F462549

General Info

Members Datasets Scaffolds Average Seq Length
550 324 1100 231

Family's Representative Sequence

Representative Sequence 3300053083|Ga0495655_0018516|Ga0495655_0018516_322_1128
Length 268
Sequence MERKKDSIADQTLSKRAGTVMQVSIHPENLRGNESSAMSVSPVSIHTLDHPIWTALTTRQQALAEGGTLARRYPTAIAPFADMADMSAQSFAALGTLMLPSEIAVLFTPDAVTAPDAFKVLLAETGEQMIGAPVEASVRGVEAVTLGADDVPEMMELTALTKPGPFSERTHELGTFLGVRIDGQLVAMTGERMKPGNYTEMTAVCVHPSHRGRGYGQLLLGSVSRQILARGEIPFLHVFTNNESAIALYKRQGMEIRRRFHVTVLQKL

Samples

Sample ID Description Type Environment
1 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
244 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
283 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
286 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
287 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
288 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
289 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
290 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
291 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
292 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
293 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
294 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
295 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
296 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
297 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
298 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
299 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
300 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
301 2791355199
302 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
303 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
304 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
305 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
306 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
307 2906610324
308 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
309 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
310 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
311 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
312 2922425934
313 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
314 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
315 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
316 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
317 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
318 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
319 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
320 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
321 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
322 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
323 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
324 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.33
Metatranscriptomes 0
Isolates 5.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 4.36
Rhizoplane 9.27
Rhizosphere 74.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495655_0018516 3300053083 Bacteria 1532
2 MBSR1b_contig_5843879 2162886012 Bacteria 1325
3 rootL2_10309054 3300003322 Bacteria 1106
4 Ga0070690_100073547 3300005330 Bacteria 2224
5 Ga0070690_100411227 3300005330 Bacteria 995
6 Ga0068869_100007011 3300005334 Bacteria 7176
7 Ga0068869_100021259 3300005334 Bacteria 4462
8 Ga0068869_100047250 3300005334 Bacteria 3108
9 Ga0070680_100001711 3300005336 Bacteria 16114
10 Ga0070682_100512959 3300005337 Bacteria 931
11 Ga0070682_100864854 3300005337 Bacteria 740
12 Ga0068868_100045833 3300005338 Bacteria 3421
13 Ga0068868_100063863 3300005338 Bacteria 2921
14 Ga0070660_100002257 3300005339 Bacteria 13236
15 Ga0070691_10250144 3300005341 Bacteria 950
16 Ga0070687_100133504 3300005343 Bacteria 1436
17 Ga0070661_100040715 3300005344 Bacteria 3391
18 Ga0070661_100378331 3300005344 Bacteria 1116
19 Ga0070668_100018694 3300005347 Bacteria 5203
20 Ga0070668_100226366 3300005347 Bacteria 1544
21 Ga0070669_100633181 3300005353 Bacteria 898
22 Ga0070671_100094186 3300005355 Bacteria 2510
23 Ga0070671_100155905 3300005355 Bacteria 1929
24 Ga0070671_100181213 3300005355 Bacteria 1783
25 Ga0070674_100117558 3300005356 Bacteria 1963
26 Ga0070673_100585220 3300005364 Bacteria 1017
27 Ga0070659_100066029 3300005366 Bacteria 2866
28 Ga0070659_100224050 3300005366 Bacteria 1553
29 Ga0070667_100553416 3300005367 Bacteria 1057
30 Ga0070709_10008606 3300005434 Bacteria 5611
31 Ga0070714_100182709 3300005435 Bacteria 1909
32 Ga0070714_100285449 3300005435 Bacteria 1534
33 Ga0070713_100031899 3300005436 Bacteria 4202
34 Ga0070710_10014167 3300005437 Bacteria 4007
35 Ga0070711_100822705 3300005439 Bacteria 789
36 Ga0070700_100398826 3300005441 Bacteria 1034
37 Ga0070708_100191970 3300005445 Bacteria 1910
38 Ga0070663_100009816 3300005455 Bacteria 5947
39 Ga0070663_100051996 3300005455 Bacteria 2921
40 Ga0070678_100063481 3300005456 Bacteria 2733
41 Ga0070678_100079489 3300005456 Bacteria 2481
42 Ga0070678_100272724 3300005456 Bacteria 1427
43 Ga0070662_100240181 3300005457 Bacteria 1453
44 Ga0070662_100348590 3300005457 Bacteria 1213
45 Ga0070681_10004759 3300005458 Bacteria 13009
46 Ga0070681_10215167 3300005458 Bacteria 1838
47 Ga0070681_10262667 3300005458 Bacteria 1638
48 Ga0068867_100092193 3300005459 Bacteria 2301
49 Ga0070706_100442432 3300005467 Bacteria 1210
50 Ga0070698_100178503 3300005471 Bacteria 2062
51 Ga0070698_100568796 3300005471 Bacteria 1073
52 Ga0070699_100371082 3300005518 Bacteria 1291
53 Ga0070699_100571695 3300005518 Bacteria 1030
54 Ga0070679_100054750 3300005530 Bacteria 3973
55 Ga0070684_100014817 3300005535 Bacteria 6326
56 Ga0070684_100113299 3300005535 Bacteria 2434
57 Ga0068853_100012584 3300005539 Bacteria 6883
58 Ga0068853_100199877 3300005539 Bacteria 1819
59 Ga0068853_100252441 3300005539 Bacteria 1619
60 Ga0068853_100480559 3300005539 Bacteria 1171
61 Ga0068853_100483136 3300005539 Bacteria 1168
62 Ga0068853_100559770 3300005539 Bacteria 1084
63 Ga0070672_100041370 3300005543 Bacteria 3543
64 Ga0070672_100157831 3300005543 Bacteria 1880
65 Ga0070672_100269662 3300005543 Bacteria 1437
66 Ga0070686_100017315 3300005544 Bacteria 4210
67 Ga0070695_100106314 3300005545 Bacteria 1897
68 Ga0070665_100024005 3300005548 Bacteria 6140
69 Ga0070665_100046153 3300005548 Bacteria 4377
70 Ga0070665_100080839 3300005548 Bacteria 3256
71 Ga0068855_100035959 3300005563 Bacteria 5897
72 Ga0068855_100137233 3300005563 Bacteria 2789
73 Ga0068857_100003968 3300005577 Bacteria 12457
74 Ga0068857_100306016 3300005577 Bacteria 1466
75 Ga0068857_100349068 3300005577 Bacteria 1370
76 Ga0068854_100032236 3300005578 Bacteria 3644
77 Ga0068854_100097720 3300005578 Bacteria 2196
78 Ga0068854_100278724 3300005578 Bacteria 1345
79 Ga0068856_100001367 3300005614 Bacteria 25662
80 Ga0068856_100460356 3300005614 Bacteria 1293
81 Ga0068856_101021613 3300005614 Bacteria 845
82 Ga0070702_100609530 3300005615 Bacteria 820
83 Ga0068852_100112462 3300005616 Bacteria 2478
84 Ga0068852_100208775 3300005616 Bacteria 1851
85 Ga0068852_100494664 3300005616 Bacteria 1217
86 Ga0068859_100134706 3300005617 Bacteria 2542
87 Ga0068859_100502475 3300005617 Bacteria 1308
88 Ga0068866_10028877 3300005718 Bacteria 2647
89 Ga0068866_10052462 3300005718 Bacteria 2081
90 Ga0068866_10204035 3300005718 Bacteria 1183
91 Ga0068861_100180099 3300005719 Bacteria 1758
92 Ga0068851_10012140 3300005834 Bacteria 4056
93 Ga0068870_10120614 3300005840 Bacteria 1510
94 Ga0068863_100326371 3300005841 Bacteria 1492
95 Ga0068863_100381100 3300005841 Bacteria 1377
96 Ga0068858_100124019 3300005842 Bacteria 2418
97 Ga0068858_100459985 3300005842 Bacteria 1227
98 Ga0068860_100126116 3300005843 Bacteria 2454
99 Ga0068862_100096883 3300005844 Bacteria 2575
100 Ga0068862_100103338 3300005844 Bacteria 2495
101 Ga0068862_100223722 3300005844 Bacteria 1705
102 Ga0081455_10016791 3300005937 Bacteria 7044
103 Ga0081540_1000979 3300005983 Bacteria 25757
104 Ga0081540_1001476 3300005983 Bacteria 20290
105 Ga0081540_1083818 3300005983 Bacteria 1425
106 Ga0081540_1133784 3300005983 Bacteria 1007
107 Ga0081539_10010267 3300005985 Bacteria 7648
108 Ga0070717_10015592 3300006028 Bacteria 5873
109 Ga0070717_10241078 3300006028 Bacteria 1594
110 Ga0075365_10028202 3300006038 Bacteria 3579
111 Ga0075365_10299540 3300006038 Bacteria 1131
112 Ga0075363_100033607 3300006048 Bacteria 2672
113 Ga0075364_10297787 3300006051 Bacteria 1098
114 Ga0070716_100627102 3300006173 Bacteria 812
115 Ga0070712_100094127 3300006175 Bacteria 2201
116 Ga0070712_100226363 3300006175 Bacteria 1483
117 Ga0075362_10283163 3300006177 Bacteria 820
118 Ga0075367_10154791 3300006178 Bacteria 1424
119 Ga0075367_10349232 3300006178 Bacteria 933
120 Ga0075369_10004585 3300006186 Bacteria 5124
121 Ga0075369_10133871 3300006186 Bacteria 1128
122 Ga0097621_100170045 3300006237 Bacteria 1878
123 Ga0097621_100275428 3300006237 Bacteria 1480
124 Ga0097621_100552023 3300006237 Bacteria 1049
125 Ga0075428_100596079 3300006844 Bacteria 1180
126 Ga0075428_100663684 3300006844 Bacteria 1112
127 Ga0075429_100319072 3300006880 Bacteria 1360
128 Ga0068865_100095458 3300006881 Bacteria 2166
129 Ga0068865_100166773 3300006881 Bacteria 1685
130 Ga0068865_100267193 3300006881 Bacteria 1357
131 Ga0097620_100134705 3300006931 Bacteria 2542
132 Ga0097620_100502491 3300006931 Bacteria 1308
133 Ga0099794_10014352 3300007265 Bacteria 3470
134 Ga0099795_10119392 3300007788 Bacteria 1053
135 Ga0105240_10008497 3300009093 Bacteria 14684
136 Ga0105240_10128892 3300009093 Bacteria 3037
137 Ga0105240_10383035 3300009093 Bacteria 1588
138 Ga0111539_10064190 3300009094 Bacteria 4345
139 Ga0105245_10196166 3300009098 Bacteria 1937
140 Ga0105247_10010445 3300009101 Bacteria 5613
141 Ga0105247_10095941 3300009101 Bacteria 1889
142 Ga0114129_10035967 3300009147 Bacteria 6993
143 Ga0105243_10133400 3300009148 Bacteria 2110
144 Ga0105241_10180595 3300009174 Bacteria 1750
145 Ga0105241_10297780 3300009174 Bacteria 1383
146 Ga0105242_10118585 3300009176 Bacteria 2267
147 Ga0105248_10019334 3300009177 Bacteria 7537
148 Ga0105248_10025755 3300009177 Bacteria 6543
149 Ga0105248_10386877 3300009177 Bacteria 1575
150 Ga0105237_10074452 3300009545 Bacteria 3388
151 Ga0105237_10164430 3300009545 Bacteria 2218
152 Ga0105237_10188536 3300009545 Bacteria 2062
153 Ga0105237_10298735 3300009545 Bacteria 1613
154 Ga0105238_10005124 3300009551 Bacteria 12953
155 Ga0105238_10614144 3300009551 Bacteria 1096
156 Ga0105249_10161594 3300009553 Bacteria 2165
157 Ga0105249_10274218 3300009553 Bacteria 1681
158 Ga0105249_10677462 3300009553 Bacteria 1090
159 Ga0099796_10021878 3300010159 Bacteria 1976
160 Ga0099796_10033398 3300010159 Bacteria 1693
161 Ga0105239_10041038 3300010375 Bacteria 5071
162 Ga0105239_10205146 3300010375 Bacteria 2209
163 Ga0105239_10240401 3300010375 Bacteria 2032
164 Ga0105239_10281645 3300010375 Bacteria 1872
165 Ga0105239_10327276 3300010375 Bacteria 1728
166 Ga0105246_10018230 3300011119 Bacteria 4473
167 Ga0157370_10033196 3300013104 Bacteria 5032
168 Ga0157370_10080305 3300013104 Bacteria 3070
169 Ga0157374_10027588 3300013296 Bacteria 5125
170 Ga0157374_10209805 3300013296 Bacteria 1909
171 Ga0157378_10034086 3300013297 Bacteria 4503
172 Ga0163162_10145635 3300013306 Bacteria 2485
173 Ga0163162_10231645 3300013306 Bacteria 1977
174 Ga0163162_10247290 3300013306 Bacteria 1915
175 Ga0163162_10528973 3300013306 Bacteria 1308
176 Ga0157375_10109789 3300013308 Bacteria 2855
177 Ga0157375_10129976 3300013308 Bacteria 2637
178 Ga0157375_10469019 3300013308 Bacteria 1424
179 Ga0163163_10064285 3300014325 Bacteria 3641
180 Ga0157380_10067297 3300014326 Bacteria 2884
181 Ga0157379_10147685 3300014968 Bacteria 2120
182 Ga0157376_10107182 3300014969 Bacteria 2453
183 Ga0157376_10430158 3300014969 Bacteria 1283
184 Ga0163161_10095102 3300017792 Bacteria 2210
185 Ga0163161_10263344 3300017792 Bacteria 1347
186 Ga0209758_1027191 3300025297 Bacteria 2451
187 Ga0209758_1057272 3300025297 Bacteria 1311
188 Ga0207656_10196382 3300025321 Bacteria 973
189 Ga0207692_10023599 3300025898 Bacteria 2847
190 Ga0207642_10057708 3300025899 Bacteria 1787
191 Ga0207642_10188803 3300025899 Bacteria 1129
192 Ga0207710_10339463 3300025900 Bacteria 764
193 Ga0207688_10041448 3300025901 Bacteria 2561
194 Ga0207688_10112148 3300025901 Bacteria 1584
195 Ga0207688_10375545 3300025901 Bacteria 879
196 Ga0207699_10018695 3300025906 Bacteria 3678
197 Ga0207645_10049456 3300025907 Bacteria 2684
198 Ga0207645_10057682 3300025907 Bacteria 2479
199 Ga0207643_10022943 3300025908 Bacteria 3440
200 Ga0207654_10058811 3300025911 Bacteria 2239
201 Ga0207707_10002327 3300025912 Bacteria 17115
202 Ga0207707_10033012 3300025912 Bacteria 4531
203 Ga0207671_10029395 3300025914 Bacteria 4103
204 Ga0207671_10071206 3300025914 Bacteria 2593
205 Ga0207671_10127232 3300025914 Bacteria 1953
206 Ga0207693_10079288 3300025915 Bacteria 2569
207 Ga0207693_10137041 3300025915 Bacteria 1924
208 Ga0207663_10177448 3300025916 Bacteria 1518
209 Ga0207663_10563227 3300025916 Bacteria 892
210 Ga0207660_10193826 3300025917 Bacteria 1584
211 Ga0207660_10291427 3300025917 Bacteria 1298
212 Ga0207657_10010155 3300025919 Bacteria 9409
213 Ga0207657_10379447 3300025919 Bacteria 1113
214 Ga0207657_10678812 3300025919 Bacteria 801
215 Ga0207649_10018599 3300025920 Bacteria 3955
216 Ga0207649_10026732 3300025920 Bacteria 3379
217 Ga0207652_10371816 3300025921 Bacteria 1290
218 Ga0207694_10030055 3300025924 Bacteria 4148
219 Ga0207694_10073311 3300025924 Bacteria 2678
220 Ga0207687_10027696 3300025927 Bacteria 3803
221 Ga0207700_10033569 3300025928 Bacteria 3673
222 Ga0207644_10074017 3300025931 Bacteria 2499
223 Ga0207690_10041213 3300025932 Bacteria 3025
224 Ga0207690_10356604 3300025932 Bacteria 1157
225 Ga0207706_10531719 3300025933 Bacteria 1013
226 Ga0207709_10139524 3300025935 Bacteria 1664
227 Ga0207670_10155532 3300025936 Bacteria 1701
228 Ga0207669_10165572 3300025937 Bacteria 1567
229 Ga0207704_10082289 3300025938 Bacteria 2085
230 Ga0207704_10186187 3300025938 Bacteria 1505
231 Ga0207704_10189478 3300025938 Bacteria 1495
232 Ga0207665_10235804 3300025939 Bacteria 1346
233 Ga0207691_10041483 3300025940 Bacteria 4248
234 Ga0207691_10048710 3300025940 Bacteria 3884
235 Ga0207711_10055787 3300025941 Bacteria 3393
236 Ga0207711_10064720 3300025941 Bacteria 3159
237 Ga0207689_10037573 3300025942 Bacteria 4016
238 Ga0207689_10052833 3300025942 Bacteria 3347
239 Ga0207689_10239274 3300025942 Bacteria 1501
240 Ga0207667_10070088 3300025949 Bacteria 3649
241 Ga0207712_10255849 3300025961 Bacteria 1418
242 Ga0207668_10012300 3300025972 Bacteria 5233
243 Ga0207668_10031333 3300025972 Bacteria 3501
244 Ga0207668_10213260 3300025972 Bacteria 1545
245 Ga0207640_10063871 3300025981 Bacteria 2449
246 Ga0207658_10112295 3300025986 Bacteria 2157
247 Ga0207658_10460676 3300025986 Bacteria 1127
248 Ga0207677_10041119 3300026023 Bacteria 3054
249 Ga0207677_10531656 3300026023 Bacteria 1022
250 Ga0207677_10819422 3300026023 Bacteria 834
251 Ga0207639_10111224 3300026041 Bacteria 2233
252 Ga0207639_10137621 3300026041 Bacteria 2030
253 Ga0207639_10500188 3300026041 Bacteria 1110
254 Ga0207639_10505425 3300026041 Bacteria 1105
255 Ga0207678_10085050 3300026067 Bacteria 2704
256 Ga0207678_10328628 3300026067 Bacteria 1316
257 Ga0207708_10062226 3300026075 Bacteria 2851
258 Ga0207708_10411749 3300026075 Bacteria 1120
259 Ga0207702_10000761 3300026078 Bacteria 34283
260 Ga0207648_10027290 3300026089 Bacteria 5071
261 Ga0207648_10109885 3300026089 Bacteria 2420
262 Ga0207676_10247673 3300026095 Bacteria 1602
263 Ga0207674_10025210 3300026116 Bacteria 6345
264 Ga0207674_10510478 3300026116 Bacteria 1161
265 Ga0207675_100035629 3300026118 Bacteria 4641
266 Ga0207675_100059660 3300026118 Bacteria 3560
267 Ga0207675_100068066 3300026118 Bacteria 3328
268 Ga0207675_100248924 3300026118 Bacteria 1719
269 Ga0207675_100336001 3300026118 Bacteria 1478
270 Ga0207675_100340544 3300026118 Bacteria 1468
271 Ga0207683_10025459 3300026121 Bacteria 5105
272 Ga0207683_10050145 3300026121 Bacteria 3655
273 Ga0207683_10076537 3300026121 Bacteria 2963
274 Ga0207698_10111418 3300026142 Bacteria 2294
275 Ga0209588_1024187 3300027671 Bacteria 1917
276 Ga0207428_10046138 3300027907 Bacteria 3505
277 Ga0268266_10187932 3300028379 Bacteria 1885
278 Ga0268265_10043947 3300028380 Bacteria 3324
279 Ga0268265_10191603 3300028380 Bacteria 1766
280 Ga0268265_10352376 3300028380 Bacteria 1344
281 Ga0268264_10000149 3300028381 Bacteria 163972
282 Ga0268264_10135206 3300028381 Bacteria 2191
283 Ga0265330_10009338 3300031235 Bacteria 4663
284 Ga0265332_10149165 3300031238 Bacteria 978
285 Ga0265340_10187720 3300031247 Bacteria 933
286 Ga0265331_10017058 3300031250 Bacteria 3796
287 Ga0265331_10155680 3300031250 Bacteria 1037
288 Ga0307509_10006531 3300031507 Bacteria 15634
289 Ga0307508_10000009 3300031616 Bacteria 256966
290 Ga0265314_10143505 3300031711 Bacteria 1473
291 Ga0307516_10040243 3300031730 Bacteria 4654
292 Ga0307410_10108582 3300031852 Bacteria 2004
293 Ga0307409_100227965 3300031995 Bacteria 1686
294 Ga0307416_100059847 3300032002 Bacteria 3098
295 Ga0307416_100128409 3300032002 Bacteria 2276
296 Ga0307415_100048273 3300032126 Bacteria 2872
297 Ga0307415_100059773 3300032126 Bacteria 2630
298 Ga0307415_100164201 3300032126 Bacteria 1725
299 Ga0307510_10002529 3300033180 Bacteria 20856
300 Ga0373930_0065793 3300034816 Bacteria 816
301 Ga0373938_0042233 3300034957 Bacteria 1017
302 Ga0373934_0023411 3300035086 Bacteria 2386
303 Ga0373923_0003839 3300035111 Bacteria 4891
304 Ga0373941_0004716 3300035115 Bacteria 3170
305 Ga0373941_0180981 3300035115 Bacteria 791
306 Ga0373953_0009466 3300035117 Bacteria 3355
307 Ga0373953_0028705 3300035117 Bacteria 2147
308 Ga0373957_0005055 3300035120 Bacteria 4070
309 Ga0373943_0001913 3300035170 Bacteria 9421
310 Ga0373955_0000593 3300035172 Bacteria 15421
311 Ga0373955_0007799 3300035172 Bacteria 4936
312 Ga0373924_0033112 3300035410 Bacteria 2084
313 Ga0373931_0018488 3300035691 Bacteria 3467
314 Ga0373935_0005366 3300035692 Bacteria 7551
315 Ga0373927_0000069 3300035695 Bacteria 74096
316 Ga0373927_0301092 3300035695 Bacteria 1055
317 Ga0373933_0000588 3300035724 Bacteria 22728
318 Ga0373947_0000385 3300035725 Bacteria 24888
319 Ga0373947_0047858 3300035725 Bacteria 2564
320 Ga0373937_0013187 3300036401 Bacteria 7278
321 Ga0373937_0092354 3300036401 Bacteria 2805
322 Ga0373937_0821043 3300036401 Bacteria 878
323 Ga0373925_0003165 3300037068 Bacteria 12891
324 Ga0373925_0404560 3300037068 Bacteria 1114
325 Ga0451804_0990541 3300041463 Bacteria 785
326 Ga0466966_0000196 3300044684 Bacteria 40708
327 Ga0466961_0000239 3300044693 Bacteria 36887
328 Ga0495592_0006702 3300046454 Bacteria 8590
329 Ga0495603_0000429 3300046455 Bacteria 23279
330 Ga0495603_0012437 3300046455 Bacteria 5152
331 Ga0495603_0029497 3300046455 Bacteria 3307
332 Ga0495629_0000083 3300046459 Bacteria 83715
333 Ga0495629_0014325 3300046459 Bacteria 5706
334 Ga0495638_0023706 3300046460 Bacteria 4009
335 Ga0495641_0004350 3300046461 Bacteria 10061
336 Ga0495651_0009898 3300046462 Bacteria 7329
337 Ga0495653_0000358 3300046463 Bacteria 36893
338 Ga0495653_0407208 3300046463 Bacteria 863
339 Ga0495650_0052605 3300046471 Bacteria 1671
340 Ga0495650_0082081 3300046471 Bacteria 1241
341 Ga0495580_0000716 3300046472 Bacteria 28310
342 Ga0495582_0000094 3300046473 Bacteria 45642
343 Ga0495582_0048907 3300046473 Bacteria 2329
344 Ga0495639_0000150 3300046475 Bacteria 36003
345 Ga0495639_0126101 3300046475 Bacteria 1224
346 Ga0495662_0002016 3300046476 Bacteria 10168
347 Ga0495584_0062219 3300046491 Bacteria 1876
348 Ga0495584_0087202 3300046491 Bacteria 1573
349 Ga0495584_0188585 3300046491 Bacteria 1048
350 Ga0495585_0145633 3300046492 Bacteria 1238
351 Ga0495594_0035825 3300046499 Bacteria 2704
352 Ga0495594_0108528 3300046499 Bacteria 1564
353 Ga0495606_0113030 3300046507 Bacteria 1635
354 Ga0495608_0008945 3300046511 Bacteria 7001
355 Ga0495628_0154407 3300046516 Bacteria 1747
356 Ga0495630_0003796 3300046517 Bacteria 10535
357 Ga0495631_0053038 3300046518 Bacteria 1770
358 Ga0495631_0131837 3300046518 Bacteria 1074
359 Ga0495631_0133334 3300046518 Bacteria 1067
360 Ga0495643_0081304 3300046522 Bacteria 1685
361 Ga0495644_0025671 3300046523 Bacteria 2236
362 Ga0495644_0074286 3300046523 Bacteria 1279
363 Ga0495644_0076145 3300046523 Bacteria 1264
364 Ga0495663_0027090 3300046525 Bacteria 1681
365 Ga0495652_0013582 3300046529 Bacteria 7329
366 Ga0495652_0017618 3300046529 Bacteria 6373
367 Ga0495665_0000975 3300046531 Bacteria 15173
368 Ga0495640_0001573 3300046533 Bacteria 17990
369 Ga0495640_0007569 3300046533 Bacteria 8533
370 Ga0495640_0131197 3300046533 Bacteria 1622
371 Ga0495609_0038412 3300046538 Bacteria 2158
372 Ga0495621_0075903 3300046539 Bacteria 1246
373 Ga0495597_0098654 3300046542 Bacteria 1234
374 Ga0495645_0034326 3300046543 Bacteria 3701
375 Ga0495645_0093869 3300046543 Bacteria 2141
376 Ga0495622_0004047 3300046557 Bacteria 6843
377 Ga0495633_0018707 3300046558 Bacteria 3515
378 Ga0495633_0061341 3300046558 Bacteria 1761
379 Ga0495667_0002771 3300046559 Bacteria 11698
380 Ga0495667_0037126 3300046559 Bacteria 3248
381 Ga0495656_0053954 3300046615 Bacteria 1728
382 Ga0495656_0054010 3300046615 Bacteria 1727
383 Ga0495656_0115819 3300046615 Bacteria 1259
384 Ga0495668_0155787 3300046616 Bacteria 1251
385 Ga0495634_0002836 3300046642 Bacteria 14230
386 Ga0495611_0157144 3300046648 Bacteria 1062
387 Ga0495635_0000466 3300046663 Bacteria 25585
388 Ga0495635_0001333 3300046663 Bacteria 16433
389 Ga0495659_0025902 3300046664 Bacteria 2010
390 Ga0495588_0021723 3300046674 Bacteria 3166
391 Ga0495588_0032025 3300046674 Bacteria 2649
392 Ga0495599_0006472 3300046678 Bacteria 7068
393 Ga0495623_0001950 3300046679 Bacteria 13853
394 Ga0495646_0034288 3300046680 Bacteria 3153
395 Ga0495647_0000665 3300046681 Bacteria 10215
396 Ga0495658_0000837 3300046683 Bacteria 16526
397 Ga0495669_0040105 3300046684 Bacteria 2075
398 Ga0495613_0012147 3300046689 Bacteria 6401
399 Ga0495613_0016895 3300046689 Bacteria 5434
400 Ga0495624_0000786 3300046690 Bacteria 24993
401 Ga0495670_0031356 3300046691 Bacteria 2641
402 Ga0495589_0044545 3300046794 Bacteria 2207
403 Ga0495600_0001173 3300046809 Bacteria 14303
404 Ga0495581_0000095 3300047315 Bacteria 36670
405 Ga0495581_0263609 3300047315 Bacteria 1008
406 Ga0495581_0381803 3300047315 Bacteria 822
407 Ga0495674_0001326 3300047319 Bacteria 24110
408 Ga0495674_0018420 3300047319 Bacteria 6501
409 Ga0495676_0040065 3300047321 Bacteria 3871
410 Ga0495676_0295807 3300047321 Bacteria 1093
411 Ga0495680_0036672 3300047322 Bacteria 3933
412 Ga0495675_0006578 3300047444 Bacteria 7117
413 Ga0495677_0031772 3300047445 Bacteria 1922
414 Ga0495677_0113258 3300047445 Bacteria 1032
415 Ga0495685_032791 3300047447 Bacteria 1785
416 Ga0495684_0000357 3300047471 Bacteria 36963
417 Ga0495684_0049462 3300047471 Bacteria 3212
418 Ga0495593_0000531 3300047673 Bacteria 21606
419 Ga0495593_0001114 3300047673 Bacteria 15690
420 Ga0495614_0028474 3300048089 Bacteria 2407
421 Ga0496100_0012436 3300048903 Bacteria 4880
422 Ga0496100_0170450 3300048903 Bacteria 1567
423 Ga0496100_0280669 3300048903 Bacteria 1242
424 Ga0496101_0004734 3300048904 Bacteria 8624
425 Ga0496101_0279077 3300048904 Bacteria 1305
426 Ga0496101_0309466 3300048904 Bacteria 1238
427 Ga0496102_0037685 3300048905 Bacteria 4362
428 Ga0496102_0042363 3300048905 Bacteria 4125
429 Ga0496103_0101705 3300048906 Bacteria 1820
430 Ga0496103_0138179 3300048906 Bacteria 1558
431 Ga0496103_0182443 3300048906 Bacteria 1349
432 Ga0496103_0203802 3300048906 Bacteria 1272
433 Ga0496104_0013859 3300048907 Bacteria 7272
434 Ga0496104_0027961 3300048907 Bacteria 5222
435 Ga0496104_0240984 3300048907 Bacteria 1721
436 Ga0496104_0331401 3300048907 Bacteria 1435
437 Ga0496105_0018485 3300048908 Bacteria 5604
438 Ga0496105_0097990 3300048908 Bacteria 2422
439 Ga0496105_0130720 3300048908 Bacteria 2070
440 Ga0496105_0369775 3300048908 Bacteria 1142
441 Ga0496106_0059551 3300048909 Bacteria 2893
442 Ga0496106_0089086 3300048909 Bacteria 2379
443 Ga0496106_0424439 3300048909 Bacteria 1069
444 Ga0496107_0009774 3300048910 Bacteria 6653
445 Ga0496107_0013513 3300048910 Bacteria 5708
446 Ga0496107_0109634 3300048910 Bacteria 2028
447 Ga0496108_0005114 3300048911 Bacteria 10600
448 Ga0496108_0204949 3300048911 Bacteria 1711
449 Ga0496108_0266651 3300048911 Bacteria 1490
450 Ga0496108_0337360 3300048911 Bacteria 1315
451 Ga0496109_0054788 3300048912 Bacteria 3637
452 Ga0496109_0124700 3300048912 Bacteria 2401
453 Ga0496109_0197662 3300048912 Bacteria 1890
454 Ga0496110_0050078 3300048913 Bacteria 3667
455 Ga0496110_0127998 3300048913 Bacteria 2292
456 Ga0496110_0136995 3300048913 Bacteria 2213
457 Ga0496111_0014742 3300048914 Bacteria 5348
458 Ga0496111_0349094 3300048914 Bacteria 1095
459 Ga0496112_0025193 3300048915 Bacteria 5709
460 Ga0496112_0096412 3300048915 Bacteria 2928
461 Ga0496112_0112697 3300048915 Bacteria 2690
462 Ga0496112_0287180 3300048915 Bacteria 1591
463 Ga0496113_0012443 3300048916 Bacteria 5717
464 Ga0496113_0122831 3300048916 Bacteria 2032
465 Ga0496113_0544022 3300048916 Bacteria 931
466 Ga0496114_0002125 3300048917 Bacteria 15068
467 Ga0496115_0001987 3300048918 Bacteria 14603
468 Ga0496115_0044103 3300048918 Bacteria 3556
469 Ga0496115_0050468 3300048918 Bacteria 3333
470 Ga0496117_0319198 3300048920 Bacteria 815
471 Ga0496121_0044664 3300048924 Bacteria 3818
472 Ga0496121_0045001 3300048924 Bacteria 3799
473 Ga0496121_0052954 3300048924 Bacteria 3403
474 Ga0496121_0190598 3300048924 Bacteria 1470
475 Ga0496121_0301859 3300048924 Bacteria 1086
476 Ga0496124_0155489 3300048927 Bacteria 1789
477 Ga0496125_0172692 3300048928 Bacteria 1451
478 Ga0496125_0212066 3300048928 Bacteria 1257
479 Ga0496126_0000542 3300048929 Bacteria 73066
480 Ga0496126_0159356 3300048929 Bacteria 1929
481 Ga0496126_0372522 3300048929 Bacteria 1164
482 Ga0496126_0393317 3300048929 Bacteria 1126
483 Ga0496126_0449615 3300048929 Bacteria 1037
484 Ga0496126_0495835 3300048929 Bacteria 977
485 Ga0495678_063044 3300049459 Bacteria 1386
486 nmdc:mga00v17_268872_c1 3300050491 Bacteria 1106
487 nmdc:mga00v17_32207_c1 3300050491 Bacteria 3097
488 nmdc:mga0yw44_106753_c1 3300050492 Bacteria 1790
489 nmdc:mga0yw44_3203_c1 3300050492 Bacteria 7203
490 nmdc:mga0yw44_327179_c1 3300050492 Bacteria 1030
491 nmdc:mga0yw44_7241_c1 3300050492 Bacteria 5438
492 nmdc:mga06z11_105750_c1 3300050494 Bacteria 1551
493 nmdc:mga06z11_163333_c1 3300050494 Bacteria 1274
494 nmdc:mga06z11_6038_c1 3300050494 Bacteria 4899
495 nmdc:mga07m45_18297_c1 3300050496 Bacteria 3779
496 nmdc:mga07m45_46857_c1 3300050496 Bacteria 2429
497 nmdc:mga05p37_45509_c1 3300050507 Bacteria 5396
498 nmdc:mga09592_344507_c1 3300050508 Bacteria 1290
499 nmdc:mga08y16_57065_c1 3300050511 Bacteria 4081
500 nmdc:mga0sz30_115879_c1 3300050516 Bacteria 1176
501 Ga0495595_0001128 3300053084 Bacteria 10339
502 Ga0495619_0000176 3300053085 Bacteria 47128
503 Ga0495619_0138244 3300053085 Bacteria 1676
504 Ga0500651_0065539 3300053093 Bacteria 2263
505 Ga0500651_0215696 3300053093 Bacteria 1127
506 Ga0500566_0007043 3300053094 Bacteria 6657
507 Ga0500641_0034331 3300053096 Bacteria 2018
508 Ga0500562_031897 3300053108 Bacteria 1390
509 Ga0500595_021613 3300053119 Bacteria 2293
510 Ga0500589_048232 3300053147 Bacteria 1981
511 Ga0500603_038022 3300053150 Bacteria 1272
512 Ga0500638_221843 3300053162 Bacteria 783
513 Ga0500639_111773 3300053163 Bacteria 1328
514 Ga0500637_0000142 3300053178 Bacteria 26117
515 Ga0500637_0008708 3300053178 Bacteria 5133
516 Ga0500661_000128 3300055283 Bacteria 12754
517 2513657982 2513237096 Bacteria 8722461
518 2513692760 2513237101 Bacteria 7952346
519 2513855684 2513237137 Bacteria 9558895
520 2513919925 2513237145 Bacteria 8979722
521 2517892222 2517572143 Bacteria 9484767
522 2524534314 2524023228 Bacteria 10118060
523 2671120528 2667528175 Bacteria 7532676
524 2723844861 2721755755 Bacteria 8322773
525 2728749566 2728368998 Bacteria 8720350
526 2793068707 2791355197 Bacteria 8420563
527 2793082268
528 2874605420 2874604998 Bacteria 7834745
529 2876814178 2876808645 Bacteria 8824342
530 2879110245 2879110137 Bacteria 8907982
531 2885381955 2885374607 Bacteria 8927485
532 2889039626 2889033259 Bacteria 9099371
533 2906617344
534 2906643100 2906635258 Bacteria 8601019
535 2908742497 2908739725 Bacteria 8628932
536 2922365564 2922361189 Bacteria 7436256
537 2922391183 2922386360 Bacteria 7017218
538 2922430480
539 2935631485 2935630451 Bacteria 8169952
540 2941510227 2941507105 Bacteria 8166816
541 2941518687 2941515067 Bacteria 8166720
542 2941525626 2941523033 Bacteria 8169134
543 3005480390 3005474847 Bacteria 9259049
544 8006940487 8006933436 Bacteria 10410654
545 8006967113 8006964411 Bacteria 8966052
546 8006980176 8006973647 Bacteria 10679141
547 8006986611 8006984368 Bacteria 9651211
548 8006995808 8006994254 Bacteria 8309700
549 8019568749 8019565922 Bacteria 9639779
550 8056673646 8056673599 Bacteria 7871253
551 Ga0495655_0018516
552 MBSR1b_contig_5843879
553 rootL2_10309054
554 Ga0070690_100073547
555 Ga0070690_100411227
556 Ga0068869_100007011
557 Ga0068869_100021259
558 Ga0068869_100047250
559 Ga0070680_100001711
560 Ga0070682_100512959
561 Ga0070682_100864854
562 Ga0068868_100045833
563 Ga0068868_100063863
564 Ga0070660_100002257
565 Ga0070691_10250144
566 Ga0070687_100133504
567 Ga0070661_100040715
568 Ga0070661_100378331
569 Ga0070668_100018694
570 Ga0070668_100226366
571 Ga0070669_100633181
572 Ga0070671_100094186
573 Ga0070671_100155905
574 Ga0070671_100181213
575 Ga0070674_100117558
576 Ga0070673_100585220
577 Ga0070659_100066029
578 Ga0070659_100224050
579 Ga0070667_100553416
580 Ga0070709_10008606
581 Ga0070714_100182709
582 Ga0070714_100285449
583 Ga0070713_100031899
584 Ga0070710_10014167
585 Ga0070711_100822705
586 Ga0070700_100398826
587 Ga0070708_100191970
588 Ga0070663_100009816
589 Ga0070663_100051996
590 Ga0070678_100063481
591 Ga0070678_100079489
592 Ga0070678_100272724
593 Ga0070662_100240181
594 Ga0070662_100348590
595 Ga0070681_10004759
596 Ga0070681_10215167
597 Ga0070681_10262667
598 Ga0068867_100092193
599 Ga0070706_100442432
600 Ga0070698_100178503
601 Ga0070698_100568796
602 Ga0070699_100371082
603 Ga0070699_100571695
604 Ga0070679_100054750
605 Ga0070684_100014817
606 Ga0070684_100113299
607 Ga0068853_100012584
608 Ga0068853_100199877
609 Ga0068853_100252441
610 Ga0068853_100480559
611 Ga0068853_100483136
612 Ga0068853_100559770
613 Ga0070672_100041370
614 Ga0070672_100157831
615 Ga0070672_100269662
616 Ga0070686_100017315
617 Ga0070695_100106314
618 Ga0070665_100024005
619 Ga0070665_100046153
620 Ga0070665_100080839
621 Ga0068855_100035959
622 Ga0068855_100137233
623 Ga0068857_100003968
624 Ga0068857_100306016
625 Ga0068857_100349068
626 Ga0068854_100032236
627 Ga0068854_100097720
628 Ga0068854_100278724
629 Ga0068856_100001367
630 Ga0068856_100460356
631 Ga0068856_101021613
632 Ga0070702_100609530
633 Ga0068852_100112462
634 Ga0068852_100208775
635 Ga0068852_100494664
636 Ga0068859_100134706
637 Ga0068859_100502475
638 Ga0068866_10028877
639 Ga0068866_10052462
640 Ga0068866_10204035
641 Ga0068861_100180099
642 Ga0068851_10012140
643 Ga0068870_10120614
644 Ga0068863_100326371
645 Ga0068863_100381100
646 Ga0068858_100124019
647 Ga0068858_100459985
648 Ga0068860_100126116
649 Ga0068862_100096883
650 Ga0068862_100103338
651 Ga0068862_100223722
652 Ga0081455_10016791
653 Ga0081540_1000979
654 Ga0081540_1001476
655 Ga0081540_1083818
656 Ga0081540_1133784
657 Ga0081539_10010267
658 Ga0070717_10015592
659 Ga0070717_10241078
660 Ga0075365_10028202
661 Ga0075365_10299540
662 Ga0075363_100033607
663 Ga0075364_10297787
664 Ga0070716_100627102
665 Ga0070712_100094127
666 Ga0070712_100226363
667 Ga0075362_10283163
668 Ga0075367_10154791
669 Ga0075367_10349232
670 Ga0075369_10004585
671 Ga0075369_10133871
672 Ga0097621_100170045
673 Ga0097621_100275428
674 Ga0097621_100552023
675 Ga0075428_100596079
676 Ga0075428_100663684
677 Ga0075429_100319072
678 Ga0068865_100095458
679 Ga0068865_100166773
680 Ga0068865_100267193
681 Ga0097620_100134705
682 Ga0097620_100502491
683 Ga0099794_10014352
684 Ga0099795_10119392
685 Ga0105240_10008497
686 Ga0105240_10128892
687 Ga0105240_10383035
688 Ga0111539_10064190
689 Ga0105245_10196166
690 Ga0105247_10010445
691 Ga0105247_10095941
692 Ga0114129_10035967
693 Ga0105243_10133400
694 Ga0105241_10180595
695 Ga0105241_10297780
696 Ga0105242_10118585
697 Ga0105248_10019334
698 Ga0105248_10025755
699 Ga0105248_10386877
700 Ga0105237_10074452
701 Ga0105237_10164430
702 Ga0105237_10188536
703 Ga0105237_10298735
704 Ga0105238_10005124
705 Ga0105238_10614144
706 Ga0105249_10161594
707 Ga0105249_10274218
708 Ga0105249_10677462
709 Ga0099796_10021878
710 Ga0099796_10033398
711 Ga0105239_10041038
712 Ga0105239_10205146
713 Ga0105239_10240401
714 Ga0105239_10281645
715 Ga0105239_10327276
716 Ga0105246_10018230
717 Ga0157370_10033196
718 Ga0157370_10080305
719 Ga0157374_10027588
720 Ga0157374_10209805
721 Ga0157378_10034086
722 Ga0163162_10145635
723 Ga0163162_10231645
724 Ga0163162_10247290
725 Ga0163162_10528973
726 Ga0157375_10109789
727 Ga0157375_10129976
728 Ga0157375_10469019
729 Ga0163163_10064285
730 Ga0157380_10067297
731 Ga0157379_10147685
732 Ga0157376_10107182
733 Ga0157376_10430158
734 Ga0163161_10095102
735 Ga0163161_10263344
736 Ga0209758_1027191
737 Ga0209758_1057272
738 Ga0207656_10196382
739 Ga0207692_10023599
740 Ga0207642_10057708
741 Ga0207642_10188803
742 Ga0207710_10339463
743 Ga0207688_10041448
744 Ga0207688_10112148
745 Ga0207688_10375545
746 Ga0207699_10018695
747 Ga0207645_10049456
748 Ga0207645_10057682
749 Ga0207643_10022943
750 Ga0207654_10058811
751 Ga0207707_10002327
752 Ga0207707_10033012
753 Ga0207671_10029395
754 Ga0207671_10071206
755 Ga0207671_10127232
756 Ga0207693_10079288
757 Ga0207693_10137041
758 Ga0207663_10177448
759 Ga0207663_10563227
760 Ga0207660_10193826
761 Ga0207660_10291427
762 Ga0207657_10010155
763 Ga0207657_10379447
764 Ga0207657_10678812
765 Ga0207649_10018599
766 Ga0207649_10026732
767 Ga0207652_10371816
768 Ga0207694_10030055
769 Ga0207694_10073311
770 Ga0207687_10027696
771 Ga0207700_10033569
772 Ga0207644_10074017
773 Ga0207690_10041213
774 Ga0207690_10356604
775 Ga0207706_10531719
776 Ga0207709_10139524
777 Ga0207670_10155532
778 Ga0207669_10165572
779 Ga0207704_10082289
780 Ga0207704_10186187
781 Ga0207704_10189478
782 Ga0207665_10235804
783 Ga0207691_10041483
784 Ga0207691_10048710
785 Ga0207711_10055787
786 Ga0207711_10064720
787 Ga0207689_10037573
788 Ga0207689_10052833
789 Ga0207689_10239274
790 Ga0207667_10070088
791 Ga0207712_10255849
792 Ga0207668_10012300
793 Ga0207668_10031333
794 Ga0207668_10213260
795 Ga0207640_10063871
796 Ga0207658_10112295
797 Ga0207658_10460676
798 Ga0207677_10041119
799 Ga0207677_10531656
800 Ga0207677_10819422
801 Ga0207639_10111224
802 Ga0207639_10137621
803 Ga0207639_10500188
804 Ga0207639_10505425
805 Ga0207678_10085050
806 Ga0207678_10328628
807 Ga0207708_10062226
808 Ga0207708_10411749
809 Ga0207702_10000761
810 Ga0207648_10027290
811 Ga0207648_10109885
812 Ga0207676_10247673
813 Ga0207674_10025210
814 Ga0207674_10510478
815 Ga0207675_100035629
816 Ga0207675_100059660
817 Ga0207675_100068066
818 Ga0207675_100248924
819 Ga0207675_100336001
820 Ga0207675_100340544
821 Ga0207683_10025459
822 Ga0207683_10050145
823 Ga0207683_10076537
824 Ga0207698_10111418
825 Ga0209588_1024187
826 Ga0207428_10046138
827 Ga0268266_10187932
828 Ga0268265_10043947
829 Ga0268265_10191603
830 Ga0268265_10352376
831 Ga0268264_10000149
832 Ga0268264_10135206
833 Ga0265330_10009338
834 Ga0265332_10149165
835 Ga0265340_10187720
836 Ga0265331_10017058
837 Ga0265331_10155680
838 Ga0307509_10006531
839 Ga0307508_10000009
840 Ga0265314_10143505
841 Ga0307516_10040243
842 Ga0307410_10108582
843 Ga0307409_100227965
844 Ga0307416_100059847
845 Ga0307416_100128409
846 Ga0307415_100048273
847 Ga0307415_100059773
848 Ga0307415_100164201
849 Ga0307510_10002529
850 Ga0373930_0065793
851 Ga0373938_0042233
852 Ga0373934_0023411
853 Ga0373923_0003839
854 Ga0373941_0004716
855 Ga0373941_0180981
856 Ga0373953_0009466
857 Ga0373953_0028705
858 Ga0373957_0005055
859 Ga0373943_0001913
860 Ga0373955_0000593
861 Ga0373955_0007799
862 Ga0373924_0033112
863 Ga0373931_0018488
864 Ga0373935_0005366
865 Ga0373927_0000069
866 Ga0373927_0301092
867 Ga0373933_0000588
868 Ga0373947_0000385
869 Ga0373947_0047858
870 Ga0373937_0013187
871 Ga0373937_0092354
872 Ga0373937_0821043
873 Ga0373925_0003165
874 Ga0373925_0404560
875 Ga0451804_0990541
876 Ga0466966_0000196
877 Ga0466961_0000239
878 Ga0495592_0006702
879 Ga0495603_0000429
880 Ga0495603_0012437
881 Ga0495603_0029497
882 Ga0495629_0000083
883 Ga0495629_0014325
884 Ga0495638_0023706
885 Ga0495641_0004350
886 Ga0495651_0009898
887 Ga0495653_0000358
888 Ga0495653_0407208
889 Ga0495650_0052605
890 Ga0495650_0082081
891 Ga0495580_0000716
892 Ga0495582_0000094
893 Ga0495582_0048907
894 Ga0495639_0000150
895 Ga0495639_0126101
896 Ga0495662_0002016
897 Ga0495584_0062219
898 Ga0495584_0087202
899 Ga0495584_0188585
900 Ga0495585_0145633
901 Ga0495594_0035825
902 Ga0495594_0108528
903 Ga0495606_0113030
904 Ga0495608_0008945
905 Ga0495628_0154407
906 Ga0495630_0003796
907 Ga0495631_0053038
908 Ga0495631_0131837
909 Ga0495631_0133334
910 Ga0495643_0081304
911 Ga0495644_0025671
912 Ga0495644_0074286
913 Ga0495644_0076145
914 Ga0495663_0027090
915 Ga0495652_0013582
916 Ga0495652_0017618
917 Ga0495665_0000975
918 Ga0495640_0001573
919 Ga0495640_0007569
920 Ga0495640_0131197
921 Ga0495609_0038412
922 Ga0495621_0075903
923 Ga0495597_0098654
924 Ga0495645_0034326
925 Ga0495645_0093869
926 Ga0495622_0004047
927 Ga0495633_0018707
928 Ga0495633_0061341
929 Ga0495667_0002771
930 Ga0495667_0037126
931 Ga0495656_0053954
932 Ga0495656_0054010
933 Ga0495656_0115819
934 Ga0495668_0155787
935 Ga0495634_0002836
936 Ga0495611_0157144
937 Ga0495635_0000466
938 Ga0495635_0001333
939 Ga0495659_0025902
940 Ga0495588_0021723
941 Ga0495588_0032025
942 Ga0495599_0006472
943 Ga0495623_0001950
944 Ga0495646_0034288
945 Ga0495647_0000665
946 Ga0495658_0000837
947 Ga0495669_0040105
948 Ga0495613_0012147
949 Ga0495613_0016895
950 Ga0495624_0000786
951 Ga0495670_0031356
952 Ga0495589_0044545
953 Ga0495600_0001173
954 Ga0495581_0000095
955 Ga0495581_0263609
956 Ga0495581_0381803
957 Ga0495674_0001326
958 Ga0495674_0018420
959 Ga0495676_0040065
960 Ga0495676_0295807
961 Ga0495680_0036672
962 Ga0495675_0006578
963 Ga0495677_0031772
964 Ga0495677_0113258
965 Ga0495685_032791
966 Ga0495684_0000357
967 Ga0495684_0049462
968 Ga0495593_0000531
969 Ga0495593_0001114
970 Ga0495614_0028474
971 Ga0496100_0012436
972 Ga0496100_0170450
973 Ga0496100_0280669
974 Ga0496101_0004734
975 Ga0496101_0279077
976 Ga0496101_0309466
977 Ga0496102_0037685
978 Ga0496102_0042363
979 Ga0496103_0101705
980 Ga0496103_0138179
981 Ga0496103_0182443
982 Ga0496103_0203802
983 Ga0496104_0013859
984 Ga0496104_0027961
985 Ga0496104_0240984
986 Ga0496104_0331401
987 Ga0496105_0018485
988 Ga0496105_0097990
989 Ga0496105_0130720
990 Ga0496105_0369775
991 Ga0496106_0059551
992 Ga0496106_0089086
993 Ga0496106_0424439
994 Ga0496107_0009774
995 Ga0496107_0013513
996 Ga0496107_0109634
997 Ga0496108_0005114
998 Ga0496108_0204949
999 Ga0496108_0266651
1000 Ga0496108_0337360
1001 Ga0496109_0054788
1002 Ga0496109_0124700
1003 Ga0496109_0197662
1004 Ga0496110_0050078
1005 Ga0496110_0127998
1006 Ga0496110_0136995
1007 Ga0496111_0014742
1008 Ga0496111_0349094
1009 Ga0496112_0025193
1010 Ga0496112_0096412
1011 Ga0496112_0112697
1012 Ga0496112_0287180
1013 Ga0496113_0012443
1014 Ga0496113_0122831
1015 Ga0496113_0544022
1016 Ga0496114_0002125
1017 Ga0496115_0001987
1018 Ga0496115_0044103
1019 Ga0496115_0050468
1020 Ga0496117_0319198
1021 Ga0496121_0044664
1022 Ga0496121_0045001
1023 Ga0496121_0052954
1024 Ga0496121_0190598
1025 Ga0496121_0301859
1026 Ga0496124_0155489
1027 Ga0496125_0172692
1028 Ga0496125_0212066
1029 Ga0496126_0000542
1030 Ga0496126_0159356
1031 Ga0496126_0372522
1032 Ga0496126_0393317
1033 Ga0496126_0449615
1034 Ga0496126_0495835
1035 Ga0495678_063044
1036 nmdc:mga00v17_268872_c1
1037 nmdc:mga00v17_32207_c1
1038 nmdc:mga0yw44_106753_c1
1039 nmdc:mga0yw44_3203_c1
1040 nmdc:mga0yw44_327179_c1
1041 nmdc:mga0yw44_7241_c1
1042 nmdc:mga06z11_105750_c1
1043 nmdc:mga06z11_163333_c1
1044 nmdc:mga06z11_6038_c1
1045 nmdc:mga07m45_18297_c1
1046 nmdc:mga07m45_46857_c1
1047 nmdc:mga05p37_45509_c1
1048 nmdc:mga09592_344507_c1
1049 nmdc:mga08y16_57065_c1
1050 nmdc:mga0sz30_115879_c1
1051 Ga0495595_0001128
1052 Ga0495619_0000176
1053 Ga0495619_0138244
1054 Ga0500651_0065539
1055 Ga0500651_0215696
1056 Ga0500566_0007043
1057 Ga0500641_0034331
1058 Ga0500562_031897
1059 Ga0500595_021613
1060 Ga0500589_048232
1061 Ga0500603_038022
1062 Ga0500638_221843
1063 Ga0500639_111773
1064 Ga0500637_0000142
1065 Ga0500637_0008708
1066 Ga0500661_000128
1067 2513657982
1068 2513692760
1069 2513855684
1070 2513919925
1071 2517892222
1072 2524534314
1073 2671120528
1074 2723844861
1075 2728749566
1076 2793068707
1077 2793082268
1078 2874605420
1079 2876814178
1080 2879110245
1081 2885381955
1082 2889039626
1083 2906617344
1084 2906643100
1085 2908742497
1086 2922365564
1087 2922391183
1088 2922430480
1089 2935631485
1090 2941510227
1091 2941518687
1092 2941525626
1093 3005480390
1094 8006940487
1095 8006967113
1096 8006980176
1097 8006986611
1098 8006995808
1099 8019568749
1100 8056673646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

176

262

0.9

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

148

254

0.87

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

172

255

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ec4-assembly1.cif.gz_A crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.921 2 226
3ec4-assembly2.cif.gz_B crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9181 2 226
3ec4-assembly1.cif.gz_A crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9171 2 226
3ec4-assembly2.cif.gz_B crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9142 2 226
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8642 99 212
ID Description Score Start End Superfamily
3ec4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9058 2 226 3.40.630.30
3ec4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9018 2 226 3.40.630.30
af_Q54U46_65_201_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8857 142 210 3.40.630.30
af_Q8IQP3_53_143_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8802 133 191 3.40.630.30
af_G5EE42_2_95_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8759 133 191 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0Q6AQM8-F1-model_v4 Acyltransferase 0.9936 4 226 GO:0016747
AF-A0A023XFE5-F1-model_v4 deleted 0.9934 4 225
AF-A0A1M7HD30-F1-model_v4 Predicted acetyltransferase, GNAT family 0.9915 1 226 GO:0016747
AF-A0A1H0S995-F1-model_v4 Predicted acetyltransferase, GNAT family 0.9901 1 226 GO:0016747
AF-A0A1Q5R6Q2-F1-model_v4 Acyltransferase 0.9888 4 226 GO:0016747

Map