F462585

General Info

Members Datasets Scaffolds Average Seq Length
551 286 1102 218

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100296696|Ga0068852_1002966962
Length 255
Sequence MTGSTSNAALRCRNLRASPRSLRVVVQGTILADTLMTTEEAAMGTSIDMKFEIVVIPVSDVDRAKRFYANLGWRLDADFDDAKGLRVLQFTPPGSACSVIFGNNVTAAAPGSAQGLYLIVSDLEVARRELVTRGVEVSETFHSAGVSAGPDEPYLFGRARVSGPDPEHGSYRSFASFRDPDGNGWLFQEVTKRLEGRIDSATTTFASLSDLAGALRRAEHAHGPHEAKLGKRDENWPEWYAAYMVAEQSGATLPD

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
94 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
95 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
274 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
275 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
276 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
277 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
278 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
279 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
281 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
284 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
285 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
286 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.18
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0.18
Rhizoplane 6.72
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100296696 3300005616 Bacteria 1563
2 JGI24746J21847_1005033 3300001977 Bacteria 2071
3 JGI24747J21853_1005702 3300001978 Bacteria 1157
4 JGI24738J21930_10010015 3300002075 Bacteria 2120
5 Ga0058861_11994443 3300004800 Bacteria 1169
6 Ga0070676_10010247 3300005328 Bacteria 5083
7 Ga0070676_10146200 3300005328 Bacteria 1509
8 Ga0070676_10542523 3300005328 Bacteria 831
9 Ga0070683_100006753 3300005329 Bacteria 9637
10 Ga0070690_100002486 3300005330 Bacteria 9910
11 Ga0070670_100005543 3300005331 Bacteria 10648
12 Ga0070670_100064004 3300005331 Bacteria 3156
13 Ga0070670_100151272 3300005331 Bacteria 2008
14 Ga0070670_100267084 3300005331 Bacteria 1492
15 Ga0068869_100048761 3300005334 Bacteria 3064
16 Ga0070666_10670059 3300005335 Bacteria 759
17 Ga0070680_100004377 3300005336 Bacteria 10630
18 Ga0070680_100110753 3300005336 Bacteria 2285
19 Ga0070680_100293152 3300005336 Bacteria 1379
20 Ga0070680_100364722 3300005336 Bacteria 1229
21 Ga0070682_100003912 3300005337 Bacteria 8265
22 Ga0070682_100040286 3300005337 Bacteria 2874
23 Ga0070682_100067848 3300005337 Bacteria 2272
24 Ga0068868_100162434 3300005338 Bacteria 1845
25 Ga0070660_100003480 3300005339 Bacteria 10842
26 Ga0070660_100266503 3300005339 Bacteria 1399
27 Ga0070689_100385417 3300005340 Bacteria 1182
28 Ga0070689_100416474 3300005340 Bacteria 1138
29 Ga0070689_100514426 3300005340 Bacteria 1027
30 Ga0070691_10034247 3300005341 Bacteria 2390
31 Ga0070691_10220930 3300005341 Bacteria 1004
32 Ga0070691_10348579 3300005341 Bacteria 821
33 Ga0070687_100003077 3300005343 Bacteria 6415
34 Ga0070661_100005996 3300005344 Bacteria 8365
35 Ga0070661_100826254 3300005344 Bacteria 761
36 Ga0070668_100066143 3300005347 Bacteria 2804
37 Ga0070668_100092929 3300005347 Bacteria 2380
38 Ga0070668_100178207 3300005347 Bacteria 1735
39 Ga0070668_100223921 3300005347 Bacteria 1553
40 Ga0070668_100271667 3300005347 Bacteria 1413
41 Ga0070668_100460798 3300005347 Bacteria 1094
42 Ga0070669_100004234 3300005353 Bacteria 10377
43 Ga0070669_100086435 3300005353 Bacteria 2343
44 Ga0070675_100004596 3300005354 Bacteria 10542
45 Ga0070675_100292155 3300005354 Bacteria 1434
46 Ga0070675_100693606 3300005354 Bacteria 927
47 Ga0070671_100007607 3300005355 Bacteria 8665
48 Ga0070671_100055786 3300005355 Bacteria 3287
49 Ga0070671_100107886 3300005355 Bacteria 2338
50 Ga0070671_100136866 3300005355 Bacteria 2065
51 Ga0070674_100070228 3300005356 Bacteria 2474
52 Ga0070674_100079221 3300005356 Bacteria 2343
53 Ga0070674_100092817 3300005356 Bacteria 2183
54 Ga0070674_100883959 3300005356 Bacteria 777
55 Ga0070673_100003318 3300005364 Bacteria 9999
56 Ga0070673_100234996 3300005364 Bacteria 1591
57 Ga0070659_100100423 3300005366 Bacteria 2328
58 Ga0070659_100567733 3300005366 Bacteria 972
59 Ga0070667_100018157 3300005367 Bacteria 5832
60 Ga0070667_100022536 3300005367 Bacteria 5222
61 Ga0070667_100931723 3300005367 Bacteria 809
62 Ga0070703_10000279 3300005406 Bacteria 23683
63 Ga0070709_10002013 3300005434 Bacteria 11043
64 Ga0070701_10005710 3300005438 Bacteria 5170
65 Ga0070705_100002546 3300005440 Bacteria 9161
66 Ga0070705_100055170 3300005440 Bacteria 2334
67 Ga0070705_100278982 3300005440 Bacteria 1187
68 Ga0070700_100009050 3300005441 Bacteria 5456
69 Ga0070700_100015267 3300005441 Bacteria 4353
70 Ga0070700_100799084 3300005441 Bacteria 759
71 Ga0070694_100073765 3300005444 Bacteria 2357
72 Ga0070663_100009057 3300005455 Bacteria 6149
73 Ga0070663_100086224 3300005455 Bacteria 2318
74 Ga0070678_100041286 3300005456 Bacteria 3269
75 Ga0070678_101024717 3300005456 Bacteria 759
76 Ga0070662_100002364 3300005457 Bacteria 11591
77 Ga0070662_100016144 3300005457 Bacteria 5010
78 Ga0070662_100327544 3300005457 Bacteria 1250
79 Ga0070662_100609651 3300005457 Bacteria 919
80 Ga0070681_10007934 3300005458 Bacteria 10388
81 Ga0070681_10352561 3300005458 Bacteria 1382
82 Ga0068867_100028777 3300005459 Bacteria 4000
83 Ga0070706_100541201 3300005467 Bacteria 1083
84 Ga0070707_100144962 3300005468 Bacteria 2311
85 Ga0070679_100023489 3300005530 Bacteria 6036
86 Ga0070679_100024574 3300005530 Bacteria 5906
87 Ga0070679_100149756 3300005530 Bacteria 2310
88 Ga0070679_101041701 3300005530 Bacteria 762
89 Ga0070684_100009321 3300005535 Bacteria 7728
90 Ga0068853_100046987 3300005539 Bacteria 3704
91 Ga0068853_100150994 3300005539 Bacteria 2091
92 Ga0070672_100007399 3300005543 Bacteria 7444
93 Ga0070672_100952617 3300005543 Bacteria 759
94 Ga0070686_100066602 3300005544 Bacteria 2343
95 Ga0070695_100066859 3300005545 Bacteria 2343
96 Ga0070696_100020813 3300005546 Bacteria 4445
97 Ga0070696_100089912 3300005546 Bacteria 2184
98 Ga0070693_100271831 3300005547 Bacteria 1132
99 Ga0070693_100663826 3300005547 Bacteria 759
100 Ga0070665_100518683 3300005548 Bacteria 1203
101 Ga0070704_100059379 3300005549 Bacteria 2728
102 Ga0068855_100020929 3300005563 Bacteria 7843
103 Ga0070664_100061799 3300005564 Bacteria 3193
104 Ga0070664_100084631 3300005564 Bacteria 2738
105 Ga0070664_100250204 3300005564 Bacteria 1593
106 Ga0070664_101068844 3300005564 Bacteria 759
107 Ga0068857_100006093 3300005577 Bacteria 10299
108 Ga0068857_100493123 3300005577 Bacteria 1149
109 Ga0068854_100000227 3300005578 Bacteria 38075
110 Ga0068854_100002230 3300005578 Bacteria 11923
111 Ga0068854_100038340 3300005578 Bacteria 3369
112 Ga0068854_100178311 3300005578 Bacteria 1658
113 Ga0068854_100503734 3300005578 Bacteria 1020
114 Ga0068854_100843832 3300005578 Bacteria 801
115 Ga0068856_100062715 3300005614 Bacteria 3671
116 Ga0068856_100463608 3300005614 Bacteria 1288
117 Ga0070702_100015554 3300005615 Bacteria 3886
118 Ga0070702_100223240 3300005615 Bacteria 1261
119 Ga0068852_100076432 3300005616 Bacteria 2956
120 Ga0068852_100224803 3300005616 Bacteria 1787
121 Ga0068859_100005469 3300005617 Bacteria 12924
122 Ga0068859_100023559 3300005617 Bacteria 6178
123 Ga0068859_100072730 3300005617 Unclassified 3475
124 Ga0068859_100095536 3300005617 Bacteria 3025
125 Ga0068864_100005847 3300005618 Bacteria 10086
126 Ga0068864_100025170 3300005618 Bacteria 5010
127 Ga0068864_100372306 3300005618 Bacteria 1352
128 Ga0068864_100498918 3300005618 Bacteria 1171
129 Ga0068866_10001457 3300005718 Bacteria 10120
130 Ga0068866_10006831 3300005718 Bacteria 4766
131 Ga0068861_100012037 3300005719 Bacteria 6027
132 Ga0068861_100156790 3300005719 Bacteria 1874
133 Ga0068851_10040583 3300005834 Bacteria 2339
134 Ga0068870_10002196 3300005840 Bacteria 8086
135 Ga0068870_10030863 3300005840 Bacteria 2712
136 Ga0068863_100101059 3300005841 Bacteria 2741
137 Ga0068863_100108704 3300005841 Bacteria 2639
138 Ga0068863_100311954 3300005841 Bacteria 1527
139 Ga0068863_101267235 3300005841 Bacteria 744
140 Ga0068858_100066247 3300005842 Bacteria 3343
141 Ga0068860_100000100 3300005843 Bacteria 144580
142 Ga0068860_100001527 3300005843 Bacteria 24942
143 Ga0068860_100006873 3300005843 Bacteria 11409
144 Ga0068860_100360723 3300005843 Bacteria 1432
145 Ga0068860_101261534 3300005843 Bacteria 759
146 Ga0068862_100149968 3300005844 Bacteria 2075
147 Ga0068862_100280623 3300005844 Bacteria 1527
148 Ga0068862_100451075 3300005844 Bacteria 1213
149 Ga0068862_100502769 3300005844 Bacteria 1151
150 Ga0068862_101192522 3300005844 Bacteria 759
151 Ga0081538_10058104 3300005981 Bacteria 2247
152 Ga0070717_10413995 3300006028 Bacteria 1212
153 Ga0097621_100008446 3300006237 Bacteria 7418
154 Ga0097621_100111094 3300006237 Bacteria 2316
155 Ga0097621_100151571 3300006237 Bacteria 1988
156 Ga0068871_100002484 3300006358 Bacteria 12578
157 Ga0068871_100018474 3300006358 Bacteria 5300
158 Ga0068871_100382986 3300006358 Bacteria 1250
159 Ga0068871_100670198 3300006358 Bacteria 948
160 Ga0068871_100814913 3300006358 Bacteria 861
161 Ga0075428_100018088 3300006844 Bacteria 7788
162 Ga0075430_100002761 3300006846 Bacteria 14667
163 Ga0075431_100059305 3300006847 Bacteria 3950
164 Ga0075431_100100313 3300006847 Bacteria 2987
165 Ga0075434_100018256 3300006871 Bacteria 6773
166 Ga0075429_100381160 3300006880 Bacteria 1235
167 Ga0068865_100008910 3300006881 Bacteria 6206
168 Ga0068865_100038004 3300006881 Bacteria 3255
169 Ga0068865_100129716 3300006881 Bacteria 1887
170 Ga0068865_100135975 3300006881 Bacteria 1847
171 Ga0097620_100005469 3300006931 Bacteria 12924
172 Ga0097620_100023559 3300006931 Bacteria 6178
173 Ga0097620_100072727 3300006931 Unclassified 3475
174 Ga0097620_100095540 3300006931 Bacteria 3025
175 Ga0105244_10140528 3300009036 Bacteria 1162
176 Ga0105240_10111937 3300009093 Bacteria 3301
177 Ga0105240_10112266 3300009093 Bacteria 3295
178 Ga0105240_10175612 3300009093 Bacteria 2533
179 Ga0105240_10224656 3300009093 Bacteria 2185
180 Ga0105240_10440225 3300009093 Bacteria 1460
181 Ga0105240_10546666 3300009093 Bacteria 1282
182 Ga0111539_10146798 3300009094 Bacteria 2762
183 Ga0111539_10170744 3300009094 Bacteria 2541
184 Ga0111539_10184041 3300009094 Bacteria 2440
185 Ga0105245_10004456 3300009098 Bacteria 12383
186 Ga0105245_10015490 3300009098 Bacteria 6648
187 Ga0105245_10107049 3300009098 Bacteria 2595
188 Ga0105245_10250744 3300009098 Bacteria 1720
189 Ga0105245_10309841 3300009098 Bacteria 1552
190 Ga0105247_10030577 3300009101 Bacteria 3264
191 Ga0114129_10289734 3300009147 Bacteria 2185
192 Ga0105243_10013000 3300009148 Bacteria 6289
193 Ga0105243_10016303 3300009148 Bacteria 5621
194 Ga0105243_10019496 3300009148 Bacteria 5142
195 Ga0105243_11218524 3300009148 Bacteria 767
196 Ga0105241_10000382 3300009174 Bacteria 33682
197 Ga0105241_10175042 3300009174 Bacteria 1775
198 Ga0105242_10020060 3300009176 Bacteria 5238
199 Ga0105242_10049706 3300009176 Bacteria 3413
200 Ga0105248_10048980 3300009177 Bacteria 4739
201 Ga0105248_10311167 3300009177 Bacteria 1774
202 Ga0105248_10587102 3300009177 Bacteria 1257
203 Ga0105237_10147996 3300009545 Bacteria 2344
204 Ga0105237_10155669 3300009545 Bacteria 2282
205 Ga0105238_10000694 3300009551 Bacteria 35250
206 Ga0105238_10228166 3300009551 Bacteria 1839
207 Ga0105238_10399428 3300009551 Bacteria 1367
208 Ga0105238_10737233 3300009551 Bacteria 999
209 Ga0105249_10089826 3300009553 Bacteria 2871
210 Ga0105249_10090128 3300009553 Bacteria 2867
211 Ga0105239_10007327 3300010375 Bacteria 12666
212 Ga0105239_10030907 3300010375 Bacteria 5892
213 Ga0105239_10122763 3300010375 Bacteria 2886
214 Ga0105239_10135870 3300010375 Bacteria 2737
215 Ga0105246_10022278 3300011119 Bacteria 4086
216 Ga0105246_10028259 3300011119 Bacteria 3683
217 Ga0157339_1001760 3300012505 Bacteria 1377
218 Ga0157324_1005712 3300012506 Bacteria 911
219 Ga0157326_1001969 3300012513 Bacteria 2230
220 Ga0157326_1010757 3300012513 Bacteria 1024
221 Ga0157369_10001748 3300013105 Bacteria 26335
222 Ga0157374_10005126 3300013296 Bacteria 10994
223 Ga0157374_10164378 3300013296 Bacteria 2163
224 Ga0157378_10003468 3300013297 Bacteria 13993
225 Ga0157378_10005460 3300013297 Bacteria 11136
226 Ga0157378_10127255 3300013297 Bacteria 2354
227 Ga0157378_10884455 3300013297 Bacteria 923
228 Ga0163162_10023944 3300013306 Bacteria 6026
229 Ga0163162_10028652 3300013306 Bacteria 5512
230 Ga0163162_10066205 3300013306 Bacteria 3661
231 Ga0163162_10112838 3300013306 Bacteria 2817
232 Ga0163162_10138873 3300013306 Bacteria 2542
233 Ga0157372_10019331 3300013307 Bacteria 7337
234 Ga0157372_10029612 3300013307 Bacteria 5981
235 Ga0157372_10030483 3300013307 Bacteria 5901
236 Ga0157372_10227601 3300013307 Bacteria 2162
237 Ga0157375_10004520 3300013308 Bacteria 12087
238 Ga0157375_10014067 3300013308 Bacteria 7135
239 Ga0157375_10057878 3300013308 Bacteria 3832
240 Ga0157375_10127330 3300013308 Unclassified 2663
241 Ga0157375_10346487 3300013308 Bacteria 1651
242 Ga0157375_10579971 3300013308 Bacteria 1282
243 Ga0163163_10071189 3300014325 Unclassified 3464
244 Ga0163163_10170133 3300014325 Bacteria 2225
245 Ga0163163_10331287 3300014325 Bacteria 1577
246 Ga0157380_10023306 3300014326 Bacteria 4668
247 Ga0157380_10057518 3300014326 Bacteria 3097
248 Ga0157380_10079222 3300014326 Bacteria 2682
249 Ga0157380_10186394 3300014326 Bacteria 1828
250 Ga0157380_10194836 3300014326 Bacteria 1792
251 Ga0157380_10294481 3300014326 Bacteria 1492
252 Ga0157377_10005921 3300014745 Bacteria 5786
253 Ga0157379_10009945 3300014968 Bacteria 8284
254 Ga0157379_10095250 3300014968 Bacteria 2671
255 Ga0157379_10298728 3300014968 Bacteria 1467
256 Ga0157376_10094438 3300014969 Bacteria 2598
257 Ga0157376_10097578 3300014969 Bacteria 2560
258 Ga0157376_10633274 3300014969 Bacteria 1068
259 Ga0157376_10654153 3300014969 Bacteria 1052
260 Ga0163161_10104295 3300017792 Bacteria 2113
261 Ga0163161_10238729 3300017792 Bacteria 1413
262 Ga0163161_10365469 3300017792 Bacteria 1150
263 Ga0213876_10233265 3300021384 Bacteria 978
264 Ga0207673_1000199 3300025290 Bacteria 6006
265 Ga0207426_1019535 3300025302 Bacteria 2367
266 Ga0207656_10023152 3300025321 Bacteria 2498
267 Ga0207682_10068053 3300025893 Bacteria 1504
268 Ga0207688_10049147 3300025901 Bacteria 2357
269 Ga0207680_10071710 3300025903 Bacteria 2148
270 Ga0207647_10002513 3300025904 Bacteria 13884
271 Ga0207643_10000170 3300025908 Bacteria 44654
272 Ga0207654_10000034 3300025911 Bacteria 113041
273 Ga0207707_10006812 3300025912 Bacteria 9970
274 Ga0207695_10166521 3300025913 Bacteria 2132
275 Ga0207695_10385910 3300025913 Bacteria 1286
276 Ga0207671_10098104 3300025914 Bacteria 2216
277 Ga0207671_10402687 3300025914 Bacteria 1088
278 Ga0207660_10022481 3300025917 Bacteria 4248
279 Ga0207660_10245953 3300025917 Bacteria 1411
280 Ga0207649_10001009 3300025920 Bacteria 17378
281 Ga0207652_10019036 3300025921 Bacteria 5638
282 Ga0207646_10196668 3300025922 Bacteria 1821
283 Ga0207681_10011248 3300025923 Bacteria 5497
284 Ga0207694_10001096 3300025924 Bacteria 23463
285 Ga0207694_10540912 3300025924 Bacteria 977
286 Ga0207650_10006724 3300025925 Bacteria 7840
287 Ga0207650_10076847 3300025925 Bacteria 2523
288 Ga0207659_10003950 3300025926 Bacteria 8951
289 Ga0207659_10081867 3300025926 Bacteria 2388
290 Ga0207687_10071386 3300025927 Bacteria 2481
291 Ga0207687_10431040 3300025927 Bacteria 1090
292 Ga0207687_10727356 3300025927 Bacteria 844
293 Ga0207644_10002334 3300025931 Bacteria 12261
294 Ga0207644_10007715 3300025931 Bacteria 7022
295 Ga0207644_10085139 3300025931 Bacteria 2344
296 Ga0207690_10004193 3300025932 Bacteria 8519
297 Ga0207690_10071832 3300025932 Bacteria 2388
298 Ga0207690_10356034 3300025932 Bacteria 1158
299 Ga0207706_10016939 3300025933 Bacteria 6574
300 Ga0207706_10017759 3300025933 Bacteria 6407
301 Ga0207706_10194272 3300025933 Bacteria 1781
302 Ga0207686_10016043 3300025934 Bacteria 4198
303 Ga0207686_10024867 3300025934 Bacteria 3476
304 Ga0207686_10172791 3300025934 Bacteria 1525
305 Ga0207709_10005222 3300025935 Bacteria 7390
306 Ga0207709_10020056 3300025935 Bacteria 3768
307 Ga0207709_10087447 3300025935 Bacteria 2026
308 Ga0207670_10230348 3300025936 Bacteria 1423
309 Ga0207670_10446621 3300025936 Bacteria 1042
310 Ga0207669_10003055 3300025937 Bacteria 7210
311 Ga0207669_10083341 3300025937 Bacteria 2056
312 Ga0207669_10107178 3300025937 Bacteria 1863
313 Ga0207669_10692277 3300025937 Bacteria 837
314 Ga0207704_10005651 3300025938 Bacteria 5777
315 Ga0207704_10489471 3300025938 Bacteria 989
316 Ga0207711_10028641 3300025941 Bacteria 4690
317 Ga0207711_10500720 3300025941 Bacteria 1132
318 Ga0207689_10406188 3300025942 Bacteria 1136
319 Ga0207661_10000500 3300025944 Bacteria 25254
320 Ga0207679_10000073 3300025945 Bacteria 89687
321 Ga0207651_10022425 3300025960 Bacteria 3860
322 Ga0207651_10043476 3300025960 Bacteria 2999
323 Ga0207712_10117143 3300025961 Bacteria 2009
324 Ga0207668_10052950 3300025972 Bacteria 2810
325 Ga0207668_10107739 3300025972 Bacteria 2084
326 Ga0207668_10270994 3300025972 Bacteria 1388
327 Ga0207668_10453877 3300025972 Bacteria 1094
328 Ga0207668_10482539 3300025972 Bacteria 1063
329 Ga0207640_10000226 3300025981 Bacteria 39673
330 Ga0207640_10002746 3300025981 Bacteria 9419
331 Ga0207640_10060231 3300025981 Bacteria 2508
332 Ga0207640_10143573 3300025981 Bacteria 1743
333 Ga0207640_10638597 3300025981 Bacteria 906
334 Ga0207658_10007054 3300025986 Bacteria 7649
335 Ga0207677_10056797 3300026023 Bacteria 2684
336 Ga0207677_10066452 3300026023 Bacteria 2521
337 Ga0207639_10021608 3300026041 Bacteria 4625
338 Ga0207639_10035019 3300026041 Bacteria 3715
339 Ga0207678_10003681 3300026067 Bacteria 13780
340 Ga0207678_10098691 3300026067 Bacteria 2495
341 Ga0207708_10051473 3300026075 Bacteria 3135
342 Ga0207708_10377506 3300026075 Bacteria 1168
343 Ga0207708_10484907 3300026075 Bacteria 1034
344 Ga0207702_10257438 3300026078 Bacteria 1642
345 Ga0207702_10516767 3300026078 Bacteria 1165
346 Ga0207641_10093444 3300026088 Bacteria 2636
347 Ga0207641_10133072 3300026088 Bacteria 2235
348 Ga0207641_10399550 3300026088 Bacteria 1319
349 Ga0207648_10677233 3300026089 Bacteria 955
350 Ga0207648_11354341 3300026089 Bacteria 669
351 Ga0207676_10006169 3300026095 Bacteria 8464
352 Ga0207676_10452000 3300026095 Bacteria 1211
353 Ga0207676_10644314 3300026095 Bacteria 1022
354 Ga0207674_10003682 3300026116 Bacteria 18700
355 Ga0207674_10005059 3300026116 Bacteria 15736
356 Ga0207674_10721107 3300026116 Bacteria 962
357 Ga0207675_100026081 3300026118 Bacteria 5439
358 Ga0207675_100035528 3300026118 Bacteria 4649
359 Ga0207675_100243399 3300026118 Bacteria 1739
360 Ga0207675_100959073 3300026118 Bacteria 873
361 Ga0207683_10051962 3300026121 Bacteria 3591
362 Ga0207683_10230841 3300026121 Bacteria 1688
363 Ga0207683_10648233 3300026121 Bacteria 978
364 Ga0209971_1014353 3300027682 Bacteria 1877
365 Ga0209998_10002260 3300027717 Bacteria 4456
366 Ga0207428_10004390 3300027907 Bacteria 13448
367 Ga0268266_10199227 3300028379 Bacteria 1832
368 Ga0268265_10012750 3300028380 Bacteria 5706
369 Ga0268265_10091506 3300028380 Bacteria 2432
370 Ga0268265_10369085 3300028380 Bacteria 1317
371 Ga0268265_10390014 3300028380 Bacteria 1284
372 Ga0268265_10391207 3300028380 Bacteria 1282
373 Ga0268264_10000002 3300028381 Bacteria 1153045
374 Ga0268264_10030450 3300028381 Bacteria 4423
375 Ga0268264_10175604 3300028381 Bacteria 1941
376 Ga0268264_10229945 3300028381 Bacteria 1712
377 Ga0268264_10520743 3300028381 Bacteria 1162
378 Ga0307515_10241717 3300028794 Bacteria 1575
379 Ga0265338_10002383 3300028800 Bacteria 28312
380 Ga0265338_10202631 3300028800 Bacteria 1495
381 Ga0265330_10044845 3300031235 Bacteria 1951
382 Ga0265325_10003200 3300031241 Bacteria 10768
383 Ga0265340_10002852 3300031247 Bacteria 9840
384 Ga0265339_10009226 3300031249 Bacteria 6221
385 Ga0265339_10062634 3300031249 Bacteria 1999
386 Ga0265331_10029140 3300031250 Bacteria 2757
387 Ga0265316_10073557 3300031344 Bacteria 2632
388 Ga0307513_10074728 3300031456 Bacteria 3523
389 Ga0265313_10042283 3300031595 Bacteria 2239
390 Ga0265314_10018256 3300031711 Bacteria 5475
391 Ga0307518_10028846 3300031838 Bacteria 4009
392 Ga0307510_10058345 3300033180 Bacteria 3997
393 Ga0373938_0021468 3300034957 Bacteria 1309
394 Ga0373928_0053585 3300035084 Bacteria 959
395 Ga0373934_0013500 3300035086 Bacteria 3089
396 Ga0373940_0124517 3300035088 Bacteria 802
397 Ga0373932_0013535 3300035112 Bacteria 2032
398 Ga0373954_0280989 3300035118 Bacteria 820
399 Ga0373956_0015317 3300035119 Bacteria 3209
400 Ga0373957_0064603 3300035120 Bacteria 1423
401 Ga0373931_0033436 3300035691 Bacteria 2664
402 Ga0373931_0052020 3300035691 Bacteria 2183
403 Ga0373933_0011228 3300035724 Bacteria 4930
404 Ga0373937_0035571 3300036401 Bacteria 4534
405 Ga0395899_0172247 3300037312 Bacteria 1524
406 Ga0395900_0169304 3300037418 Bacteria 2225
407 Ga0395900_0393222 3300037418 Bacteria 1352
408 Ga0395905_0032253 3300037471 Bacteria 4927
409 Ga0395901_0179261 3300038443 Bacteria 2222
410 Ga0436365_0664817 3300039437 Bacteria 3144
411 Ga0436360_0120418 3300039438 Bacteria 900
412 Ga0436363_0458370 3300039450 Bacteria 995
413 Ga0436363_0920203 3300039450 Bacteria 2287
414 Ga0436362_0153170 3300039453 Bacteria 694
415 Ga0451833_1170682 3300041491 Bacteria 2135
416 Ga0439464_0060682 3300042439 Bacteria 1107
417 Ga0495603_0028976 3300046455 Bacteria 3340
418 Ga0495651_0019365 3300046462 Bacteria 5275
419 Ga0495580_0011920 3300046472 Bacteria 6699
420 Ga0495580_0014242 3300046472 Bacteria 6037
421 Ga0495580_0211372 3300046472 Bacteria 1335
422 Ga0495580_0233782 3300046472 Bacteria 1261
423 Ga0495662_0018303 3300046476 Bacteria 3390
424 Ga0495664_0001058 3300046477 Bacteria 14209
425 Ga0495664_0135501 3300046477 Bacteria 1492
426 Ga0495585_0049027 3300046492 Bacteria 2347
427 Ga0495585_0081418 3300046492 Bacteria 1754
428 Ga0495594_0002576 3300046499 Bacteria 9428
429 Ga0495607_0318338 3300046501 Bacteria 727
430 Ga0495583_0001124 3300046506 Bacteria 29443
431 Ga0495608_0049220 3300046511 Bacteria 2798
432 Ga0495618_0045118 3300046514 Bacteria 2780
433 Ga0495620_0128348 3300046515 Bacteria 996
434 Ga0495628_0012616 3300046516 Bacteria 7119
435 Ga0495630_0036184 3300046517 Bacteria 3691
436 Ga0495630_0499416 3300046517 Bacteria 933
437 Ga0495643_0090437 3300046522 Bacteria 1580
438 Ga0495644_0160787 3300046523 Bacteria 861
439 Ga0495648_0094905 3300046524 Bacteria 1661
440 Ga0495666_0018725 3300046526 Bacteria 3441
441 Ga0495652_0028500 3300046529 Bacteria 4913
442 Ga0495586_0391099 3300046535 Bacteria 800
443 Ga0495587_0031768 3300046536 Bacteria 3195
444 Ga0495622_0075289 3300046557 Bacteria 1556
445 Ga0495667_0009893 3300046559 Bacteria 6458
446 Ga0495667_0323605 3300046559 Bacteria 975
447 Ga0495668_0084088 3300046616 Bacteria 1745
448 Ga0495634_0022396 3300046642 Bacteria 4451
449 Ga0495625_0034781 3300046660 Bacteria 3717
450 Ga0495625_0110132 3300046660 Bacteria 1883
451 Ga0495625_0573719 3300046660 Bacteria 680
452 Ga0495635_0041450 3300046663 Bacteria 3179
453 Ga0495635_0131796 3300046663 Bacteria 1704
454 Ga0495661_0163975 3300046665 Bacteria 1191
455 Ga0495657_0006712 3300046675 Bacteria 8976
456 Ga0495599_0027348 3300046678 Bacteria 3575
457 Ga0495599_0029420 3300046678 Bacteria 3444
458 Ga0495623_0028050 3300046679 Bacteria 3624
459 Ga0495646_0031828 3300046680 Bacteria 3285
460 Ga0495669_0002028 3300046684 Bacteria 8305
461 Ga0495669_0150444 3300046684 Bacteria 1101
462 Ga0495613_0039822 3300046689 Bacteria 3482
463 Ga0495670_0000028 3300046691 Bacteria 90085
464 Ga0495671_0131071 3300046692 Bacteria 1223
465 Ga0495600_0108355 3300046809 Bacteria 1809
466 Ga0495604_0026671 3300047317 Bacteria 4598
467 Ga0495604_0030653 3300047317 Bacteria 4270
468 Ga0495604_0068169 3300047317 Bacteria 2701
469 Ga0495674_0070155 3300047319 Bacteria 3028
470 Ga0495674_0103471 3300047319 Bacteria 2421
471 Ga0495674_0741001 3300047319 Bacteria 768
472 Ga0495676_0003557 3300047321 Bacteria 14129
473 Ga0495680_0015133 3300047322 Bacteria 6662
474 Ga0495680_0021217 3300047322 Bacteria 5442
475 Ga0495675_0006355 3300047444 Bacteria 7230
476 Ga0495675_0040752 3300047444 Bacteria 2960
477 Ga0495684_0020272 3300047471 Bacteria 5123
478 Ga0495593_0069215 3300047673 Bacteria 1836
479 Ga0495602_0039540 3300048088 Bacteria 4341
480 Ga0495602_0546646 3300048088 Bacteria 803
481 Ga0495614_0002517 3300048089 Bacteria 8139
482 Ga0496100_0046285 3300048903 Bacteria 2796
483 Ga0496100_0113503 3300048903 Bacteria 1886
484 Ga0496101_0080288 3300048904 Bacteria 2409
485 Ga0496101_0080682 3300048904 Bacteria 2404
486 Ga0496101_0283985 3300048904 Bacteria 1294
487 Ga0496102_0018239 3300048905 Bacteria 6163
488 Ga0496102_0018536 3300048905 Bacteria 6117
489 Ga0496102_0052115 3300048905 Bacteria 3727
490 Ga0496102_0350630 3300048905 Bacteria 1389
491 Ga0496103_0011391 3300048906 Bacteria 5268
492 Ga0496103_0014394 3300048906 Bacteria 4697
493 Ga0496103_0016224 3300048906 Bacteria 4444
494 Ga0496103_0035917 3300048906 Bacteria 3034
495 Ga0496103_0487925 3300048906 Bacteria 789
496 Ga0496104_0020755 3300048907 Bacteria 6025
497 Ga0496104_0468637 3300048907 Bacteria 1171
498 Ga0496104_0926077 3300048907 Bacteria 776
499 Ga0496106_0008735 3300048909 Bacteria 7491
500 Ga0496106_0078152 3300048909 Bacteria 2538
501 Ga0496106_0275615 3300048909 Bacteria 1347
502 Ga0496106_0761128 3300048909 Bacteria 770
503 Ga0496107_0056398 3300048910 Bacteria 2838
504 Ga0496108_0030261 3300048911 Bacteria 4487
505 Ga0496108_0066590 3300048911 Bacteria 3038
506 Ga0496109_0005078 3300048912 Bacteria 10996
507 Ga0496109_0964060 3300048912 Bacteria 791
508 Ga0496110_0034834 3300048913 Bacteria 4364
509 Ga0496110_0306432 3300048913 Bacteria 1447
510 Ga0496110_0333204 3300048913 Bacteria 1383
511 Ga0496112_0045593 3300048915 Bacteria 4298
512 Ga0496112_0114544 3300048915 Bacteria 2667
513 Ga0496112_0508496 3300048915 Bacteria 1140
514 Ga0496113_0561763 3300048916 Bacteria 915
515 Ga0496114_0008728 3300048917 Bacteria 8032
516 Ga0496114_0064840 3300048917 Bacteria 3060
517 Ga0496114_0211308 3300048917 Bacteria 1702
518 Ga0496114_0386336 3300048917 Unclassified 1239
519 Ga0501301_001319 3300049524 Bacteria 1554
520 Ga0501039_0638968 3300049575 Bacteria 833
521 Ga0501042_0247171 3300049578 Bacteria 1287
522 Ga0501072_0451332 3300049588 Bacteria 1018
523 Ga0501075_0180392 3300049591 Bacteria 1611
524 Ga0501076_0421580 3300049592 Bacteria 1098
525 Ga0501257_042745 3300049686 Bacteria 1115
526 Ga0501221_000235 3300049704 Bacteria 7984
527 Ga0501081_0061494 3300049743 Bacteria 2604
528 Ga0501278_005070 3300049774 Bacteria 962
529 nmdc:mga05p37_512130_c1 3300050507 Bacteria 1374
530 nmdc:mga05p37_645547_c1 3300050507 Bacteria 1186
531 nmdc:mga09592_264430_c1 3300050508 Bacteria 1492
532 nmdc:mga0qj67_60306_c1 3300050509 Bacteria 3010
533 nmdc:mga0qj67_7808_c1 3300050509 Bacteria 7907
534 nmdc:mga06r32_104061_c1 3300050510 Bacteria 2788
535 nmdc:mga08y16_65120_c1 3300050511 Bacteria 3805
536 nmdc:mga08y16_81665_c1 3300050511 Bacteria 3370
537 nmdc:mga0n895_5597_c1 3300050512 Bacteria 10517
538 Ga0500610_0010890 3300053079 Bacteria 4115
539 Ga0500635_0004342 3300053080 Bacteria 3647
540 Ga0500554_034370 3300053102 Bacteria 1517
541 Ga0500573_0234571 3300053140 Bacteria 954
542 Ga0500590_122148 3300053148 Bacteria 1219
543 Ga0500603_001023 3300053150 Bacteria 6583
544 Ga0500634_0173758 3300053161 Bacteria 978
545 Ga0500637_0064304 3300053178 Bacteria 2104
546 Ga0500596_003472 3300053735 Bacteria 2991
547 Ga0501082_0383636 3300060353 Bacteria 1226
548 2585228071 2582581299 Bacteria 6518058
549 2644192237 2643221634 Bacteria 6705461
550 2776261026 2775506901 Bacteria 9631051
551 8056377440 8056375014 Bacteria 7006639
552 Ga0068852_100296696
553 JGI24746J21847_1005033
554 JGI24747J21853_1005702
555 JGI24738J21930_10010015
556 Ga0058861_11994443
557 Ga0070676_10010247
558 Ga0070676_10146200
559 Ga0070676_10542523
560 Ga0070683_100006753
561 Ga0070690_100002486
562 Ga0070670_100005543
563 Ga0070670_100064004
564 Ga0070670_100151272
565 Ga0070670_100267084
566 Ga0068869_100048761
567 Ga0070666_10670059
568 Ga0070680_100004377
569 Ga0070680_100110753
570 Ga0070680_100293152
571 Ga0070680_100364722
572 Ga0070682_100003912
573 Ga0070682_100040286
574 Ga0070682_100067848
575 Ga0068868_100162434
576 Ga0070660_100003480
577 Ga0070660_100266503
578 Ga0070689_100385417
579 Ga0070689_100416474
580 Ga0070689_100514426
581 Ga0070691_10034247
582 Ga0070691_10220930
583 Ga0070691_10348579
584 Ga0070687_100003077
585 Ga0070661_100005996
586 Ga0070661_100826254
587 Ga0070668_100066143
588 Ga0070668_100092929
589 Ga0070668_100178207
590 Ga0070668_100223921
591 Ga0070668_100271667
592 Ga0070668_100460798
593 Ga0070669_100004234
594 Ga0070669_100086435
595 Ga0070675_100004596
596 Ga0070675_100292155
597 Ga0070675_100693606
598 Ga0070671_100007607
599 Ga0070671_100055786
600 Ga0070671_100107886
601 Ga0070671_100136866
602 Ga0070674_100070228
603 Ga0070674_100079221
604 Ga0070674_100092817
605 Ga0070674_100883959
606 Ga0070673_100003318
607 Ga0070673_100234996
608 Ga0070659_100100423
609 Ga0070659_100567733
610 Ga0070667_100018157
611 Ga0070667_100022536
612 Ga0070667_100931723
613 Ga0070703_10000279
614 Ga0070709_10002013
615 Ga0070701_10005710
616 Ga0070705_100002546
617 Ga0070705_100055170
618 Ga0070705_100278982
619 Ga0070700_100009050
620 Ga0070700_100015267
621 Ga0070700_100799084
622 Ga0070694_100073765
623 Ga0070663_100009057
624 Ga0070663_100086224
625 Ga0070678_100041286
626 Ga0070678_101024717
627 Ga0070662_100002364
628 Ga0070662_100016144
629 Ga0070662_100327544
630 Ga0070662_100609651
631 Ga0070681_10007934
632 Ga0070681_10352561
633 Ga0068867_100028777
634 Ga0070706_100541201
635 Ga0070707_100144962
636 Ga0070679_100023489
637 Ga0070679_100024574
638 Ga0070679_100149756
639 Ga0070679_101041701
640 Ga0070684_100009321
641 Ga0068853_100046987
642 Ga0068853_100150994
643 Ga0070672_100007399
644 Ga0070672_100952617
645 Ga0070686_100066602
646 Ga0070695_100066859
647 Ga0070696_100020813
648 Ga0070696_100089912
649 Ga0070693_100271831
650 Ga0070693_100663826
651 Ga0070665_100518683
652 Ga0070704_100059379
653 Ga0068855_100020929
654 Ga0070664_100061799
655 Ga0070664_100084631
656 Ga0070664_100250204
657 Ga0070664_101068844
658 Ga0068857_100006093
659 Ga0068857_100493123
660 Ga0068854_100000227
661 Ga0068854_100002230
662 Ga0068854_100038340
663 Ga0068854_100178311
664 Ga0068854_100503734
665 Ga0068854_100843832
666 Ga0068856_100062715
667 Ga0068856_100463608
668 Ga0070702_100015554
669 Ga0070702_100223240
670 Ga0068852_100076432
671 Ga0068852_100224803
672 Ga0068859_100005469
673 Ga0068859_100023559
674 Ga0068859_100072730
675 Ga0068859_100095536
676 Ga0068864_100005847
677 Ga0068864_100025170
678 Ga0068864_100372306
679 Ga0068864_100498918
680 Ga0068866_10001457
681 Ga0068866_10006831
682 Ga0068861_100012037
683 Ga0068861_100156790
684 Ga0068851_10040583
685 Ga0068870_10002196
686 Ga0068870_10030863
687 Ga0068863_100101059
688 Ga0068863_100108704
689 Ga0068863_100311954
690 Ga0068863_101267235
691 Ga0068858_100066247
692 Ga0068860_100000100
693 Ga0068860_100001527
694 Ga0068860_100006873
695 Ga0068860_100360723
696 Ga0068860_101261534
697 Ga0068862_100149968
698 Ga0068862_100280623
699 Ga0068862_100451075
700 Ga0068862_100502769
701 Ga0068862_101192522
702 Ga0081538_10058104
703 Ga0070717_10413995
704 Ga0097621_100008446
705 Ga0097621_100111094
706 Ga0097621_100151571
707 Ga0068871_100002484
708 Ga0068871_100018474
709 Ga0068871_100382986
710 Ga0068871_100670198
711 Ga0068871_100814913
712 Ga0075428_100018088
713 Ga0075430_100002761
714 Ga0075431_100059305
715 Ga0075431_100100313
716 Ga0075434_100018256
717 Ga0075429_100381160
718 Ga0068865_100008910
719 Ga0068865_100038004
720 Ga0068865_100129716
721 Ga0068865_100135975
722 Ga0097620_100005469
723 Ga0097620_100023559
724 Ga0097620_100072727
725 Ga0097620_100095540
726 Ga0105244_10140528
727 Ga0105240_10111937
728 Ga0105240_10112266
729 Ga0105240_10175612
730 Ga0105240_10224656
731 Ga0105240_10440225
732 Ga0105240_10546666
733 Ga0111539_10146798
734 Ga0111539_10170744
735 Ga0111539_10184041
736 Ga0105245_10004456
737 Ga0105245_10015490
738 Ga0105245_10107049
739 Ga0105245_10250744
740 Ga0105245_10309841
741 Ga0105247_10030577
742 Ga0114129_10289734
743 Ga0105243_10013000
744 Ga0105243_10016303
745 Ga0105243_10019496
746 Ga0105243_11218524
747 Ga0105241_10000382
748 Ga0105241_10175042
749 Ga0105242_10020060
750 Ga0105242_10049706
751 Ga0105248_10048980
752 Ga0105248_10311167
753 Ga0105248_10587102
754 Ga0105237_10147996
755 Ga0105237_10155669
756 Ga0105238_10000694
757 Ga0105238_10228166
758 Ga0105238_10399428
759 Ga0105238_10737233
760 Ga0105249_10089826
761 Ga0105249_10090128
762 Ga0105239_10007327
763 Ga0105239_10030907
764 Ga0105239_10122763
765 Ga0105239_10135870
766 Ga0105246_10022278
767 Ga0105246_10028259
768 Ga0157339_1001760
769 Ga0157324_1005712
770 Ga0157326_1001969
771 Ga0157326_1010757
772 Ga0157369_10001748
773 Ga0157374_10005126
774 Ga0157374_10164378
775 Ga0157378_10003468
776 Ga0157378_10005460
777 Ga0157378_10127255
778 Ga0157378_10884455
779 Ga0163162_10023944
780 Ga0163162_10028652
781 Ga0163162_10066205
782 Ga0163162_10112838
783 Ga0163162_10138873
784 Ga0157372_10019331
785 Ga0157372_10029612
786 Ga0157372_10030483
787 Ga0157372_10227601
788 Ga0157375_10004520
789 Ga0157375_10014067
790 Ga0157375_10057878
791 Ga0157375_10127330
792 Ga0157375_10346487
793 Ga0157375_10579971
794 Ga0163163_10071189
795 Ga0163163_10170133
796 Ga0163163_10331287
797 Ga0157380_10023306
798 Ga0157380_10057518
799 Ga0157380_10079222
800 Ga0157380_10186394
801 Ga0157380_10194836
802 Ga0157380_10294481
803 Ga0157377_10005921
804 Ga0157379_10009945
805 Ga0157379_10095250
806 Ga0157379_10298728
807 Ga0157376_10094438
808 Ga0157376_10097578
809 Ga0157376_10633274
810 Ga0157376_10654153
811 Ga0163161_10104295
812 Ga0163161_10238729
813 Ga0163161_10365469
814 Ga0213876_10233265
815 Ga0207673_1000199
816 Ga0207426_1019535
817 Ga0207656_10023152
818 Ga0207682_10068053
819 Ga0207688_10049147
820 Ga0207680_10071710
821 Ga0207647_10002513
822 Ga0207643_10000170
823 Ga0207654_10000034
824 Ga0207707_10006812
825 Ga0207695_10166521
826 Ga0207695_10385910
827 Ga0207671_10098104
828 Ga0207671_10402687
829 Ga0207660_10022481
830 Ga0207660_10245953
831 Ga0207649_10001009
832 Ga0207652_10019036
833 Ga0207646_10196668
834 Ga0207681_10011248
835 Ga0207694_10001096
836 Ga0207694_10540912
837 Ga0207650_10006724
838 Ga0207650_10076847
839 Ga0207659_10003950
840 Ga0207659_10081867
841 Ga0207687_10071386
842 Ga0207687_10431040
843 Ga0207687_10727356
844 Ga0207644_10002334
845 Ga0207644_10007715
846 Ga0207644_10085139
847 Ga0207690_10004193
848 Ga0207690_10071832
849 Ga0207690_10356034
850 Ga0207706_10016939
851 Ga0207706_10017759
852 Ga0207706_10194272
853 Ga0207686_10016043
854 Ga0207686_10024867
855 Ga0207686_10172791
856 Ga0207709_10005222
857 Ga0207709_10020056
858 Ga0207709_10087447
859 Ga0207670_10230348
860 Ga0207670_10446621
861 Ga0207669_10003055
862 Ga0207669_10083341
863 Ga0207669_10107178
864 Ga0207669_10692277
865 Ga0207704_10005651
866 Ga0207704_10489471
867 Ga0207711_10028641
868 Ga0207711_10500720
869 Ga0207689_10406188
870 Ga0207661_10000500
871 Ga0207679_10000073
872 Ga0207651_10022425
873 Ga0207651_10043476
874 Ga0207712_10117143
875 Ga0207668_10052950
876 Ga0207668_10107739
877 Ga0207668_10270994
878 Ga0207668_10453877
879 Ga0207668_10482539
880 Ga0207640_10000226
881 Ga0207640_10002746
882 Ga0207640_10060231
883 Ga0207640_10143573
884 Ga0207640_10638597
885 Ga0207658_10007054
886 Ga0207677_10056797
887 Ga0207677_10066452
888 Ga0207639_10021608
889 Ga0207639_10035019
890 Ga0207678_10003681
891 Ga0207678_10098691
892 Ga0207708_10051473
893 Ga0207708_10377506
894 Ga0207708_10484907
895 Ga0207702_10257438
896 Ga0207702_10516767
897 Ga0207641_10093444
898 Ga0207641_10133072
899 Ga0207641_10399550
900 Ga0207648_10677233
901 Ga0207648_11354341
902 Ga0207676_10006169
903 Ga0207676_10452000
904 Ga0207676_10644314
905 Ga0207674_10003682
906 Ga0207674_10005059
907 Ga0207674_10721107
908 Ga0207675_100026081
909 Ga0207675_100035528
910 Ga0207675_100243399
911 Ga0207675_100959073
912 Ga0207683_10051962
913 Ga0207683_10230841
914 Ga0207683_10648233
915 Ga0209971_1014353
916 Ga0209998_10002260
917 Ga0207428_10004390
918 Ga0268266_10199227
919 Ga0268265_10012750
920 Ga0268265_10091506
921 Ga0268265_10369085
922 Ga0268265_10390014
923 Ga0268265_10391207
924 Ga0268264_10000002
925 Ga0268264_10030450
926 Ga0268264_10175604
927 Ga0268264_10229945
928 Ga0268264_10520743
929 Ga0307515_10241717
930 Ga0265338_10002383
931 Ga0265338_10202631
932 Ga0265330_10044845
933 Ga0265325_10003200
934 Ga0265340_10002852
935 Ga0265339_10009226
936 Ga0265339_10062634
937 Ga0265331_10029140
938 Ga0265316_10073557
939 Ga0307513_10074728
940 Ga0265313_10042283
941 Ga0265314_10018256
942 Ga0307518_10028846
943 Ga0307510_10058345
944 Ga0373938_0021468
945 Ga0373928_0053585
946 Ga0373934_0013500
947 Ga0373940_0124517
948 Ga0373932_0013535
949 Ga0373954_0280989
950 Ga0373956_0015317
951 Ga0373957_0064603
952 Ga0373931_0033436
953 Ga0373931_0052020
954 Ga0373933_0011228
955 Ga0373937_0035571
956 Ga0395899_0172247
957 Ga0395900_0169304
958 Ga0395900_0393222
959 Ga0395905_0032253
960 Ga0395901_0179261
961 Ga0436365_0664817
962 Ga0436360_0120418
963 Ga0436363_0458370
964 Ga0436363_0920203
965 Ga0436362_0153170
966 Ga0451833_1170682
967 Ga0439464_0060682
968 Ga0495603_0028976
969 Ga0495651_0019365
970 Ga0495580_0011920
971 Ga0495580_0014242
972 Ga0495580_0211372
973 Ga0495580_0233782
974 Ga0495662_0018303
975 Ga0495664_0001058
976 Ga0495664_0135501
977 Ga0495585_0049027
978 Ga0495585_0081418
979 Ga0495594_0002576
980 Ga0495607_0318338
981 Ga0495583_0001124
982 Ga0495608_0049220
983 Ga0495618_0045118
984 Ga0495620_0128348
985 Ga0495628_0012616
986 Ga0495630_0036184
987 Ga0495630_0499416
988 Ga0495643_0090437
989 Ga0495644_0160787
990 Ga0495648_0094905
991 Ga0495666_0018725
992 Ga0495652_0028500
993 Ga0495586_0391099
994 Ga0495587_0031768
995 Ga0495622_0075289
996 Ga0495667_0009893
997 Ga0495667_0323605
998 Ga0495668_0084088
999 Ga0495634_0022396
1000 Ga0495625_0034781
1001 Ga0495625_0110132
1002 Ga0495625_0573719
1003 Ga0495635_0041450
1004 Ga0495635_0131796
1005 Ga0495661_0163975
1006 Ga0495657_0006712
1007 Ga0495599_0027348
1008 Ga0495599_0029420
1009 Ga0495623_0028050
1010 Ga0495646_0031828
1011 Ga0495669_0002028
1012 Ga0495669_0150444
1013 Ga0495613_0039822
1014 Ga0495670_0000028
1015 Ga0495671_0131071
1016 Ga0495600_0108355
1017 Ga0495604_0026671
1018 Ga0495604_0030653
1019 Ga0495604_0068169
1020 Ga0495674_0070155
1021 Ga0495674_0103471
1022 Ga0495674_0741001
1023 Ga0495676_0003557
1024 Ga0495680_0015133
1025 Ga0495680_0021217
1026 Ga0495675_0006355
1027 Ga0495675_0040752
1028 Ga0495684_0020272
1029 Ga0495593_0069215
1030 Ga0495602_0039540
1031 Ga0495602_0546646
1032 Ga0495614_0002517
1033 Ga0496100_0046285
1034 Ga0496100_0113503
1035 Ga0496101_0080288
1036 Ga0496101_0080682
1037 Ga0496101_0283985
1038 Ga0496102_0018239
1039 Ga0496102_0018536
1040 Ga0496102_0052115
1041 Ga0496102_0350630
1042 Ga0496103_0011391
1043 Ga0496103_0014394
1044 Ga0496103_0016224
1045 Ga0496103_0035917
1046 Ga0496103_0487925
1047 Ga0496104_0020755
1048 Ga0496104_0468637
1049 Ga0496104_0926077
1050 Ga0496106_0008735
1051 Ga0496106_0078152
1052 Ga0496106_0275615
1053 Ga0496106_0761128
1054 Ga0496107_0056398
1055 Ga0496108_0030261
1056 Ga0496108_0066590
1057 Ga0496109_0005078
1058 Ga0496109_0964060
1059 Ga0496110_0034834
1060 Ga0496110_0306432
1061 Ga0496110_0333204
1062 Ga0496112_0045593
1063 Ga0496112_0114544
1064 Ga0496112_0508496
1065 Ga0496113_0561763
1066 Ga0496114_0008728
1067 Ga0496114_0064840
1068 Ga0496114_0211308
1069 Ga0496114_0386336
1070 Ga0501301_001319
1071 Ga0501039_0638968
1072 Ga0501042_0247171
1073 Ga0501072_0451332
1074 Ga0501075_0180392
1075 Ga0501076_0421580
1076 Ga0501257_042745
1077 Ga0501221_000235
1078 Ga0501081_0061494
1079 Ga0501278_005070
1080 nmdc:mga05p37_512130_c1
1081 nmdc:mga05p37_645547_c1
1082 nmdc:mga09592_264430_c1
1083 nmdc:mga0qj67_60306_c1
1084 nmdc:mga0qj67_7808_c1
1085 nmdc:mga06r32_104061_c1
1086 nmdc:mga08y16_65120_c1
1087 nmdc:mga08y16_81665_c1
1088 nmdc:mga0n895_5597_c1
1089 Ga0500610_0010890
1090 Ga0500635_0004342
1091 Ga0500554_034370
1092 Ga0500573_0234571
1093 Ga0500590_122148
1094 Ga0500603_001023
1095 Ga0500634_0173758
1096 Ga0500637_0064304
1097 Ga0500596_003472
1098 Ga0501082_0383636
1099 2585228071
1100 2644192237
1101 2776261026
1102 8056377440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

50

84

0.89

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

50

151

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8316 6 143
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.83 1 144
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8251 6 143
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8223 2 143
5uhj-assembly2.cif.gz_B-3 the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 0.8198 4 141
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.831 6 143 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8244 6 143 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8209 6 141 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8094 3 143 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7974 3 143 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A521LQ03-F1-model_v4 Glyoxalase 0.9653 3 87
AF-A0A4R7ZXV9-F1-model_v4 Muconolactone delta-isomerase 0.9632 4 152 GO:0016853
AF-A0A7V8KJD4-F1-model_v4 deleted 0.9586 1 72
AF-A0A659YM85-F1-model_v4 deleted 0.955 1 78
AF-A0A7W8C6X0-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9548 3 144 GO:0016829
GO:0051213

Map