 Bacteria 1963
467 Ga0495653_0376667 3300046463 Unclassified 907
468 Ga0495580_0002429 3300046472 Bacteria 16279
469 Ga0495580_0013063 3300046472 Bacteria 6356
470 Ga0495580_0046503 3300046472 Bacteria 3079
471 Ga0495608_0335193 3300046511 Bacteria 933
472 Ga0495630_0556893 3300046517 Bacteria 879
473 Ga0495642_0055879 3300046528 Bacteria 1630
474 Ga0495587_0182710 3300046536 Unclassified 1189
475 Ga0495633_0015766 3300046558 Bacteria 3915
476 Ga0495656_0002009 3300046615 Bacteria 6697
477 Ga0495659_0002916 3300046664 Bacteria 5495
478 Ga0495588_0011026 3300046674 Bacteria 4229
479 Ga0495670_0009420 3300046691 Bacteria 4800
480 Ga0495604_0191050 3300047317 Bacteria 1427
481 Ga0495677_0038306 3300047445 Bacteria 1752
482 Ga0495681_0015145 3300047470 Bacteria 4375
483 Ga0496100_0020193 3300048903 Bacteria 3990
484 Ga0496100_0119500 3300048903 Bacteria 1841
485 Ga0496101_0046163 3300048904 Bacteria 3123
486 Ga0496101_0051121 3300048904 Bacteria 2977
487 Ga0496101_0248263 3300048904 Unclassified 1386
488 Ga0496102_0000322 3300048905 Bacteria 59788
489 Ga0496102_0007102 3300048905 Bacteria 9560
490 Ga0496102_0042318 3300048905 Bacteria 4127
491 Ga0496103_0002175 3300048906 Bacteria 12451
492 Ga0496103_0080158 3300048906 Bacteria 2052
493 Ga0496104_0057955 3300048907 Bacteria 3665
494 Ga0496104_0079288 3300048907 Unclassified 3130
495 Ga0496104_0197901 3300048907 Bacteria 1921
496 Ga0496105_0317434 3300048908 Bacteria 1249
497 Ga0496105_0336344 3300048908 Bacteria 1208
498 Ga0496105_0366224 3300048908 Bacteria 1149
499 Ga0496106_0003494 3300048909 Bacteria 11706
500 Ga0496106_0034415 3300048909 Unclassified 3783
501 Ga0496106_0054971 3300048909 Bacteria 3008
502 Ga0496107_0076556 3300048910 Bacteria 2436
503 Ga0496107_0077743 3300048910 Bacteria 2417
504 Ga0496107_0109882 3300048910 Bacteria 2025
505 Ga0496108_0035265 3300048911 Bacteria 4157
506 Ga0496108_0042824 3300048911 Bacteria 3780
507 Ga0496109_0071270 3300048912 Bacteria 3190
508 Ga0496109_0206589 3300048912 Bacteria 1846
509 Ga0496109_0401426 3300048912 Bacteria 1295
510 Ga0496110_0008685 3300048913 Bacteria 8181
511 Ga0496110_0059359 3300048913 Bacteria 3372
512 Ga0496110_0158447 3300048913 Bacteria 2051
513 Ga0496111_0014633 3300048914 Bacteria 5367
514 Ga0496111_0140352 3300048914 Bacteria 1790
515 Ga0496112_0013854 3300048915 Bacteria 7458
516 Ga0496112_0050772 3300048915 Bacteria 4068
517 Ga0496112_0210761 3300048915 Bacteria 1900
518 Ga0496113_0043930 3300048916 Bacteria 3308
519 Ga0496113_0097718 3300048916 Bacteria 2272
520 Ga0496114_0028451 3300048917 Bacteria 4587
521 Ga0496114_0125338 3300048917 Bacteria 2213
522 Ga0496114_0253439 3300048917 Bacteria 1549
523 Ga0496119_0075499 3300048922 Bacteria 1959
524 Ga0496120_0115835 3300048923 Bacteria 1393
525 Ga0496121_0187624 3300048924 Bacteria 1486
526 Ga0496124_0050366 3300048927 Bacteria 3549
527 Ga0496126_0013801 3300048929 Bacteria 8192
528 Ga0501048_0000199 3300049582 Bacteria 39152
529 Ga0501070_0003977 3300049586 Bacteria 12725
530 Ga0501076_0004362 3300049592 Bacteria 10046
531 nmdc:mga03683_62217_c1 3300050489 Bacteria 1580
532 nmdc:mga0yw44_88751_c1 3300050492 Bacteria 1950
533 nmdc:mga0k408_267726_c1 3300050493 Bacteria 1020
534 nmdc:mga06z11_44796_c1 3300050494 Bacteria 2233
535 nmdc:mga07m45_303793_c1 3300050496 Bacteria 928
536 nmdc:mga08y16_356914_c1 3300050511 Bacteria 1501
537 nmdc:mga0n895_25618_c1 3300050512 Bacteria 5575
538 nmdc:mga0rr50_161443_c1 3300050513 Bacteria 1819
539 nmdc:mga0rr50_485174_c1 3300050513 Bacteria 1050
540 Ga0495619_0072493 3300053085 Bacteria 2307
541 Ga0500616_0002188 3300053153 Bacteria 16853
542 Ga0530510_0076487 3300061734 Bacteria 2432
543 Ga0530510_0150061 3300061734 Bacteria 1721
544 2513552587 2513237082 Bacteria 8640282
545 2513560672 2513237083 Bacteria 8410967
546 2524463781 2524023210 Bacteria 9029266
547 2524535346 2524023228 Bacteria 10118060
548 2904673358 2904666416 Bacteria 8226587
549 2904698582 2904690495 Bacteria 9412302
550 2908741104 2908739725 Bacteria 8628932
551 2908762408 2908756301 Bacteria 8864324
552 Ga0097621_100185761
553 JGI25404J52841_10019971
554 Ga0070676_10000101
555 Ga0070676_10002705
556 Ga0070676_10007846
557 Ga0070683_100021245
558 Ga0070690_100000316
559 Ga0070670_100034394
560 Ga0070677_10004536
561 Ga0070677_10011959
562 Ga0068869_100019436
563 Ga0070666_10009585
564 Ga0070666_10019223
565 Ga0070680_100021494
566 Ga0070680_100216987
567 Ga0070682_100000741
568 Ga0070682_100059855
569 Ga0070682_100266537
570 Ga0068868_100127543
571 Ga0070660_100185246
572 Ga0070689_100003624
573 Ga0070689_100048959
574 Ga0070687_100006552
575 Ga0070661_100001050
576 Ga0070661_100090642
577 Ga0070668_100003368
578 Ga0070668_100065381
579 Ga0070669_100000736
580 Ga0070669_100017301
581 Ga0070669_100081382
582 Ga0070675_100007885
583 Ga0070675_100010135
584 Ga0070674_100219230
585 Ga0070674_100307543
586 Ga0070673_100009134
587 Ga0070688_100000908
588 Ga0070659_100009584
589 Ga0070659_100131413
590 Ga0070659_100282996
591 Ga0070667_100000911
592 Ga0070667_100270931
593 Ga0070667_100403538
594 Ga0070709_10002775
595 Ga0070709_10033821
596 Ga0070709_10081930
597 Ga0070714_100004834
598 Ga0070714_100019717
599 Ga0070714_100099511
600 Ga0070714_100234619
601 Ga0070714_100303333
602 Ga0070713_100000630
603 Ga0070713_100094526
604 Ga0070713_100107789
605 Ga0070713_100183380
606 Ga0070713_100229766
607 Ga0070710_10001617
608 Ga0070710_10023188
609 Ga0070710_10234957
610 Ga0070710_10304258
611 Ga0070711_100015086
612 Ga0070711_100025501
613 Ga0070711_100120105
614 Ga0070711_100191440
615 Ga0070711_100345360
616 Ga0070700_100000459
617 Ga0070663_100000852
618 Ga0070678_100005813
619 Ga0070678_100426560
620 Ga0070662_100001503
621 Ga0070662_100013482
622 Ga0070681_10000040
623 Ga0070681_10086737
624 Ga0068867_100018950
625 Ga0068867_100048593
626 Ga0068867_100216363
627 Ga0070685_10047804
628 Ga0070685_10087251
629 Ga0070706_100001802
630 Ga0070706_100006607
631 Ga0070706_100013807
632 Ga0070706_100015247
633 Ga0070707_100020357
634 Ga0070698_100040621
635 Ga0070698_100128413
636 Ga0070699_100007216
637 Ga0070679_100001695
638 Ga0070679_100075536
639 Ga0070684_100017328
640 Ga0070684_100030307
641 Ga0070697_100053685
642 Ga0068853_100014364
643 Ga0068853_100397068
644 Ga0070672_100000298
645 Ga0070672_100027102
646 Ga0070672_100283433
647 Ga0070686_100000989
648 Ga0070686_100004160
649 Ga0070686_100030995
650 Ga0070695_100140845
651 Ga0070696_100183355
652 Ga0070693_100041185
653 Ga0070693_100233104
654 Ga0070665_100006728
655 Ga0068855_100000096
656 Ga0068855_100008121
657 Ga0068855_100019518
658 Ga0068855_100625717
659 Ga0070664_100001668
660 Ga0070664_100014281
661 Ga0070664_100097401
662 Ga0070664_100220418
663 Ga0068857_100054179
664 Ga0068857_100299181
665 Ga0068854_100000511
666 Ga0068854_100004868
667 Ga0068854_100020413
668 Ga0068854_100117557
669 Ga0068856_100000756
670 Ga0068856_100004750
671 Ga0068856_100005937
672 Ga0068856_100008332
673 Ga0068856_100022293
674 Ga0068852_100009195
675 Ga0068852_100081927
676 Ga0068852_100678119
677 Ga0068859_100002596
678 Ga0068859_100005789
679 Ga0068859_100007474
680 Ga0068859_100014631
681 Ga0068864_100006459
682 Ga0068864_100054036
683 Ga0068866_10002832
684 Ga0068866_10188937
685 Ga0068851_10002982
686 Ga0068863_100000830
687 Ga0068863_100000951
688 Ga0068863_100082372
689 Ga0068858_100001155
690 Ga0068858_100006190
691 Ga0068858_100006823
692 Ga0068858_100023747
693 Ga0068858_100042971
694 Ga0068858_100046652
695 Ga0068860_100000796
696 Ga0068860_100021617
697 Ga0068862_100025568
698 Ga0081538_10007935
699 Ga0081540_1000086
700 Ga0070717_10000492
701 Ga0070717_10000947
702 Ga0070717_10055780
703 Ga0075365_10022846
704 Ga0070715_10005882
705 Ga0070716_100017097
706 Ga0070716_100029051
707 Ga0070716_100060060
708 Ga0070716_100113702
709 Ga0070712_100005241
710 Ga0070712_100011522
711 Ga0070712_100017619
712 Ga0070712_100120682
713 Ga0070712_100413186
714 Ga0075367_10108288
715 Ga0097621_100001314
716 Ga0097621_100002377
717 Ga0097621_100004753
718 Ga0097621_100005174
719 Ga0097621_100006541
720 Ga0097621_100041120
721 Ga0097621_100392444
722 Ga0068871_100000226
723 Ga0068871_100001612
724 Ga0068871_100002435
725 Ga0068871_100025860
726 Ga0068865_100032599
727 Ga0068865_100070967
728 Ga0097620_100002596
729 Ga0097620_100005789
730 Ga0097620_100007475
731 Ga0097620_100014631
732 Ga0075435_100118279
733 Ga0075435_100225571
734 Ga0099795_10023321
735 Ga0105251_10089360
736 Ga0105244_10137302
737 Ga0105240_10000820
738 Ga0105240_10002935
739 Ga0105240_10070607
740 Ga0105240_10105397
741 Ga0111539_10393846
742 Ga0111539_10755047
743 Ga0111539_10897954
744 Ga0105245_10004827
745 Ga0105245_10012267
746 Ga0105247_10001142
747 Ga0105247_10204729
748 Ga0114129_10901665
749 Ga0105243_10005098
750 Ga0105243_10186796
751 Ga0105241_10022224
752 Ga0105241_10147583
753 Ga0105241_10585235
754 Ga0105248_10003754
755 Ga0105248_10004230
756 Ga0105248_10011571
757 Ga0105248_10026078
758 Ga0105248_10073281
759 Ga0105248_10298890
760 Ga0105237_10029342
761 Ga0105237_10289705
762 Ga0105237_10538786
763 Ga0105238_10000548
764 Ga0105238_10024369
765 Ga0105238_10121197
766 Ga0105238_10172436
767 Ga0105249_10016745
768 Ga0105032_101960
769 Ga0105239_10031370
770 Ga0105239_10037990
771 Ga0105239_10122614
772 Ga0105239_10152972
773 Ga0105246_10016586
774 Ga0105246_10103764
775 Ga0157373_10033694
776 Ga0157371_10271057
777 Ga0157371_10289852
778 Ga0157369_10000041
779 Ga0157369_10001859
780 Ga0157369_10054472
781 Ga0157369_10168208
782 Ga0157374_10000078
783 Ga0157374_10004157
784 Ga0157374_10004200
785 Ga0157374_10098935
786 Ga0157374_10164640
787 Ga0157378_10002970
788 Ga0157378_10005309
789 Ga0157378_10013891
790 Ga0157378_10020009
791 Ga0157378_10078362
792 Ga0157378_10202937
793 Ga0163162_10008849
794 Ga0163162_10009457
795 Ga0163162_10013536
796 Ga0163162_10024609
797 Ga0163162_10115293
798 Ga0163162_10302070
799 Ga0157372_10000431
800 Ga0157372_10006059
801 Ga0157372_10008205
802 Ga0157372_10011026
803 Ga0157372_10146428
804 Ga0157372_10226307
805 Ga0157372_10267779
806 Ga0157372_10318689
807 Ga0157375_10001027
808 Ga0157375_10003850
809 Ga0157375_10026976
810 Ga0163163_10011593
811 Ga0163163_10232067
812 Ga0157380_10000360
813 Ga0157380_10179907
814 Ga0157380_10627594
815 Ga0182008_10025824
816 Ga0157377_10126241
817 Ga0157379_10004258
818 Ga0157379_10005735
819 Ga0157379_10059545
820 Ga0157379_10158179
821 Ga0157379_10183967
822 Ga0157376_10015161
823 Ga0157376_10017042
824 Ga0157376_10125928
825 Ga0163161_10011240
826 Ga0207697_10000796
827 Ga0207656_10138913
828 Ga0207655_1003545
829 Ga0207713_1076030
830 Ga0207692_10075187
831 Ga0207692_10084588
832 Ga0207692_10233931
833 Ga0207680_10003866
834 Ga0207680_10025629
835 Ga0207680_10059983
836 Ga0207699_10040480
837 Ga0207699_10042899
838 Ga0207699_10072613
839 Ga0207645_10002303
840 Ga0207645_10005194
841 Ga0207645_10027038
842 Ga0207684_10001829
843 Ga0207684_10026227
844 Ga0207684_10285922
845 Ga0207654_10005026
846 Ga0207654_10041014
847 Ga0207654_10335345
848 Ga0207707_10000194
849 Ga0207707_10082632
850 Ga0207695_10014360
851 Ga0207695_10024621
852 Ga0207695_10166608
853 Ga0207695_10281579
854 Ga0207671_10245967
855 Ga0207693_10000286
856 Ga0207693_10004130
857 Ga0207693_10004585
858 Ga0207693_10005273
859 Ga0207693_10026242
860 Ga0207693_10134477
861 Ga0207693_10250572
862 Ga0207663_10001808
863 Ga0207663_10034135
864 Ga0207663_10034220
865 Ga0207663_10082853
866 Ga0207663_10271278
867 Ga0207660_10186237
868 Ga0207662_10009401
869 Ga0207657_10002061
870 Ga0207649_10052895
871 Ga0207652_10329020
872 Ga0207646_10000469
873 Ga0207646_10295955
874 Ga0207681_10000592
875 Ga0207681_10045669
876 Ga0207681_10070861
877 Ga0207694_10002301
878 Ga0207694_10016132
879 Ga0207650_10023555
880 Ga0207659_10011409
881 Ga0207659_10013840
882 Ga0207687_10000114
883 Ga0207687_10038307
884 Ga0207687_10465816
885 Ga0207700_10006699
886 Ga0207700_10009057
887 Ga0207700_10025316
888 Ga0207700_10155322
889 Ga0207700_10506440
890 Ga0207664_10000770
891 Ga0207664_10008332
892 Ga0207664_10108670
893 Ga0207664_10242042
894 Ga0207644_10042148
895 Ga0207644_10186048
896 Ga0207644_10237814
897 Ga0207690_10120148
898 Ga0207706_10000142
899 Ga0207706_10002518
900 Ga0207686_10092439
901 Ga0207709_10029484
902 Ga0207709_10031995
903 Ga0207670_10000059
904 Ga0207670_10035026
905 Ga0207669_10001832
906 Ga0207669_10100828
907 Ga0207704_10106491
908 Ga0207665_10001827
909 Ga0207665_10005832
910 Ga0207665_10028515
911 Ga0207665_10053282
912 Ga0207665_10080241
913 Ga0207665_10158681
914 Ga0207665_10167730
915 Ga0207691_10029438
916 Ga0207691_10118401
917 Ga0207711_10005720
918 Ga0207711_10013309
919 Ga0207711_10059275
920 Ga0207711_10309287
921 Ga0207711_10450658
922 Ga0207689_10006195
923 Ga0207689_10068787
924 Ga0207689_10272965
925 Ga0207679_10010543
926 Ga0207679_10031660
927 Ga0207679_10157870
928 Ga0207679_10173185
929 Ga0207667_10000821
930 Ga0207667_10002541
931 Ga0207667_10005864
932 Ga0207667_10041670
933 Ga0207712_10006834
934 Ga0207712_10066351
935 Ga0207668_10004797
936 Ga0207668_10011986
937 Ga0207640_10005281
938 Ga0207640_10057358
939 Ga0207640_10131896
940 Ga0207640_10472374
941 Ga0207658_10000510
942 Ga0207658_10048610
943 Ga0207658_10203914
944 Ga0207677_10002896
945 Ga0207677_10006776
946 Ga0207703_10001422
947 Ga0207703_10008453
948 Ga0207703_10009168
949 Ga0207703_10017852
950 Ga0207703_10051158
951 Ga0207703_10059442
952 Ga0207703_10069427
953 Ga0207639_10023769
954 Ga0207639_10040460
955 Ga0207639_10128502
956 Ga0207678_10000039
957 Ga0207678_10083605
958 Ga0207708_10000274
959 Ga0207702_10000275
960 Ga0207702_10004239
961 Ga0207702_10007064
962 Ga0207702_10142268
963 Ga0207641_10001218
964 Ga0207641_10010148
965 Ga0207641_10014501
966 Ga0207641_10025030
967 Ga0207648_10001492
968 Ga0207648_10007986
969 Ga0207676_10008441
970 Ga0207676_10099084
971 Ga0207674_10004700
972 Ga0207674_10038466
973 Ga0207675_100001773
974 Ga0207683_10002047
975 Ga0207683_10068440
976 Ga0207683_10149833
977 Ga0207698_10009126
978 Ga0207698_10015206
979 Ga0207698_10032781
980 Ga0268266_10005246
981 Ga0268265_10326946
982 Ga0268264_10007395
983 Ga0268264_10035895
984 Ga0265760_10091153
985 Ga0307408_100122032
986 Ga0307410_10060147
987 Ga0307407_10012672
988 Ga0373950_0039980
989 Ga0373934_0054135
990 Ga0373952_0008724
991 Ga0373923_0016392
992 Ga0373936_0028470
993 Ga0373941_0073799
994 Ga0373954_0057340
995 Ga0373956_0012483
996 Ga0373943_0094834
997 Ga0373943_0258554
998 Ga0373946_0022055
999 Ga0373955_0281479
1000 Ga0373931_0031651
1001 Ga0373931_0088260
1002 Ga0373931_0172313
1003 Ga0373927_0000189
1004 Ga0373927_0159532
1005 Ga0373933_0028504
1006 Ga0373947_0042546
1007 Ga0373937_0123869
1008 Ga0373925_0001487
1009 Ga0373925_0001494
1010 Ga0373925_0021475
1011 Ga0373925_0051715
1012 Ga0395899_0089819
1013 Ga0395900_0015389
1014 Ga0395900_0055835
1015 Ga0395901_0039977
1016 Ga0451793_0709325
1017 Ga0451853_2281844
1018 Ga0495653_0376667
1019 Ga0495580_0002429
1020 Ga0495580_0013063
1021 Ga0495580_0046503
1022 Ga0495608_0335193
1023 Ga0495630_0556893
1024 Ga0495642_0055879
1025 Ga0495587_0182710
1026 Ga0495633_0015766
1027 Ga0495656_0002009
1028 Ga0495659_0002916
1029 Ga0495588_0011026
1030 Ga0495670_0009420
1031 Ga0495604_0191050
1032 Ga0495677_0038306
1033 Ga0495681_0015145
1034 Ga0496100_0020193
1035 Ga0496100_0119500
1036 Ga0496101_0046163
1037 Ga0496101_0051121
1038 Ga0496101_0248263
1039 Ga0496102_0000322
1040 Ga0496102_0007102
1041 Ga0496102_0042318
1042 Ga0496103_0002175
1043 Ga0496103_0080158
1044 Ga0496104_0057955
1045 Ga0496104_0079288
1046 Ga0496104_0197901
1047 Ga0496105_0317434
1048 Ga0496105_0336344
1049 Ga0496105_0366224
1050 Ga0496106_0003494
1051 Ga0496106_0034415
1052 Ga0496106_0054971
1053 Ga0496107_0076556
1054 Ga0496107_0077743
1055 Ga0496107_0109882
1056 Ga0496108_0035265
1057 Ga0496108_0042824
1058 Ga0496109_0071270
1059 Ga0496109_0206589
1060 Ga0496109_0401426
1061 Ga0496110_0008685
1062 Ga0496110_0059359
1063 Ga0496110_0158447
1064 Ga0496111_0014633
1065 Ga0496111_0140352
1066 Ga0496112_0013854
1067 Ga0496112_0050772
1068 Ga0496112_0210761
1069 Ga0496113_0043930
1070 Ga0496113_0097718
1071 Ga0496114_0028451
1072 Ga0496114_0125338
1073 Ga0496114_0253439
1074 Ga0496119_0075499
1075 Ga0496120_0115835
1076 Ga0496121_0187624
1077 Ga0496124_0050366
1078 Ga0496126_0013801
1079 Ga0501048_0000199
1080 Ga0501070_0003977
1081 Ga0501076_0004362
1082 nmdc:mga03683_62217_c1
1083 nmdc:mga0yw44_88751_c1
1084 nmdc:mga0k408_267726_c1
1085 nmdc:mga06z11_44796_c1
1086 nmdc:mga07m45_303793_c1
1087 nmdc:mga08y16_356914_c1
1088 nmdc:mga0n895_25618_c1
1089 nmdc:mga0rr50_161443_c1
1090 nmdc:mga0rr50_485174_c1
1091 Ga0495619_0072493
1092 Ga0500616_0002188
1093 Ga0530510_0076487
1094 Ga0530510_0150061
1095 2513552587
1096 2513560672
1097 2524463781
1098 2524535346
1099 2904673358
1100 2904698582
1101 2908741104
1102 2908762408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

65

293

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5llf-assembly2.cif.gz_C structure of polyphosphate kinase 2 mutant d117n from francisella tularensis with polyphosphate 0.9821 15 241
5llb-assembly1.cif.gz_C structure of polyphosphate kinase 2 from francisella tularensis with amppch2ppp and polyphosphate 0.9772 17 242
3czq-assembly1.cif.gz_D crystal structure of putative polyphosphate kinase 2 from sinorhizobium meliloti 0.9753 15 242
4yeg-assembly2.cif.gz_D characterisation of polyphosphate kinase 2 from the intracellular pathogen francisella tularensis 0.9589 14 241
4yeg-assembly1.cif.gz_A characterisation of polyphosphate kinase 2 from the intracellular pathogen francisella tularensis 0.9467 14 242
ID Description Score Start End Superfamily
3czqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9674 15 239 3.40.50.300
4yegC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.938 14 242 3.40.50.300
3czpB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9118 10 234 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9055 9 235 3.40.50.300
3czpB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8995 17 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5C7K9I6-F1-model_v4 deleted 0.9964 17 135
AF-A0A7V8G0E4-F1-model_v4 Polyphosphate:ADP phosphotransferase 0.9957 19 162 GO:0016740
AF-A0A526RPP4-F1-model_v4 ADP/GDP-polyphosphate phosphotransferase (EC 2.7.4.-) (Polyphosphate kinase PPK2) 0.9943 15 231 GO:0006754
GO:0008976
AF-A0A7C3CXH0-F1-model_v4 ADP/GDP-polyphosphate phosphotransferase (EC 2.7.4.-) (Polyphosphate kinase PPK2) 0.993 16 243 GO:0006793
GO:0008976
AF-A0A530QIR0-F1-model_v4 Polyphosphate kinase 2 0.9927 78 207 GO:0006754
GO:0016301

Map