F462537

General Info

Members Datasets Scaffolds Average Seq Length
550 267 978 326

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0203547|Ga0496103_0203547_58_1158
Length 366
Sequence LRIPRWAAAIAVVTICVAAAALGTAGSSNAKPAAGPTIALVSDIGRFTDKGFNQSQLAGLNKAKKQLDFTALPLQSNATSDYSPNFNTAVRKGAKLVIAAGFLLAGTEATYAKQFPNVHFAITDDSVHGSDFKGKYTKNIEGLTYQANEGGCLAGVLAAKMAKKEGGNTIGAVGGLTIPPVDIWIAGYRFCAKKAVPGTKVLIQYSQDFVATDKCKTVATNEISQGAKVVFQVAGGCGLGVFKAADEAGAWAIGVDVDQYKLGKRVLTSGVKHVDSGVIGVIRQELAGKFKGGTDLNFNLKNGGIGIGKINPSVPKAFITLMNSYKAKIIAGKLKVPTALYRRPGSTAARGRGARPLALRVRIGTA

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
144 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
182 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
183 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
184 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
185 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
186 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 2.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.27
Rhizosphere 83.27
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0203547 3300048906 Bacteria 1273
2 JGI25405J52794_10009653 3300003911 Bacteria 1825
3 Ga0058863_11946881 3300004799 Bacteria 1088
4 Ga0058861_12042373 3300004800 Bacteria 1962
5 Ga0058862_10206867 3300004803 Bacteria 1091
6 Ga0058862_12841296 3300004803 Bacteria 1607
7 Ga0070676_10034871 3300005328 Bacteria 2891
8 Ga0070676_10233495 3300005328 Bacteria 1220
9 Ga0070683_100024717 3300005329 Bacteria 5384
10 Ga0070683_100051832 3300005329 Bacteria 3800
11 Ga0070690_100047346 3300005330 Bacteria 2736
12 Ga0068869_100170525 3300005334 Bacteria 1700
13 Ga0070666_10169223 3300005335 Bacteria 1530
14 Ga0070680_100041452 3300005336 Bacteria 3733
15 Ga0070680_100109215 3300005336 Unclassified 2302
16 Ga0070682_100048027 3300005337 Bacteria 2656
17 Ga0070682_100093884 3300005337 Bacteria 1968
18 Ga0070682_100135014 3300005337 Bacteria 1675
19 Ga0068868_100101059 3300005338 Bacteria 2334
20 Ga0068868_100279325 3300005338 Bacteria 1413
21 Ga0070660_100094799 3300005339 Bacteria 2358
22 Ga0070691_10037695 3300005341 Bacteria 2282
23 Ga0070692_10016676 3300005345 Bacteria 3498
24 Ga0070668_100029799 3300005347 Bacteria 4146
25 Ga0070668_100170118 3300005347 Unclassified 1773
26 Ga0070671_100058809 3300005355 Bacteria 3199
27 Ga0070674_100038231 3300005356 Bacteria 3233
28 Ga0070674_100240851 3300005356 Unclassified 1416
29 Ga0070673_100188548 3300005364 Bacteria 1770
30 Ga0070659_100132251 3300005366 Bacteria 2027
31 Ga0070659_100219529 3300005366 Bacteria 1568
32 Ga0070659_100339368 3300005366 Unclassified 1258
33 Ga0070667_100009824 3300005367 Bacteria 7932
34 Ga0070709_10057297 3300005434 Bacteria 2467
35 Ga0070714_100075470 3300005435 Bacteria 2925
36 Ga0070714_100088564 3300005435 Bacteria 2709
37 Ga0070714_100101827 3300005435 Bacteria 2531
38 Ga0070714_100321723 3300005435 Bacteria 1447
39 Ga0070714_100366600 3300005435 Bacteria 1355
40 Ga0070714_100465473 3300005435 Bacteria 1202
41 Ga0070713_100010359 3300005436 Bacteria 6734
42 Ga0070713_100168895 3300005436 Bacteria 1958
43 Ga0070713_100175258 3300005436 Bacteria 1924
44 Ga0070711_100162991 3300005439 Bacteria 1692
45 Ga0070705_100024714 3300005440 Bacteria 3247
46 Ga0070700_100103802 3300005441 Unclassified 1877
47 Ga0070694_100026079 3300005444 Bacteria 3785
48 Ga0070694_100090303 3300005444 Bacteria 2148
49 Ga0070663_100120946 3300005455 Bacteria 1978
50 Ga0070678_100022046 3300005456 Bacteria 4210
51 Ga0070678_100027090 3300005456 Bacteria 3886
52 Ga0070662_100026866 3300005457 Bacteria 3990
53 Ga0070662_100055472 3300005457 Bacteria 2874
54 Ga0070662_100084788 3300005457 Bacteria 2367
55 Ga0070681_10058068 3300005458 Bacteria 3849
56 Ga0070681_10072986 3300005458 Bacteria 3394
57 Ga0070681_10081894 3300005458 Bacteria 3183
58 Ga0068867_100040465 3300005459 Bacteria 3402
59 Ga0070706_100141188 3300005467 Bacteria 2248
60 Ga0070706_100240107 3300005467 Bacteria 1692
61 Ga0070707_100193562 3300005468 Bacteria 1983
62 Ga0070707_100253960 3300005468 Bacteria 1711
63 Ga0070679_100161939 3300005530 Bacteria 2212
64 Ga0070684_100011202 3300005535 Bacteria 7139
65 Ga0070684_100096691 3300005535 Bacteria 2633
66 Ga0070684_100144658 3300005535 Unclassified 2151
67 Ga0070684_100178882 3300005535 Bacteria 1928
68 Ga0068853_100186746 3300005539 Bacteria 1882
69 Ga0070686_100012419 3300005544 Bacteria 4851
70 Ga0070695_100012792 3300005545 Bacteria 5038
71 Ga0070695_100159784 3300005545 Bacteria 1581
72 Ga0070696_100034720 3300005546 Bacteria 3471
73 Ga0070696_100045766 3300005546 Bacteria 3032
74 Ga0070696_100075585 3300005546 Bacteria 2377
75 Ga0070693_100003206 3300005547 Bacteria 7593
76 Ga0070693_100016465 3300005547 Bacteria 3829
77 Ga0070704_100018886 3300005549 Bacteria 4419
78 Ga0070704_100086876 3300005549 Bacteria 2319
79 Ga0070704_100123864 3300005549 Bacteria 1991
80 Ga0068855_100022798 3300005563 Bacteria 7502
81 Ga0068855_100034537 3300005563 Bacteria 6029
82 Ga0068855_100154022 3300005563 Bacteria 2612
83 Ga0068855_100362179 3300005563 Bacteria 1595
84 Ga0068857_100006198 3300005577 Bacteria 10224
85 Ga0068857_100194512 3300005577 Bacteria 1848
86 Ga0068854_100037090 3300005578 Bacteria 3419
87 Ga0068856_100056048 3300005614 Bacteria 3889
88 Ga0068856_100151228 3300005614 Bacteria 2330
89 Ga0068856_100233966 3300005614 Bacteria 1853
90 Ga0070702_100046443 3300005615 Unclassified 2461
91 Ga0068852_100388757 3300005616 Bacteria 1370
92 Ga0068864_100235130 3300005618 Unclassified 1696
93 Ga0068866_10129857 3300005718 Bacteria 1431
94 Ga0068861_100003676 3300005719 Bacteria 10231
95 Ga0068861_100060180 3300005719 Bacteria 2910
96 Ga0068861_100200670 3300005719 Bacteria 1674
97 Ga0068863_100154605 3300005841 Unclassified 2196
98 Ga0068862_100130481 3300005844 Unclassified 2222
99 Ga0081455_10001217 3300005937 Bacteria 32259
100 Ga0081540_1004299 3300005983 Bacteria 10910
101 Ga0081540_1004945 3300005983 Bacteria 10020
102 Ga0081540_1015246 3300005983 Bacteria 4873
103 Ga0070717_10044728 3300006028 Bacteria 3618
104 Ga0070717_10083727 3300006028 Bacteria 2683
105 Ga0070717_10126688 3300006028 Bacteria 2193
106 Ga0070715_10010261 3300006163 Bacteria 3333
107 Ga0070715_10126293 3300006163 Bacteria 1225
108 Ga0070716_100006638 3300006173 Bacteria 5661
109 Ga0070712_100079113 3300006175 Bacteria 2375
110 Ga0070712_100119285 3300006175 Bacteria 1982
111 Ga0097621_100016660 3300006237 Bacteria 5563
112 Ga0068871_100062848 3300006358 Bacteria 3035
113 Ga0075433_10164847 3300006852 Bacteria 1972
114 Ga0075434_100409070 3300006871 Unclassified 1378
115 Ga0075434_100417669 3300006871 Bacteria 1362
116 Ga0075436_100031405 3300006914 Bacteria 3657
117 Ga0075436_100055451 3300006914 Bacteria 2737
118 Ga0075436_100060023 3300006914 Bacteria 2627
119 Ga0075436_100106726 3300006914 Bacteria 1953
120 Ga0075436_100145553 3300006914 Bacteria 1666
121 Ga0075435_100028261 3300007076 Bacteria 4396
122 Ga0075435_100152748 3300007076 Unclassified 1942
123 Ga0105240_10162858 3300009093 Bacteria 2648
124 Ga0105240_10248045 3300009093 Bacteria 2061
125 Ga0105245_10010520 3300009098 Bacteria 8049
126 Ga0105245_10013892 3300009098 Bacteria 7013
127 Ga0105245_10044952 3300009098 Bacteria 3943
128 Ga0105245_10062069 3300009098 Bacteria 3371
129 Ga0105245_10078705 3300009098 Bacteria 3009
130 Ga0105245_10188828 3300009098 Bacteria 1973
131 Ga0114129_10643466 3300009147 Bacteria 1369
132 Ga0105243_10171314 3300009148 Bacteria 1880
133 Ga0105243_10200839 3300009148 Bacteria 1748
134 Ga0105243_10248278 3300009148 Bacteria 1587
135 Ga0105241_10010992 3300009174 Bacteria 6638
136 Ga0105241_10283273 3300009174 Unclassified 1416
137 Ga0105242_10104665 3300009176 Bacteria 2403
138 Ga0105242_10324565 3300009176 Bacteria 1413
139 Ga0105248_10238624 3300009177 Unclassified 2046
140 Ga0105237_10173063 3300009545 Unclassified 2159
141 Ga0105249_10009944 3300009553 Bacteria 8344
142 Ga0105249_10148909 3300009553 Bacteria 2251
143 Ga0105239_10042999 3300010375 Bacteria 4951
144 Ga0105239_10104085 3300010375 Bacteria 3143
145 Ga0105239_10131059 3300010375 Bacteria 2789
146 Ga0105239_10246744 3300010375 Bacteria 2005
147 Ga0105239_10353504 3300010375 Bacteria 1659
148 Ga0105246_10143671 3300011119 Bacteria 1798
149 Ga0105246_10184305 3300011119 Bacteria 1610
150 Ga0157371_10075465 3300013102 Unclassified 2388
151 Ga0157370_10015122 3300013104 Bacteria 7862
152 Ga0157369_10054423 3300013105 Bacteria 4322
153 Ga0157374_10172371 3300013296 Bacteria 2111
154 Ga0157378_10161980 3300013297 Bacteria 2093
155 Ga0163162_10026197 3300013306 Bacteria 5763
156 Ga0163162_10114272 3300013306 Bacteria 2798
157 Ga0157372_10050553 3300013307 Bacteria 4624
158 Ga0157372_10160751 3300013307 Bacteria 2596
159 Ga0157372_10217769 3300013307 Bacteria 2213
160 Ga0157372_10346129 3300013307 Bacteria 1732
161 Ga0157375_10332020 3300013308 Bacteria 1685
162 Ga0157375_10368115 3300013308 Bacteria 1603
163 Ga0157380_10233000 3300014326 Bacteria 1655
164 Ga0157376_10064983 3300014969 Bacteria 3079
165 Ga0163161_10049883 3300017792 Bacteria 3027
166 Ga0163161_10127569 3300017792 Bacteria 1917
167 Ga0197907_10186392 3300020069 Bacteria 1215
168 Ga0206356_10058131 3300020070 Bacteria 1309
169 Ga0206356_10206220 3300020070 Bacteria 2552
170 Ga0206356_11388658 3300020070 Unclassified 1079
171 Ga0206354_11163339 3300020081 Unclassified 1078
172 Ga0206353_11345996 3300020082 Bacteria 1450
173 Ga0206353_11924500 3300020082 Bacteria 1617
174 Ga0207692_10002316 3300025898 Bacteria 7317
175 Ga0207692_10029284 3300025898 Bacteria 2615
176 Ga0207692_10171590 3300025898 Bacteria 1257
177 Ga0207642_10028323 3300025899 Bacteria 2305
178 Ga0207688_10060942 3300025901 Bacteria 2126
179 Ga0207685_10072040 3300025905 Bacteria 1404
180 Ga0207699_10242113 3300025906 Bacteria 1240
181 Ga0207684_10105222 3300025910 Bacteria 2414
182 Ga0207684_10174045 3300025910 Bacteria 1855
183 Ga0207654_10046785 3300025911 Bacteria 2469
184 Ga0207654_10088131 3300025911 Bacteria 1885
185 Ga0207654_10242222 3300025911 Bacteria 1206
186 Ga0207707_10008420 3300025912 Bacteria 8946
187 Ga0207707_10052079 3300025912 Bacteria 3565
188 Ga0207707_10166316 3300025912 Bacteria 1927
189 Ga0207695_10377095 3300025913 Unclassified 1304
190 Ga0207693_10116699 3300025915 Bacteria 2096
191 Ga0207693_10131207 3300025915 Bacteria 1970
192 Ga0207693_10212921 3300025915 Bacteria 1519
193 Ga0207663_10058302 3300025916 Bacteria 2436
194 Ga0207660_10040880 3300025917 Bacteria 3248
195 Ga0207657_10059829 3300025919 Bacteria 3271
196 Ga0207652_10001672 3300025921 Bacteria 19424
197 Ga0207652_10109738 3300025921 Bacteria 2446
198 Ga0207646_10205021 3300025922 Bacteria 1781
199 Ga0207687_10027687 3300025927 Bacteria 3804
200 Ga0207687_10031161 3300025927 Bacteria 3602
201 Ga0207687_10242682 3300025927 Bacteria 1429
202 Ga0207700_10130708 3300025928 Bacteria 2050
203 Ga0207664_10002681 3300025929 Bacteria 11812
204 Ga0207664_10012104 3300025929 Bacteria 6161
205 Ga0207664_10023379 3300025929 Bacteria 4629
206 Ga0207664_10026053 3300025929 Bacteria 4414
207 Ga0207664_10073222 3300025929 Bacteria 2764
208 Ga0207664_10220564 3300025929 Bacteria 1644
209 Ga0207644_10036694 3300025931 Bacteria 3443
210 Ga0207690_10081948 3300025932 Bacteria 2256
211 Ga0207690_10246859 3300025932 Bacteria 1377
212 Ga0207706_10030160 3300025933 Bacteria 4839
213 Ga0207706_10107816 3300025933 Bacteria 2451
214 Ga0207706_10131861 3300025933 Bacteria 2198
215 Ga0207709_10071235 3300025935 Bacteria 2207
216 Ga0207709_10087542 3300025935 Bacteria 2025
217 Ga0207709_10087786 3300025935 Bacteria 2023
218 Ga0207669_10121542 3300025937 Bacteria 1774
219 Ga0207704_10237552 3300025938 Bacteria 1359
220 Ga0207665_10004604 3300025939 Bacteria 9160
221 Ga0207691_10120775 3300025940 Bacteria 2322
222 Ga0207689_10334431 3300025942 Bacteria 1258
223 Ga0207661_10025826 3300025944 Bacteria 4469
224 Ga0207661_10112787 3300025944 Bacteria 2302
225 Ga0207661_10290032 3300025944 Bacteria 1464
226 Ga0207667_10086886 3300025949 Bacteria 3235
227 Ga0207667_10090893 3300025949 Bacteria 3155
228 Ga0207651_10188041 3300025960 Unclassified 1645
229 Ga0207712_10096315 3300025961 Bacteria 2190
230 Ga0207668_10047981 3300025972 Bacteria 2928
231 Ga0207668_10059561 3300025972 Bacteria 2676
232 Ga0207640_10095946 3300025981 Unclassified 2066
233 Ga0207639_10378805 3300026041 Bacteria 1270
234 Ga0207678_10117872 3300026067 Bacteria 2265
235 Ga0207708_10012186 3300026075 Bacteria 6415
236 Ga0207708_10153578 3300026075 Bacteria 1814
237 Ga0207702_10001734 3300026078 Bacteria 21458
238 Ga0207702_10028501 3300026078 Bacteria 4642
239 Ga0207702_10045450 3300026078 Bacteria 3693
240 Ga0207641_10051348 3300026088 Bacteria 3492
241 Ga0207648_10002381 3300026089 Bacteria 20243
242 Ga0207648_10103797 3300026089 Bacteria 2493
243 Ga0207674_10001837 3300026116 Bacteria 27050
244 Ga0207674_10194768 3300026116 Bacteria 1976
245 Ga0207675_100001495 3300026118 Bacteria 23420
246 Ga0207675_100066124 3300026118 Bacteria 3378
247 Ga0207675_100350754 3300026118 Bacteria 1446
248 Ga0207683_10005116 3300026121 Bacteria 11256
249 Ga0207683_10063978 3300026121 Bacteria 3241
250 Ga0207683_10129631 3300026121 Bacteria 2268
251 Ga0207698_10155712 3300026142 Bacteria 1990
252 Ga0207428_10065476 3300027907 Bacteria 2867
253 Ga0207428_10136456 3300027907 Bacteria 1875
254 Ga0268264_10265554 3300028381 Bacteria 1601
255 Ga0265326_10021386 3300028558 Bacteria 1854
256 Ga0265319_1002066 3300028563 Bacteria 11280
257 Ga0265334_10050052 3300028573 Bacteria 1606
258 Ga0265334_10087261 3300028573 Bacteria 1142
259 Ga0265318_10000065 3300028577 Bacteria 102014
260 Ga0265318_10010551 3300028577 Bacteria 4017
261 Ga0265323_10006349 3300028653 Bacteria 4970
262 Ga0265322_10001365 3300028654 Bacteria 8064
263 Ga0265322_10007691 3300028654 Bacteria 3142
264 Ga0265336_10022274 3300028666 Bacteria 2018
265 Ga0265338_10003947 3300028800 Bacteria 20441
266 Ga0265338_10004565 3300028800 Bacteria 18629
267 Ga0265338_10005613 3300028800 Bacteria 16301
268 Ga0265338_10027708 3300028800 Bacteria 5676
269 Ga0265338_10029968 3300028800 Bacteria 5378
270 Ga0265338_10050173 3300028800 Bacteria 3774
271 Ga0265330_10000243 3300031235 Bacteria 41099
272 Ga0265330_10021388 3300031235 Bacteria 2953
273 Ga0265332_10002850 3300031238 Bacteria 8557
274 Ga0265320_10018962 3300031240 Bacteria 3774
275 Ga0265320_10018985 3300031240 Bacteria 3770
276 Ga0265325_10001766 3300031241 Bacteria 14981
277 Ga0265325_10017478 3300031241 Bacteria 3984
278 Ga0265325_10033509 3300031241 Bacteria 2738
279 Ga0265329_10007138 3300031242 Bacteria 4349
280 Ga0265340_10011922 3300031247 Bacteria 4603
281 Ga0265340_10063938 3300031247 Bacteria 1755
282 Ga0265339_10006370 3300031249 Bacteria 7760
283 Ga0265339_10009323 3300031249 Bacteria 6177
284 Ga0265331_10014065 3300031250 Bacteria 4276
285 Ga0265331_10023383 3300031250 Bacteria 3140
286 Ga0265327_10008969 3300031251 Bacteria 7327
287 Ga0265327_10022753 3300031251 Bacteria 3734
288 Ga0265316_10002772 3300031344 Bacteria 17956
289 Ga0265316_10013972 3300031344 Bacteria 7100
290 Ga0265316_10023385 3300031344 Bacteria 5192
291 Ga0265316_10032162 3300031344 Bacteria 4283
292 Ga0265313_10005148 3300031595 Bacteria 9720
293 Ga0265313_10021638 3300031595 Bacteria 3512
294 Ga0265314_10003399 3300031711 Bacteria 15417
295 Ga0265314_10005215 3300031711 Bacteria 11790
296 Ga0265314_10013148 3300031711 Bacteria 6705
297 Ga0265314_10028729 3300031711 Bacteria 4142
298 Ga0265342_10008974 3300031712 Bacteria 7100
299 Ga0265342_10013371 3300031712 Bacteria 5512
300 Ga0265342_10025757 3300031712 Bacteria 3692
301 Ga0265342_10078754 3300031712 Bacteria 1907
302 Ga0373930_0021039 3300034816 Bacteria 1277
303 Ga0373944_0029013 3300035089 Bacteria 1651
304 Ga0373949_0010860 3300035090 Unclassified 2001
305 Ga0373953_0030204 3300035117 Bacteria 2100
306 Ga0373956_0072585 3300035119 Bacteria 1572
307 Ga0373960_0026599 3300035121 Bacteria 1582
308 Ga0373961_0040844 3300035241 Bacteria 1338
309 Ga0373962_0021909 3300035242 Bacteria 1690
310 Ga0373947_0008876 3300035725 Bacteria 5785
311 Ga0373937_0048493 3300036401 Bacteria 3888
312 Ga0395899_0011645 3300037312 Bacteria 6731
313 Ga0395899_0034288 3300037312 Bacteria 3810
314 Ga0395899_0236627 3300037312 Bacteria 1258
315 Ga0395900_0015891 3300037418 Bacteria 7667
316 Ga0395900_0042783 3300037418 Bacteria 4666
317 Ga0395898_0011444 3300037466 Bacteria 9214
318 Ga0395898_0063867 3300037466 Bacteria 3572
319 Ga0395905_0023022 3300037471 Bacteria 5888
320 Ga0395905_0033629 3300037471 Bacteria 4814
321 Ga0395901_0019590 3300038443 Bacteria 6916
322 Ga0451789_0723253 3300041443 Bacteria 2149
323 Ga0451793_1563929 3300041452 Bacteria 2946
324 Ga0451800_0198612 3300041459 Bacteria 1987
325 Ga0451802_0064792 3300041460 Bacteria 5132
326 Ga0451802_1919658 3300041460 Unclassified 1390
327 Ga0451804_0406825 3300041463 Bacteria 3037
328 Ga0451807_1408601 3300041486 Bacteria 3940
329 Ga0451835_1163545 3300041492 Bacteria 3118
330 Ga0451839_0054092 3300041496 Bacteria 3151
331 Ga0451845_0293172 3300041501 Bacteria 3414
332 Ga0451847_0635435 3300041503 Bacteria 2083
333 Ga0451849_0167195 3300041505 Bacteria 2218
334 Ga0451851_0403422 3300041507 Bacteria 1240
335 Ga0451853_1260915 3300041512 Bacteria 1914
336 Ga0451853_1559313 3300041512 Bacteria 2006
337 Ga0439448_0034642 3300042005 Bacteria 1614
338 Ga0466961_0181960 3300044693 Bacteria 1305
339 Ga0466964_0040283 3300044706 Bacteria 1886
340 Ga0466960_0095588 3300044901 Bacteria 1522
341 Ga0451576_0029915 3300045051 Bacteria 5826
342 Ga0466967_0015900 3300045976 Bacteria 5914
343 Ga0466967_0161864 3300045976 Unclassified 2101
344 Ga0495627_039457 3300046453 Bacteria 1457
345 Ga0495603_0010490 3300046455 Bacteria 5614
346 Ga0495641_0002340 3300046461 Bacteria 15054
347 Ga0495641_0005114 3300046461 Bacteria 8984
348 Ga0495641_0066568 3300046461 Bacteria 1621
349 Ga0495641_0069018 3300046461 Bacteria 1589
350 Ga0495651_0014469 3300046462 Bacteria 6097
351 Ga0495651_0043592 3300046462 Bacteria 3480
352 Ga0495651_0259270 3300046462 Bacteria 1184
353 Ga0495653_0111054 3300046463 Bacteria 1969
354 Ga0495580_0024207 3300046472 Bacteria 4449
355 Ga0495582_0011964 3300046473 Bacteria 4779
356 Ga0495582_0018894 3300046473 Bacteria 3769
357 Ga0495639_0149180 3300046475 Bacteria 1127
358 Ga0495584_0034025 3300046491 Bacteria 2578
359 Ga0495584_0073858 3300046491 Bacteria 1714
360 Ga0495585_0148410 3300046492 Unclassified 1224
361 Ga0495594_0000653 3300046499 Bacteria 17908
362 Ga0495607_0020221 3300046501 Bacteria 4214
363 Ga0495608_0006040 3300046511 Bacteria 8607
364 Ga0495608_0078428 3300046511 Bacteria 2149
365 Ga0495628_0216569 3300046516 Bacteria 1439
366 Ga0495630_0051995 3300046517 Bacteria 3067
367 Ga0495630_0122273 3300046517 Bacteria 1975
368 Ga0495630_0125889 3300046517 Bacteria 1945
369 Ga0495637_0041855 3300046520 Unclassified 1963
370 Ga0495663_0015504 3300046525 Bacteria 2147
371 Ga0495666_0029658 3300046526 Bacteria 2691
372 Ga0495642_0039995 3300046528 Bacteria 1904
373 Ga0495652_0062253 3300046529 Bacteria 3146
374 Ga0495587_0046833 3300046536 Bacteria 2565
375 Ga0495587_0189456 3300046536 Bacteria 1165
376 Ga0495598_0019562 3300046537 Bacteria 1778
377 Ga0495598_0126569 3300046537 Unclassified 872
378 Ga0495667_0084497 3300046559 Bacteria 2060
379 Ga0495656_0019401 3300046615 Bacteria 2625
380 Ga0495656_0133754 3300046615 Unclassified 1182
381 Ga0495659_0011194 3300046664 Bacteria 2890
382 Ga0495661_0046944 3300046665 Bacteria 2633
383 Ga0495588_0001107 3300046674 Bacteria 11626
384 Ga0495657_0040780 3300046675 Bacteria 3181
385 Ga0495658_0010763 3300046683 Bacteria 4582
386 Ga0495669_0021227 3300046684 Bacteria 2817
387 Ga0495613_0055415 3300046689 Bacteria 2913
388 Ga0495624_0136767 3300046690 Bacteria 1502
389 Ga0495589_0032480 3300046794 Bacteria 2624
390 Ga0495589_0083093 3300046794 Unclassified 1557
391 Ga0495600_0023256 3300046809 Bacteria 3986
392 Ga0495581_0006041 3300047315 Bacteria 7019
393 Ga0495604_0016093 3300047317 Bacteria 5974
394 Ga0495604_0289424 3300047317 Unclassified 1104
395 Ga0495674_0085542 3300047319 Bacteria 2701
396 Ga0495676_0002111 3300047321 Bacteria 17530
397 Ga0495676_0096716 3300047321 Bacteria 2194
398 Ga0495676_0153771 3300047321 Bacteria 1634
399 Ga0495676_0156511 3300047321 Bacteria 1616
400 Ga0495680_0007167 3300047322 Bacteria 10270
401 Ga0495680_0017402 3300047322 Bacteria 6139
402 Ga0495677_0063223 3300047445 Bacteria 1375
403 Ga0495684_0094823 3300047471 Bacteria 2259
404 Ga0495602_0012856 3300048088 Bacteria 8581
405 Ga0496100_0089529 3300048903 Bacteria 2096
406 Ga0496100_0096591 3300048903 Bacteria 2028
407 Ga0496100_0106166 3300048903 Unclassified 1943
408 Ga0496101_0075096 3300048904 Bacteria 2487
409 Ga0496101_0124474 3300048904 Unclassified 1952
410 Ga0496101_0201427 3300048904 Bacteria 1539
411 Ga0496102_0009512 3300048905 Bacteria 8357
412 Ga0496102_0010875 3300048905 Bacteria 7834
413 Ga0496102_0064478 3300048905 Bacteria 3355
414 Ga0496102_0147498 3300048905 Bacteria 2209
415 Ga0496102_0207621 3300048905 Bacteria 1847
416 Ga0496102_0446542 3300048905 Unclassified 1213
417 Ga0496103_0003779 3300048906 Bacteria 9207
418 Ga0496103_0014919 3300048906 Bacteria 4619
419 Ga0496104_0003091 3300048907 Bacteria 14348
420 Ga0496104_0023732 3300048907 Bacteria 5640
421 Ga0496104_0061830 3300048907 Bacteria 3550
422 Ga0496105_0005641 3300048908 Bacteria 9525
423 Ga0496105_0025608 3300048908 Bacteria 4804
424 Ga0496105_0042809 3300048908 Bacteria 3733
425 Ga0496106_0026270 3300048909 Bacteria 4334
426 Ga0496106_0128434 3300048909 Bacteria 1986
427 Ga0496106_0129194 3300048909 Unclassified 1980
428 Ga0496107_0000937 3300048910 Bacteria 17247
429 Ga0496107_0012590 3300048910 Bacteria 5906
430 Ga0496107_0131428 3300048910 Unclassified 1848
431 Ga0496107_0135973 3300048910 Unclassified 1815
432 Ga0496108_0001508 3300048911 Bacteria 18428
433 Ga0496108_0004714 3300048911 Bacteria 10999
434 Ga0496109_0002816 3300048912 Bacteria 14567
435 Ga0496109_0003635 3300048912 Bacteria 12885
436 Ga0496109_0058343 3300048912 Bacteria 3525
437 Ga0496109_0201740 3300048912 Bacteria 1870
438 Ga0496109_0290529 3300048912 Bacteria 1541
439 Ga0496110_0000908 3300048913 Bacteria 20813
440 Ga0496110_0133164 3300048913 Bacteria 2245
441 Ga0496110_0246626 3300048913 Bacteria 1625
442 Ga0496111_0001294 3300048914 Bacteria 14031
443 Ga0496111_0001730 3300048914 Bacteria 12771
444 Ga0496111_0006377 3300048914 Bacteria 7656
445 Ga0496111_0099588 3300048914 Bacteria 2135
446 Ga0496111_0145672 3300048914 Bacteria 1756
447 Ga0496111_0210980 3300048914 Bacteria 1442
448 Ga0496112_0000901 3300048915 Bacteria 21405
449 Ga0496112_0005656 3300048915 Bacteria 10853
450 Ga0496112_0055080 3300048915 Bacteria 3909
451 Ga0496112_0066899 3300048915 Bacteria 3546
452 Ga0496112_0198086 3300048915 Bacteria 1969
453 Ga0496112_0204041 3300048915 Bacteria 1935
454 Ga0496113_0000274 3300048916 Bacteria 24414
455 Ga0496113_0005666 3300048916 Bacteria 7820
456 Ga0496113_0167746 3300048916 Bacteria 1738
457 Ga0496113_0203029 3300048916 Bacteria 1576
458 Ga0496113_0360300 3300048916 Bacteria 1167
459 Ga0496114_0021922 3300048917 Bacteria 5200
460 Ga0496114_0137220 3300048917 Unclassified 2115
461 Ga0496115_0009476 3300048918 Bacteria 7233
462 Ga0496115_0031439 3300048918 Bacteria 4184
463 Ga0496115_0031888 3300048918 Bacteria 4154
464 Ga0496115_0075187 3300048918 Bacteria 2743
465 Ga0501034_0296499 3300049571 Bacteria 1554
466 Ga0501047_0046869 3300049581 Bacteria 4176
467 Ga0501067_0002644 3300049583 Bacteria 9922
468 Ga0501067_0032692 3300049583 Bacteria 2887
469 Ga0501069_0018862 3300049585 Bacteria 3723
470 Ga0501070_0180496 3300049586 Bacteria 1737
471 Ga0501074_0134696 3300049590 Bacteria 1767
472 Ga0501077_0001544 3300049593 Bacteria 13876
473 Ga0501080_0118831 3300049742 Bacteria 2451
474 nmdc:mga05p37_173375_c1 3300050507 Bacteria 2629
475 nmdc:mga08y16_85532_c1 3300050511 Bacteria 3287
476 nmdc:mga0n895_205779_c1 3300050512 Unclassified 1999
477 nmdc:mga0n895_372846_c1 3300050512 Bacteria 1445
478 nmdc:mga0n895_558851_c1 3300050512 Bacteria 1150
479 nmdc:mga0n895_731256_c1 3300050512 Unclassified 984
480 nmdc:mga0rr50_93675_c1 3300050513 Bacteria 2344
481 nmdc:mga08x19_189986_c1 3300050514 Bacteria 1405
482 nmdc:mga08x19_268172_c1 3300050514 Bacteria 1181
483 nmdc:mga08x19_51275_c1 3300050514 Bacteria 2650
484 nmdc:mga0a205_145120_c1 3300050515 Bacteria 2273
485 nmdc:mga0a205_261080_c1 3300050515 Unclassified 1610
486 Ga0495595_0009998 3300053084 Bacteria 3934
487 Ga0495595_0016049 3300053084 Bacteria 3199
488 Ga0495619_0066080 3300053085 Bacteria 2413
489 Ga0587082_020152 3300059504 Bacteria 1077
490 Ga0496103_0203547
491 JGI25405J52794_10009653
492 Ga0058863_11946881
493 Ga0058861_12042373
494 Ga0058862_10206867
495 Ga0058862_12841296
496 Ga0070676_10034871
497 Ga0070676_10233495
498 Ga0070683_100024717
499 Ga0070683_100051832
500 Ga0070690_100047346
501 Ga0068869_100170525
502 Ga0070666_10169223
503 Ga0070680_100041452
504 Ga0070680_100109215
505 Ga0070682_100048027
506 Ga0070682_100093884
507 Ga0070682_100135014
508 Ga0068868_100101059
509 Ga0068868_100279325
510 Ga0070660_100094799
511 Ga0070691_10037695
512 Ga0070692_10016676
513 Ga0070668_100029799
514 Ga0070668_100170118
515 Ga0070671_100058809
516 Ga0070674_100038231
517 Ga0070674_100240851
518 Ga0070673_100188548
519 Ga0070659_100132251
520 Ga0070659_100219529
521 Ga0070659_100339368
522 Ga0070667_100009824
523 Ga0070709_10057297
524 Ga0070714_100075470
525 Ga0070714_100088564
526 Ga0070714_100101827
527 Ga0070714_100321723
528 Ga0070714_100366600
529 Ga0070714_100465473
530 Ga0070713_100010359
531 Ga0070713_100168895
532 Ga0070713_100175258
533 Ga0070711_100162991
534 Ga0070705_100024714
535 Ga0070700_100103802
536 Ga0070694_100026079
537 Ga0070694_100090303
538 Ga0070663_100120946
539 Ga0070678_100022046
540 Ga0070678_100027090
541 Ga0070662_100026866
542 Ga0070662_100055472
543 Ga0070662_100084788
544 Ga0070681_10058068
545 Ga0070681_10072986
546 Ga0070681_10081894
547 Ga0068867_100040465
548 Ga0070706_100141188
549 Ga0070706_100240107
550 Ga0070707_100193562
551 Ga0070707_100253960
552 Ga0070679_100161939
553 Ga0070684_100011202
554 Ga0070684_100096691
555 Ga0070684_100144658
556 Ga0070684_100178882
557 Ga0068853_100186746
558 Ga0070686_100012419
559 Ga0070695_100012792
560 Ga0070695_100159784
561 Ga0070696_100034720
562 Ga0070696_100045766
563 Ga0070696_100075585
564 Ga0070693_100003206
565 Ga0070693_100016465
566 Ga0070704_100018886
567 Ga0070704_100086876
568 Ga0070704_100123864
569 Ga0068855_100022798
570 Ga0068855_100034537
571 Ga0068855_100154022
572 Ga0068855_100362179
573 Ga0068857_100006198
574 Ga0068857_100194512
575 Ga0068854_100037090
576 Ga0068856_100056048
577 Ga0068856_100151228
578 Ga0068856_100233966
579 Ga0070702_100046443
580 Ga0068852_100388757
581 Ga0068864_100235130
582 Ga0068866_10129857
583 Ga0068861_100003676
584 Ga0068861_100060180
585 Ga0068861_100200670
586 Ga0068863_100154605
587 Ga0068862_100130481
588 Ga0081455_10001217
589 Ga0081540_1004299
590 Ga0081540_1004945
591 Ga0081540_1015246
592 Ga0070717_10044728
593 Ga0070717_10083727
594 Ga0070717_10126688
595 Ga0070715_10010261
596 Ga0070715_10126293
597 Ga0070716_100006638
598 Ga0070712_100079113
599 Ga0070712_100119285
600 Ga0097621_100016660
601 Ga0068871_100062848
602 Ga0075433_10164847
603 Ga0075434_100409070
604 Ga0075434_100417669
605 Ga0075436_100031405
606 Ga0075436_100055451
607 Ga0075436_100060023
608 Ga0075436_100106726
609 Ga0075436_100145553
610 Ga0075435_100028261
611 Ga0075435_100152748
612 Ga0105240_10162858
613 Ga0105240_10248045
614 Ga0105245_10010520
615 Ga0105245_10013892
616 Ga0105245_10044952
617 Ga0105245_10062069
618 Ga0105245_10078705
619 Ga0105245_10188828
620 Ga0114129_10643466
621 Ga0105243_10171314
622 Ga0105243_10200839
623 Ga0105243_10248278
624 Ga0105241_10010992
625 Ga0105241_10283273
626 Ga0105242_10104665
627 Ga0105242_10324565
628 Ga0105248_10238624
629 Ga0105237_10173063
630 Ga0105249_10009944
631 Ga0105249_10148909
632 Ga0105239_10042999
633 Ga0105239_10104085
634 Ga0105239_10131059
635 Ga0105239_10246744
636 Ga0105239_10353504
637 Ga0105246_10143671
638 Ga0105246_10184305
639 Ga0157371_10075465
640 Ga0157370_10015122
641 Ga0157369_10054423
642 Ga0157374_10172371
643 Ga0157378_10161980
644 Ga0163162_10026197
645 Ga0163162_10114272
646 Ga0157372_10050553
647 Ga0157372_10160751
648 Ga0157372_10217769
649 Ga0157372_10346129
650 Ga0157375_10332020
651 Ga0157375_10368115
652 Ga0157380_10233000
653 Ga0157376_10064983
654 Ga0163161_10049883
655 Ga0163161_10127569
656 Ga0197907_10186392
657 Ga0206356_10058131
658 Ga0206356_10206220
659 Ga0206356_11388658
660 Ga0206354_11163339
661 Ga0206353_11345996
662 Ga0206353_11924500
663 Ga0207692_10002316
664 Ga0207692_10029284
665 Ga0207692_10171590
666 Ga0207642_10028323
667 Ga0207688_10060942
668 Ga0207685_10072040
669 Ga0207699_10242113
670 Ga0207684_10105222
671 Ga0207684_10174045
672 Ga0207654_10046785
673 Ga0207654_10088131
674 Ga0207654_10242222
675 Ga0207707_10008420
676 Ga0207707_10052079
677 Ga0207707_10166316
678 Ga0207695_10377095
679 Ga0207693_10116699
680 Ga0207693_10131207
681 Ga0207693_10212921
682 Ga0207663_10058302
683 Ga0207660_10040880
684 Ga0207657_10059829
685 Ga0207652_10001672
686 Ga0207652_10109738
687 Ga0207646_10205021
688 Ga0207687_10027687
689 Ga0207687_10031161
690 Ga0207687_10242682
691 Ga0207700_10130708
692 Ga0207664_10002681
693 Ga0207664_10012104
694 Ga0207664_10023379
695 Ga0207664_10026053
696 Ga0207664_10073222
697 Ga0207664_10220564
698 Ga0207644_10036694
699 Ga0207690_10081948
700 Ga0207690_10246859
701 Ga0207706_10030160
702 Ga0207706_10107816
703 Ga0207706_10131861
704 Ga0207709_10071235
705 Ga0207709_10087542
706 Ga0207709_10087786
707 Ga0207669_10121542
708 Ga0207704_10237552
709 Ga0207665_10004604
710 Ga0207691_10120775
711 Ga0207689_10334431
712 Ga0207661_10025826
713 Ga0207661_10112787
714 Ga0207661_10290032
715 Ga0207667_10086886
716 Ga0207667_10090893
717 Ga0207651_10188041
718 Ga0207712_10096315
719 Ga0207668_10047981
720 Ga0207668_10059561
721 Ga0207640_10095946
722 Ga0207639_10378805
723 Ga0207678_10117872
724 Ga0207708_10012186
725 Ga0207708_10153578
726 Ga0207702_10001734
727 Ga0207702_10028501
728 Ga0207702_10045450
729 Ga0207641_10051348
730 Ga0207648_10002381
731 Ga0207648_10103797
732 Ga0207674_10001837
733 Ga0207674_10194768
734 Ga0207675_100001495
735 Ga0207675_100066124
736 Ga0207675_100350754
737 Ga0207683_10005116
738 Ga0207683_10063978
739 Ga0207683_10129631
740 Ga0207698_10155712
741 Ga0207428_10065476
742 Ga0207428_10136456
743 Ga0268264_10265554
744 Ga0265326_10021386
745 Ga0265319_1002066
746 Ga0265334_10050052
747 Ga0265334_10087261
748 Ga0265318_10000065
749 Ga0265318_10010551
750 Ga0265323_10006349
751 Ga0265322_10001365
752 Ga0265322_10007691
753 Ga0265336_10022274
754 Ga0265338_10003947
755 Ga0265338_10004565
756 Ga0265338_10005613
757 Ga0265338_10027708
758 Ga0265338_10029968
759 Ga0265338_10050173
760 Ga0265330_10000243
761 Ga0265330_10021388
762 Ga0265332_10002850
763 Ga0265320_10018962
764 Ga0265320_10018985
765 Ga0265325_10001766
766 Ga0265325_10017478
767 Ga0265325_10033509
768 Ga0265329_10007138
769 Ga0265340_10011922
770 Ga0265340_10063938
771 Ga0265339_10006370
772 Ga0265339_10009323
773 Ga0265331_10014065
774 Ga0265331_10023383
775 Ga0265327_10008969
776 Ga0265327_10022753
777 Ga0265316_10002772
778 Ga0265316_10013972
779 Ga0265316_10023385
780 Ga0265316_10032162
781 Ga0265313_10005148
782 Ga0265313_10021638
783 Ga0265314_10003399
784 Ga0265314_10005215
785 Ga0265314_10013148
786 Ga0265314_10028729
787 Ga0265342_10008974
788 Ga0265342_10013371
789 Ga0265342_10025757
790 Ga0265342_10078754
791 Ga0373930_0021039
792 Ga0373944_0029013
793 Ga0373949_0010860
794 Ga0373953_0030204
795 Ga0373956_0072585
796 Ga0373960_0026599
797 Ga0373961_0040844
798 Ga0373962_0021909
799 Ga0373947_0008876
800 Ga0373937_0048493
801 Ga0395899_0011645
802 Ga0395899_0034288
803 Ga0395899_0236627
804 Ga0395900_0015891
805 Ga0395900_0042783
806 Ga0395898_0011444
807 Ga0395898_0063867
808 Ga0395905_0023022
809 Ga0395905_0033629
810 Ga0395901_0019590
811 Ga0451789_0723253
812 Ga0451793_1563929
813 Ga0451800_0198612
814 Ga0451802_0064792
815 Ga0451802_1919658
816 Ga0451804_0406825
817 Ga0451807_1408601
818 Ga0451835_1163545
819 Ga0451839_0054092
820 Ga0451845_0293172
821 Ga0451847_0635435
822 Ga0451849_0167195
823 Ga0451851_0403422
824 Ga0451853_1260915
825 Ga0451853_1559313
826 Ga0439448_0034642
827 Ga0466961_0181960
828 Ga0466964_0040283
829 Ga0466960_0095588
830 Ga0451576_0029915
831 Ga0466967_0015900
832 Ga0466967_0161864
833 Ga0495627_039457
834 Ga0495603_0010490
835 Ga0495641_0002340
836 Ga0495641_0005114
837 Ga0495641_0066568
838 Ga0495641_0069018
839 Ga0495651_0014469
840 Ga0495651_0043592
841 Ga0495651_0259270
842 Ga0495653_0111054
843 Ga0495580_0024207
844 Ga0495582_0011964
845 Ga0495582_0018894
846 Ga0495639_0149180
847 Ga0495584_0034025
848 Ga0495584_0073858
849 Ga0495585_0148410
850 Ga0495594_0000653
851 Ga0495607_0020221
852 Ga0495608_0006040
853 Ga0495608_0078428
854 Ga0495628_0216569
855 Ga0495630_0051995
856 Ga0495630_0122273
857 Ga0495630_0125889
858 Ga0495637_0041855
859 Ga0495663_0015504
860 Ga0495666_0029658
861 Ga0495642_0039995
862 Ga0495652_0062253
863 Ga0495587_0046833
864 Ga0495587_0189456
865 Ga0495598_0019562
866 Ga0495598_0126569
867 Ga0495667_0084497
868 Ga0495656_0019401
869 Ga0495656_0133754
870 Ga0495659_0011194
871 Ga0495661_0046944
872 Ga0495588_0001107
873 Ga0495657_0040780
874 Ga0495658_0010763
875 Ga0495669_0021227
876 Ga0495613_0055415
877 Ga0495624_0136767
878 Ga0495589_0032480
879 Ga0495589_0083093
880 Ga0495600_0023256
881 Ga0495581_0006041
882 Ga0495604_0016093
883 Ga0495604_0289424
884 Ga0495674_0085542
885 Ga0495676_0002111
886 Ga0495676_0096716
887 Ga0495676_0153771
888 Ga0495676_0156511
889 Ga0495680_0007167
890 Ga0495680_0017402
891 Ga0495677_0063223
892 Ga0495684_0094823
893 Ga0495602_0012856
894 Ga0496100_0089529
895 Ga0496100_0096591
896 Ga0496100_0106166
897 Ga0496101_0075096
898 Ga0496101_0124474
899 Ga0496101_0201427
900 Ga0496102_0009512
901 Ga0496102_0010875
902 Ga0496102_0064478
903 Ga0496102_0147498
904 Ga0496102_0207621
905 Ga0496102_0446542
906 Ga0496103_0003779
907 Ga0496103_0014919
908 Ga0496104_0003091
909 Ga0496104_0023732
910 Ga0496104_0061830
911 Ga0496105_0005641
912 Ga0496105_0025608
913 Ga0496105_0042809
914 Ga0496106_0026270
915 Ga0496106_0128434
916 Ga0496106_0129194
917 Ga0496107_0000937
918 Ga0496107_0012590
919 Ga0496107_0131428
920 Ga0496107_0135973
921 Ga0496108_0001508
922 Ga0496108_0004714
923 Ga0496109_0002816
924 Ga0496109_0003635
925 Ga0496109_0058343
926 Ga0496109_0201740
927 Ga0496109_0290529
928 Ga0496110_0000908
929 Ga0496110_0133164
930 Ga0496110_0246626
931 Ga0496111_0001294
932 Ga0496111_0001730
933 Ga0496111_0006377
934 Ga0496111_0099588
935 Ga0496111_0145672
936 Ga0496111_0210980
937 Ga0496112_0000901
938 Ga0496112_0005656
939 Ga0496112_0055080
940 Ga0496112_0066899
941 Ga0496112_0198086
942 Ga0496112_0204041
943 Ga0496113_0000274
944 Ga0496113_0005666
945 Ga0496113_0167746
946 Ga0496113_0203029
947 Ga0496113_0360300
948 Ga0496114_0021922
949 Ga0496114_0137220
950 Ga0496115_0009476
951 Ga0496115_0031439
952 Ga0496115_0031888
953 Ga0496115_0075187
954 Ga0501034_0296499
955 Ga0501047_0046869
956 Ga0501067_0002644
957 Ga0501067_0032692
958 Ga0501069_0018862
959 Ga0501070_0180496
960 Ga0501074_0134696
961 Ga0501077_0001544
962 Ga0501080_0118831
963 nmdc:mga05p37_173375_c1
964 nmdc:mga08y16_85532_c1
965 nmdc:mga0n895_205779_c1
966 nmdc:mga0n895_372846_c1
967 nmdc:mga0n895_558851_c1
968 nmdc:mga0n895_731256_c1
969 nmdc:mga0rr50_93675_c1
970 nmdc:mga08x19_189986_c1
971 nmdc:mga08x19_268172_c1
972 nmdc:mga08x19_51275_c1
973 nmdc:mga0a205_145120_c1
974 nmdc:mga0a205_261080_c1
975 Ga0495595_0009998
976 Ga0495595_0016049
977 Ga0495619_0066080
978 Ga0587082_020152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02608

Bmp

ABC transporter substrate-binding protein PnrA-like

37

339

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x0r-assembly1.cif.gz_A crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum 0.9316 11 297
2fqy-assembly1.cif.gz_A pnra from treponema pallidum complexed with adenosine. 0.9252 11 298
6shu-assembly1.cif.gz_A borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine 0.9016 8 299
6yab-assembly3.cif.gz_BBB crystal structure of pnra from s. pneumoniae in complex with uridine 0.9011 13 298
7x0r-assembly1.cif.gz_A crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum 0.8925 11 297
ID Description Score Start End Superfamily
4pevC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8789 11 118 3.40.50.2300
4ycsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8513 10 117 3.40.50.2300
2hqbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.832 12 262 3.40.50.2300
2hqbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8147 12 262 3.40.50.2300
3e61A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.813 12 97 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7W0P802-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9765 177 299 GO:0005886
AF-A0A538JHM5-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9616 58 298 GO:0005886
AF-A0A7W0P802-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9612 177 299 GO:0005886
AF-A0A7Y6CD20-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.9595 1 299 GO:0005886
AF-A0A538GQV2-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.959 1 299 GO:0005886

Map