F462536

General Info

Members Datasets Scaffolds Average Seq Length
550 247 1100 301

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0000257|Ga0496100_0000257_5611_6600
Length 329
Sequence VAARVNTGATNRPNAEHEHRLEKGDCMSTQAPSLLAGTFTELMPHDGIELREGYAEIGDQRLHYVEAGHGPLVVLLHGFPEFWFGWRLQIEPLAAAGFRVVAPDTRGYNLSSKPEGFEAYGVDLLAADIRGLIGQLGAESASLVGHDWGGTIAWTTAMNHPEVVDRLAILNAAHPRRLSEGLHHPSQLRKSWYFXXXAAPGLPEEVVQARDWHFFRHFLEDANPPYTPEEIERYVEAWSQPGAAAGMINYYRASVRQSQKAAVAKLRPLAAPTLVIWGERDSYLGSDLAEPKREDVPNLDRVERLPDASHWVHHDEAERVNQLLIDFFA

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
177 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
178 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
179 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 15.64
Rhizosphere 82
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0000257 3300048903 Bacteria 27180
2 JGI24751J29686_10002009 3300002459 Bacteria 4139
3 JGI25406J46586_10031033 3300003203 Bacteria 2004
4 JGI25407J50210_10001917 3300003373 Bacteria 4825
5 JGI25407J50210_10003496 3300003373 Bacteria 3766
6 JGI25407J50210_10014344 3300003373 Bacteria 2042
7 JGI25407J50210_10019130 3300003373 Bacteria 1780
8 Ga0058862_12876957 3300004803 Archaea 1095
9 Ga0070658_10006560 3300005327 Bacteria 9439
10 Ga0070658_10377456 3300005327 Bacteria 1216
11 Ga0070683_100034301 3300005329 Bacteria 4634
12 Ga0070683_100058113 3300005329 Bacteria 3594
13 Ga0070670_100005744 3300005331 Bacteria 10478
14 Ga0068869_100001470 3300005334 Bacteria 13949
15 Ga0068869_100075308 3300005334 Bacteria 2507
16 Ga0070680_100010663 3300005336 Bacteria 7091
17 Ga0070682_100018321 3300005337 Bacteria 4091
18 Ga0070682_100027032 3300005337 Bacteria 3440
19 Ga0068868_100002936 3300005338 Bacteria 11829
20 Ga0068868_100011183 3300005338 Bacteria 6535
21 Ga0068868_100040994 3300005338 Bacteria 3606
22 Ga0068868_100147687 3300005338 Bacteria 1934
23 Ga0070660_100008359 3300005339 Bacteria 7236
24 Ga0070660_100019853 3300005339 Bacteria 4930
25 Ga0070660_100295679 3300005339 Bacteria 1327
26 Ga0070689_100245694 3300005340 Bacteria 1475
27 Ga0070691_10040537 3300005341 Bacteria 2201
28 Ga0070691_10054478 3300005341 Bacteria 1915
29 Ga0070661_100003306 3300005344 Bacteria 11127
30 Ga0070661_100080849 3300005344 Bacteria 2399
31 Ga0070668_100034866 3300005347 Bacteria 3835
32 Ga0070675_100017374 3300005354 Bacteria 5715
33 Ga0070675_100140791 3300005354 Bacteria 2062
34 Ga0070671_100004157 3300005355 Bacteria 11434
35 Ga0070671_100043762 3300005355 Bacteria 3720
36 Ga0070674_100078642 3300005356 Bacteria 2351
37 Ga0070673_100140844 3300005364 Bacteria 2034
38 Ga0070659_100012632 3300005366 Bacteria 6263
39 Ga0070659_100044216 3300005366 Bacteria 3486
40 Ga0070709_10158626 3300005434 Bacteria 1571
41 Ga0070714_100021350 3300005435 Bacteria 5298
42 Ga0070714_100177616 3300005435 Bacteria 1935
43 Ga0070714_100388044 3300005435 Bacteria 1318
44 Ga0070713_100213701 3300005436 Unclassified 1747
45 Ga0070713_100381836 3300005436 Bacteria 1313
46 Ga0070710_10030380 3300005437 Bacteria 2906
47 Ga0070710_10172077 3300005437 Bacteria 1350
48 Ga0070711_100187567 3300005439 Bacteria 1587
49 Ga0070700_100074066 3300005441 Bacteria 2181
50 Ga0070700_100075767 3300005441 Bacteria 2159
51 Ga0070663_100033461 3300005455 Bacteria 3551
52 Ga0070663_100126144 3300005455 Bacteria 1939
53 Ga0070678_100002579 3300005456 Bacteria 9953
54 Ga0070662_100068011 3300005457 Bacteria 2617
55 Ga0070662_100312940 3300005457 Bacteria 1279
56 Ga0070681_10004311 3300005458 Bacteria 13513
57 Ga0070685_10258057 3300005466 Bacteria 1158
58 Ga0070706_100022791 3300005467 Bacteria 5767
59 Ga0070707_100128446 3300005468 Bacteria 2463
60 Ga0070698_100003489 3300005471 Bacteria 17302
61 Ga0070684_100024628 3300005535 Bacteria 5051
62 Ga0070697_100297665 3300005536 Bacteria 1387
63 Ga0070672_100006945 3300005543 Bacteria 7655
64 Ga0070695_100412526 3300005545 Bacteria 1026
65 Ga0070693_100050284 3300005547 Bacteria 2382
66 Ga0070665_100040951 3300005548 Bacteria 4656
67 Ga0070704_100068418 3300005549 Unclassified 2568
68 Ga0068855_100006271 3300005563 Bacteria 14494
69 Ga0068855_100040991 3300005563 Bacteria 5490
70 Ga0070664_100006643 3300005564 Bacteria 9328
71 Ga0068857_100367713 3300005577 Bacteria 1334
72 Ga0068854_100014745 3300005578 Bacteria 5159
73 Ga0068856_100001346 3300005614 Bacteria 25824
74 Ga0068856_100003992 3300005614 Bacteria 14779
75 Ga0068856_100019431 3300005614 Bacteria 6593
76 Ga0070702_100018007 3300005615 Bacteria 3655
77 Ga0070702_100025557 3300005615 Bacteria 3166
78 Ga0070702_100154748 3300005615 Bacteria 1476
79 Ga0070702_100206609 3300005615 Bacteria 1304
80 Ga0068852_100049529 3300005616 Bacteria 3594
81 Ga0068852_100410335 3300005616 Bacteria 1334
82 Ga0068859_100220599 3300005617 Bacteria 1984
83 Ga0068864_100005057 3300005618 Bacteria 10799
84 Ga0068864_100081915 3300005618 Bacteria 2830
85 Ga0068866_10061027 3300005718 Bacteria 1957
86 Ga0068851_10131140 3300005834 Archaea 1355
87 Ga0068870_10010138 3300005840 Bacteria 4313
88 Ga0081455_10012526 3300005937 Bacteria 8461
89 Ga0081455_10058166 3300005937 Bacteria 3272
90 Ga0081538_10000736 3300005981 Bacteria 35786
91 Ga0081538_10002319 3300005981 Bacteria 18796
92 Ga0081538_10002644 3300005981 Bacteria 17290
93 Ga0081538_10007388 3300005981 Bacteria 9516
94 Ga0081538_10012670 3300005981 Bacteria 6743
95 Ga0081538_10013358 3300005981 Bacteria 6506
96 Ga0081538_10013470 3300005981 Bacteria 6468
97 Ga0081538_10021637 3300005981 Bacteria 4684
98 Ga0081538_10028543 3300005981 Bacteria 3835
99 Ga0081538_10034945 3300005981 Bacteria 3313
100 Ga0081538_10053065 3300005981 Bacteria 2415
101 Ga0081538_10070259 3300005981 Bacteria 1934
102 Ga0081538_10122165 3300005981 Bacteria 1248
103 Ga0081540_1000153 3300005983 Bacteria 70813
104 Ga0081540_1012199 3300005983 Bacteria 5682
105 Ga0081540_1020468 3300005983 Bacteria 3977
106 Ga0081539_10001486 3300005985 Bacteria 39689
107 Ga0081539_10009074 3300005985 Bacteria 8429
108 Ga0081539_10031052 3300005985 Bacteria 3301
109 Ga0070717_10003371 3300006028 Bacteria 11415
110 Ga0070717_10022862 3300006028 Bacteria 4946
111 Ga0070717_10027285 3300006028 Bacteria 4563
112 Ga0070717_10054091 3300006028 Bacteria 3310
113 Ga0070717_10074951 3300006028 Bacteria 2830
114 Ga0070717_10195820 3300006028 Bacteria 1768
115 Ga0075365_10143316 3300006038 Unclassified 1659
116 Ga0070715_10016838 3300006163 Bacteria 2756
117 Ga0070716_100089718 3300006173 Bacteria 1858
118 Ga0070712_100008884 3300006175 Bacteria 6328
119 Ga0070712_100053675 3300006175 Bacteria 2815
120 Ga0075428_100111011 3300006844 Bacteria 2987
121 Ga0075431_100048416 3300006847 Bacteria 4385
122 Ga0075431_100658221 3300006847 Bacteria 1027
123 Ga0075433_10011881 3300006852 Bacteria 7015
124 Ga0075433_10024922 3300006852 Bacteria 5054
125 Ga0075433_10041906 3300006852 Archaea 3969
126 Ga0075433_10062924 3300006852 Bacteria 3250
127 Ga0075433_10064649 3300006852 Bacteria 3207
128 Ga0075433_10108371 3300006852 Bacteria 2464
129 Ga0075433_10259299 3300006852 Bacteria 1541
130 Ga0075434_100016278 3300006871 Bacteria 7148
131 Ga0075434_100038860 3300006871 Archaea 4715
132 Ga0075434_100238179 3300006871 Bacteria 1840
133 Ga0075434_100455458 3300006871 Bacteria 1300
134 Ga0075429_100109406 3300006880 Bacteria 2415
135 Ga0075429_100230822 3300006880 Unclassified 1621
136 Ga0075436_100030107 3300006914 Bacteria 3735
137 Ga0075436_100128158 3300006914 Archaea 1778
138 Ga0097620_100220586 3300006931 Bacteria 1984
139 Ga0075435_100015519 3300007076 Bacteria 5728
140 Ga0075435_100047246 3300007076 Bacteria 3456
141 Ga0105251_10027842 3300009011 Bacteria 2859
142 Ga0105240_10375452 3300009093 Bacteria 1607
143 Ga0111539_10018228 3300009094 Bacteria 8694
144 Ga0111539_10031887 3300009094 Bacteria 6402
145 Ga0105245_10001298 3300009098 Bacteria 22552
146 Ga0105245_10001761 3300009098 Bacteria 19733
147 Ga0105245_10006869 3300009098 Bacteria 9981
148 Ga0105245_10075308 3300009098 Bacteria 3073
149 Ga0105245_10665550 3300009098 Bacteria 1072
150 Ga0105247_10016361 3300009101 Bacteria 4443
151 Ga0114129_10013014 3300009147 Bacteria 11850
152 Ga0114129_10198135 3300009147 Bacteria 2722
153 Ga0114129_10209045 3300009147 Bacteria 2639
154 Ga0105243_10227051 3300009148 Bacteria 1654
155 Ga0105241_10022621 3300009174 Bacteria 4657
156 Ga0105241_10049163 3300009174 Bacteria 3211
157 Ga0105241_10236257 3300009174 Bacteria 1543
158 Ga0105242_10035365 3300009176 Bacteria 4007
159 Ga0105242_10195670 3300009176 Unclassified 1793
160 Ga0105242_10231655 3300009176 Bacteria 1656
161 Ga0105248_10070208 3300009177 Bacteria 3934
162 Ga0105237_10004798 3300009545 Bacteria 15534
163 Ga0105238_10002808 3300009551 Bacteria 17379
164 Ga0105239_10003707 3300010375 Bacteria 18605
165 Ga0105239_10045425 3300010375 Bacteria 4814
166 Ga0105239_10049061 3300010375 Bacteria 4629
167 Ga0105239_10714539 3300010375 Bacteria 1146
168 Ga0105246_10001969 3300011119 Bacteria 12386
169 Ga0105246_10002811 3300011119 Bacteria 10541
170 Ga0105246_10028440 3300011119 Bacteria 3672
171 Ga0157373_10148847 3300013100 Archaea 1647
172 Ga0157373_10199848 3300013100 Bacteria 1409
173 Ga0157371_10078054 3300013102 Bacteria 2345
174 Ga0157370_10011763 3300013104 Bacteria 9136
175 Ga0157369_10010311 3300013105 Bacteria 10657
176 Ga0157369_10188976 3300013105 Bacteria 2165
177 Ga0157374_10002678 3300013296 Bacteria 14979
178 Ga0157374_10003301 3300013296 Bacteria 13548
179 Ga0157374_10003342 3300013296 Bacteria 13469
180 Ga0157374_10012715 3300013296 Bacteria 7333
181 Ga0163162_10005424 3300013306 Bacteria 12325
182 Ga0163162_10019631 3300013306 Bacteria 6634
183 Ga0157372_10003850 3300013307 Bacteria 16125
184 Ga0157372_10013574 3300013307 Bacteria 8707
185 Ga0157372_10022423 3300013307 Bacteria 6833
186 Ga0157375_10017434 3300013308 Bacteria 6480
187 Ga0157375_10042086 3300013308 Bacteria 4418
188 Ga0157375_10111147 3300013308 Bacteria 2839
189 Ga0157375_10274510 3300013308 Bacteria 1848
190 Ga0157375_10630571 3300013308 Bacteria 1229
191 Ga0163163_10027558 3300014325 Bacteria 5444
192 Ga0163163_10067237 3300014325 Bacteria 3562
193 Ga0163163_10081626 3300014325 Bacteria 3235
194 Ga0163163_10245185 3300014325 Bacteria 1842
195 Ga0157380_10084091 3300014326 Bacteria 2609
196 Ga0157377_10001237 3300014745 Bacteria 10917
197 Ga0157377_10009737 3300014745 Bacteria 4729
198 Ga0157377_10037033 3300014745 Bacteria 2687
199 Ga0157379_10175115 3300014968 Bacteria 1937
200 Ga0157379_10256140 3300014968 Bacteria 1589
201 Ga0157376_10132446 3300014969 Bacteria 2226
202 Ga0206356_10842373 3300020070 Bacteria 1116
203 Ga0206356_11122414 3300020070 Bacteria 3750
204 Ga0206349_1339099 3300020075 Bacteria 2244
205 Ga0206352_11301019 3300020078 Archaea 5903
206 Ga0206354_10245646 3300020081 Bacteria 9131
207 Ga0206353_11975239 3300020082 Bacteria 3139
208 Ga0224712_10006275 3300022467 Bacteria 3377
209 Ga0224712_10010843 3300022467 Bacteria 2802
210 Ga0209672_100006 3300025228 Bacteria 1004497
211 Ga0209147_100361 3300025229 Bacteria 32545
212 Ga0209258_104363 3300025242 Bacteria 2708
213 Ga0209148_1000152 3300025254 Bacteria 153782
214 Ga0209455_1000134 3300025272 Bacteria 153783
215 Ga0207692_10054037 3300025898 Bacteria 2048
216 Ga0207710_10034819 3300025900 Bacteria 2214
217 Ga0207688_10001423 3300025901 Bacteria 12481
218 Ga0207688_10003499 3300025901 Bacteria 8567
219 Ga0207688_10014599 3300025901 Bacteria 4267
220 Ga0207688_10226646 3300025901 Bacteria 1127
221 Ga0207643_10000606 3300025908 Bacteria 22663
222 Ga0207705_10004986 3300025909 Bacteria 9961
223 Ga0207684_10009419 3300025910 Bacteria 8625
224 Ga0207684_10228830 3300025910 Bacteria 1604
225 Ga0207654_10134390 3300025911 Bacteria 1569
226 Ga0207654_10310518 3300025911 Archaea 1075
227 Ga0207707_10025058 3300025912 Bacteria 5218
228 Ga0207671_10020732 3300025914 Bacteria 4999
229 Ga0207693_10007941 3300025915 Bacteria 8718
230 Ga0207693_10038941 3300025915 Bacteria 3742
231 Ga0207693_10044881 3300025915 Bacteria 3473
232 Ga0207693_10334605 3300025915 Bacteria 1185
233 Ga0207663_10007749 3300025916 Bacteria 5591
234 Ga0207663_10142862 3300025916 Bacteria 1669
235 Ga0207660_10019868 3300025917 Bacteria 4499
236 Ga0207657_10001341 3300025919 Bacteria 26174
237 Ga0207657_10031770 3300025919 Bacteria 4777
238 Ga0207657_10276977 3300025919 Bacteria 1333
239 Ga0207649_10002798 3300025920 Bacteria 9630
240 Ga0207649_10079554 3300025920 Bacteria 2118
241 Ga0207652_10055353 3300025921 Bacteria 3411
242 Ga0207694_10008682 3300025924 Bacteria 7670
243 Ga0207650_10004299 3300025925 Bacteria 9722
244 Ga0207659_10167633 3300025926 Bacteria 1730
245 Ga0207659_10333847 3300025926 Archaea 1254
246 Ga0207687_10000308 3300025927 Bacteria 33182
247 Ga0207687_10092976 3300025927 Bacteria 2204
248 Ga0207687_10101168 3300025927 Bacteria 2121
249 Ga0207687_10468177 3300025927 Bacteria 1047
250 Ga0207664_10010767 3300025929 Bacteria 6468
251 Ga0207664_10037154 3300025929 Bacteria 3767
252 Ga0207664_10068479 3300025929 Bacteria 2851
253 Ga0207664_10157440 3300025929 Bacteria 1935
254 Ga0207664_10371412 3300025929 Bacteria 1269
255 Ga0207644_10033384 3300025931 Bacteria 3595
256 Ga0207644_10104217 3300025931 Bacteria 2135
257 Ga0207690_10008529 3300025932 Bacteria 6081
258 Ga0207690_10029086 3300025932 Bacteria 3510
259 Ga0207706_10020067 3300025933 Bacteria 6005
260 Ga0207686_10055085 3300025934 Bacteria 2493
261 Ga0207686_10258499 3300025934 Bacteria 1275
262 Ga0207709_10062604 3300025935 Bacteria 2329
263 Ga0207709_10088994 3300025935 Bacteria 2012
264 Ga0207670_10085041 3300025936 Bacteria 2222
265 Ga0207670_10305996 3300025936 Bacteria 1246
266 Ga0207669_10096645 3300025937 Bacteria 1940
267 Ga0207691_10008044 3300025940 Bacteria 10138
268 Ga0207711_10211823 3300025941 Bacteria 1770
269 Ga0207689_10004531 3300025942 Bacteria 12579
270 Ga0207689_10131676 3300025942 Bacteria 2058
271 Ga0207661_10005582 3300025944 Bacteria 8870
272 Ga0207661_10067753 3300025944 Bacteria 2904
273 Ga0207661_10081819 3300025944 Bacteria 2668
274 Ga0207661_10173529 3300025944 Bacteria 1878
275 Ga0207679_10004889 3300025945 Bacteria 8352
276 Ga0207667_10019174 3300025949 Bacteria 7650
277 Ga0207667_10242372 3300025949 Bacteria 1845
278 Ga0207712_10018704 3300025961 Bacteria 4515
279 Ga0207712_10160315 3300025961 Bacteria 1747
280 Ga0207677_10004622 3300026023 Archaea 7406
281 Ga0207677_10017538 3300026023 Bacteria 4273
282 Ga0207677_10271143 3300026023 Bacteria 1388
283 Ga0207677_10402500 3300026023 Bacteria 1161
284 Ga0207677_10598889 3300026023 Bacteria 967
285 Ga0207703_10106398 3300026035 Archaea 2386
286 Ga0207678_10001514 3300026067 Bacteria 21304
287 Ga0207678_10082132 3300026067 Bacteria 2758
288 Ga0207678_10129985 3300026067 Bacteria 2148
289 Ga0207708_10002246 3300026075 Bacteria 14222
290 Ga0207708_10022166 3300026075 Bacteria 4796
291 Ga0207708_10085518 3300026075 Bacteria 2426
292 Ga0207702_10005744 3300026078 Bacteria 10806
293 Ga0207702_10007043 3300026078 Bacteria 9621
294 Ga0207702_10036963 3300026078 Bacteria 4085
295 Ga0207702_10295183 3300026078 Bacteria 1537
296 Ga0207648_10049975 3300026089 Bacteria 3657
297 Ga0207648_10169743 3300026089 Bacteria 1928
298 Ga0207676_10256271 3300026095 Bacteria 1577
299 Ga0207676_10453318 3300026095 Archaea 1209
300 Ga0207676_10594311 3300026095 Bacteria 1062
301 Ga0207674_10011283 3300026116 Bacteria 10043
302 Ga0207674_10386134 3300026116 Bacteria 1354
303 Ga0207683_10006736 3300026121 Bacteria 9834
304 Ga0207683_10187637 3300026121 Bacteria 1876
305 Ga0207698_10004488 3300026142 Bacteria 8515
306 Ga0207698_10591631 3300026142 Bacteria 1093
307 Ga0207428_10020174 3300027907 Bacteria 5667
308 Ga0307509_10259163 3300031507 Bacteria 1516
309 Ga0307405_10086042 3300031731 Bacteria 2068
310 Ga0307413_10046128 3300031824 Bacteria 2589
311 Ga0307406_10194412 3300031901 Bacteria 1488
312 Ga0307409_100032457 3300031995 Bacteria 3786
313 Ga0307416_100010252 3300032002 Bacteria 6180
314 Ga0307414_10233562 3300032004 Bacteria 1518
315 Ga0307415_100002942 3300032126 Bacteria 8549
316 Ga0373927_0092856 3300035695 Archaea 1961
317 Ga0373933_0055012 3300035724 Bacteria 2386
318 Ga0373937_0007413 3300036401 Bacteria 9497
319 Ga0373937_0010438 3300036401 Bacteria 8112
320 Ga0373925_0031109 3300037068 Bacteria 3920
321 Ga0395899_0004454 3300037312 Bacteria 10925
322 Ga0395899_0022829 3300037312 Bacteria 4740
323 Ga0395899_0033141 3300037312 Bacteria 3880
324 Ga0395899_0070992 3300037312 Bacteria 2548
325 Ga0395899_0126097 3300037312 Bacteria 1831
326 Ga0395899_0158588 3300037312 Bacteria 1600
327 Ga0395899_0187587 3300037312 Bacteria 1448
328 Ga0395899_0229490 3300037312 Bacteria 1282
329 Ga0395900_0009015 3300037418 Bacteria 10229
330 Ga0395900_0012667 3300037418 Bacteria 8622
331 Ga0395900_0020713 3300037418 Bacteria 6720
332 Ga0395900_0033873 3300037418 Bacteria 5256
333 Ga0395900_0036646 3300037418 Bacteria 5057
334 Ga0395900_0048658 3300037418 Bacteria 4367
335 Ga0395900_0085170 3300037418 Bacteria 3248
336 Ga0395900_0093112 3300037418 Bacteria 3096
337 Ga0395900_0199500 3300037418 Bacteria 2025
338 Ga0395900_0242465 3300037418 Bacteria 1807
339 Ga0395900_0290917 3300037418 Bacteria 1622
340 Ga0395900_0390205 3300037418 Bacteria 1358
341 Ga0395900_0393563 3300037418 Bacteria 1351
342 Ga0395900_0640278 3300037418 Bacteria 1000
343 Ga0395898_0007072 3300037466 Bacteria 11920
344 Ga0395898_0009812 3300037466 Bacteria 10033
345 Ga0395898_0012957 3300037466 Bacteria 8599
346 Ga0395898_0021157 3300037466 Bacteria 6598
347 Ga0395898_0033139 3300037466 Bacteria 5156
348 Ga0395898_0034189 3300037466 Bacteria 5068
349 Ga0395898_0089085 3300037466 Bacteria 2970
350 Ga0395898_0109690 3300037466 Bacteria 2645
351 Ga0395898_0124948 3300037466 Bacteria 2465
352 Ga0395898_0138046 3300037466 Bacteria 2334
353 Ga0395898_0217976 3300037466 Bacteria 1820
354 Ga0395898_0257091 3300037466 Bacteria 1665
355 Ga0395898_0534191 3300037466 Bacteria 1114
356 Ga0395905_0012110 3300037471 Bacteria 8310
357 Ga0395905_0025084 3300037471 Bacteria 5623
358 Ga0395905_0035827 3300037471 Bacteria 4660
359 Ga0395905_0045264 3300037471 Bacteria 4127
360 Ga0395905_0124316 3300037471 Archaea 2426
361 Ga0395905_0162269 3300037471 Bacteria 2100
362 Ga0395905_0163959 3300037471 Bacteria 2088
363 Ga0395905_0236485 3300037471 Bacteria 1707
364 Ga0436364_0179355 3300037853 Bacteria 2310
365 Ga0395901_0005566 3300038443 Bacteria 12744
366 Ga0395901_0006511 3300038443 Bacteria 11815
367 Ga0395901_0012654 3300038443 Bacteria 8560
368 Ga0395901_0032337 3300038443 Bacteria 5398
369 Ga0395901_0085479 3300038443 Bacteria 3298
370 Ga0395901_0111453 3300038443 Bacteria 2873
371 Ga0395901_0123553 3300038443 Bacteria 2720
372 Ga0395901_0161710 3300038443 Bacteria 2351
373 Ga0395901_0201433 3300038443 Bacteria 2086
374 Ga0395901_0400900 3300038443 Bacteria 1409
375 Ga0395901_0467690 3300038443 Bacteria 1287
376 Ga0436365_0946849 3300039437 Bacteria 13502
377 Ga0436365_0986683 3300039437 Bacteria 32616
378 Ga0436363_0975008 3300039450 Bacteria 1316
379 Ga0451798_0100400 3300041458 Bacteria 1520
380 Ga0451802_0902154 3300041460 Bacteria 1847
381 Ga0451845_0639757 3300041501 Bacteria 1401
382 Ga0451851_0156690 3300041507 Bacteria 3186
383 Ga0439448_0004109 3300042005 Bacteria 4098
384 Ga0439451_011968 3300042009 Unclassified 1750
385 Ga0439455_0028328 3300042012 Bacteria 1379
386 Ga0450888_001904 3300042126 Bacteria 2026
387 Ga0439464_0021857 3300042439 Bacteria 1758
388 Ga0466965_0048420 3300044683 Bacteria 2106
389 Ga0466963_0097509 3300044694 Bacteria 2009
390 Ga0466970_0075546 3300044765 Bacteria 1815
391 Ga0451576_0042306 3300045051 Bacteria 4810
392 Ga0466967_0062794 3300045976 Bacteria 3299
393 Ga0466967_0146862 3300045976 Archaea 2200
394 Ga0495603_0052945 3300046455 Bacteria 2409
395 Ga0495651_0005106 3300046462 Bacteria 10015
396 Ga0495653_0004642 3300046463 Bacteria 11111
397 Ga0495653_0038990 3300046463 Bacteria 3725
398 Ga0495582_0020593 3300046473 Bacteria 3611
399 Ga0495582_0194395 3300046473 Bacteria 1158
400 Ga0495639_0032721 3300046475 Bacteria 2320
401 Ga0495608_0006566 3300046511 Bacteria 8251
402 Ga0495608_0268039 3300046511 Bacteria 1062
403 Ga0495628_0045358 3300046516 Bacteria 3496
404 Ga0495630_0034250 3300046517 Bacteria 3792
405 Ga0495666_0064715 3300046526 Bacteria 1745
406 Ga0495652_0027595 3300046529 Bacteria 5002
407 Ga0495652_0051745 3300046529 Bacteria 3505
408 Ga0495652_0165908 3300046529 Bacteria 1709
409 Ga0495665_0072690 3300046531 Bacteria 1811
410 Ga0495640_0043331 3300046533 Bacteria 3135
411 Ga0495587_0113969 3300046536 Bacteria 1551
412 Ga0495587_0149890 3300046536 Bacteria 1329
413 Ga0495645_0149163 3300046543 Bacteria 1626
414 Ga0495667_0016910 3300046559 Bacteria 4925
415 Ga0495656_0016073 3300046615 Bacteria 2836
416 Ga0495634_0004967 3300046642 Bacteria 10278
417 Ga0495634_0031602 3300046642 Bacteria 3645
418 Ga0495634_0056080 3300046642 Bacteria 2634
419 Ga0495657_0022719 3300046675 Bacteria 4488
420 Ga0495599_0040669 3300046678 Bacteria 2919
421 Ga0495599_0200045 3300046678 Bacteria 1227
422 Ga0495646_0055005 3300046680 Bacteria 2392
423 Ga0495613_0054033 3300046689 Bacteria 2953
424 Ga0495613_0095444 3300046689 Bacteria 2151
425 Ga0495600_0026139 3300046809 Bacteria 3765
426 Ga0495581_0103861 3300047315 Bacteria 1651
427 Ga0495604_0007873 3300047317 Bacteria 8439
428 Ga0495674_0050888 3300047319 Bacteria 3654
429 Ga0495674_0064109 3300047319 Bacteria 3195
430 Ga0495674_0079824 3300047319 Bacteria 2809
431 Ga0495674_0303462 3300047319 Bacteria 1304
432 Ga0495676_0031810 3300047321 Bacteria 4458
433 Ga0495680_0053614 3300047322 Bacteria 3137
434 Ga0495684_0152449 3300047471 Bacteria 1727
435 Ga0495684_0261948 3300047471 Bacteria 1254
436 Ga0495602_0030474 3300048088 Bacteria 5115
437 Ga0496100_0002156 3300048903 Bacteria 9905
438 Ga0496100_0132665 3300048903 Bacteria 1756
439 Ga0496100_0146841 3300048903 Bacteria 1678
440 Ga0496100_0215549 3300048903 Bacteria 1406
441 Ga0496100_0342630 3300048903 Bacteria 1127
442 Ga0496101_0000780 3300048904 Bacteria 18852
443 Ga0496101_0001309 3300048904 Bacteria 14880
444 Ga0496101_0002353 3300048904 Bacteria 11603
445 Ga0496101_0027517 3300048904 Bacteria 3962
446 Ga0496101_0080374 3300048904 Bacteria 2408
447 Ga0496101_0097918 3300048904 Bacteria 2191
448 Ga0496101_0217119 3300048904 Bacteria 1483
449 Ga0496102_0001015 3300048905 Bacteria 26202
450 Ga0496102_0001610 3300048905 Bacteria 19901
451 Ga0496102_0186018 3300048905 Bacteria 1957
452 Ga0496102_0243947 3300048905 Bacteria 1694
453 Ga0496102_0368783 3300048905 Bacteria 1351
454 Ga0496102_0523283 3300048905 Bacteria 1108
455 Ga0496103_0001378 3300048906 Bacteria 16396
456 Ga0496104_0000973 3300048907 Bacteria 24535
457 Ga0496104_0007124 3300048907 Bacteria 9858
458 Ga0496104_0012523 3300048907 Bacteria 7628
459 Ga0496104_0018325 3300048907 Archaea 6387
460 Ga0496104_0094224 3300048907 Bacteria 2864
461 Ga0496105_0000354 3300048908 Bacteria 30235
462 Ga0496105_0001124 3300048908 Bacteria 18636
463 Ga0496105_0003356 3300048908 Bacteria 11836
464 Ga0496105_0005631 3300048908 Bacteria 9529
465 Ga0496105_0107491 3300048908 Bacteria 2303
466 Ga0496106_0000879 3300048909 Bacteria 21883
467 Ga0496106_0004729 3300048909 Bacteria 10076
468 Ga0496106_0062937 3300048909 Bacteria 2818
469 Ga0496106_0112488 3300048909 Bacteria 2121
470 Ga0496106_0200763 3300048909 Bacteria 1587
471 Ga0496106_0324674 3300048909 Bacteria 1235
472 Ga0496107_0005128 3300048910 Bacteria 8936
473 Ga0496107_0012119 3300048910 Bacteria 6013
474 Ga0496107_0031199 3300048910 Bacteria 3801
475 Ga0496107_0031239 3300048910 Bacteria 3799
476 Ga0496107_0132136 3300048910 Bacteria 1843
477 Ga0496107_0136468 3300048910 Bacteria 1812
478 Ga0496108_0002694 3300048911 Bacteria 14211
479 Ga0496108_0005110 3300048911 Bacteria 10605
480 Ga0496108_0015641 3300048911 Bacteria 6188
481 Ga0496108_0023875 3300048911 Bacteria 5033
482 Ga0496108_0269973 3300048911 Bacteria 1480
483 Ga0496108_0440542 3300048911 Bacteria 1138
484 Ga0496109_0008576 3300048912 Bacteria 8698
485 Ga0496109_0013102 3300048912 Bacteria 7173
486 Ga0496109_0013288 3300048912 Bacteria 7133
487 Ga0496109_0024528 3300048912 Bacteria 5362
488 Ga0496109_0024864 3300048912 Bacteria 5330
489 Ga0496109_0038952 3300048912 Bacteria 4300
490 Ga0496109_0443373 3300048912 Bacteria 1226
491 Ga0496110_0005681 3300048913 Bacteria 9795
492 Ga0496110_0006141 3300048913 Bacteria 9472
493 Ga0496110_0007129 3300048913 Bacteria 8898
494 Ga0496110_0011636 3300048913 Bacteria 7214
495 Ga0496110_0035148 3300048913 Bacteria 4345
496 Ga0496111_0000385 3300048914 Bacteria 22042
497 Ga0496111_0010997 3300048914 Bacteria 6090
498 Ga0496111_0316291 3300048914 Bacteria 1156
499 Ga0496112_0000154 3300048915 Bacteria 43098
500 Ga0496112_0000227 3300048915 Bacteria 36412
501 Ga0496112_0004226 3300048915 Bacteria 12119
502 Ga0496112_0009739 3300048915 Bacteria 8675
503 Ga0496112_0095908 3300048915 Bacteria 2936
504 Ga0496113_0003446 3300048916 Bacteria 9467
505 Ga0496113_0096644 3300048916 Bacteria 2284
506 Ga0496113_0220692 3300048916 Bacteria 1510
507 Ga0496114_0000503 3300048917 Bacteria 28593
508 Ga0496114_0018248 3300048917 Bacteria 5671
509 Ga0496114_0075546 3300048917 Bacteria 2838
510 Ga0496114_0140331 3300048917 Bacteria 2092
511 Ga0496114_0349840 3300048917 Archaea 1307
512 Ga0496114_0407489 3300048917 Bacteria 1204
513 Ga0496114_0449650 3300048917 Unclassified 1141
514 Ga0496115_0000321 3300048918 Bacteria 40923
515 Ga0496115_0001224 3300048918 Bacteria 18426
516 Ga0496115_0016300 3300048918 Bacteria 5655
517 Ga0496115_0086734 3300048918 Bacteria 2554
518 Ga0496115_0113108 3300048918 Archaea 2230
519 Ga0496115_0206202 3300048918 Bacteria 1624
520 Ga0501068_0243170 3300049584 Bacteria 1146
521 Ga0501071_0491281 3300049587 Bacteria 941
522 nmdc:mga05p37_166947_c1 3300050507 Bacteria 2686
523 nmdc:mga05p37_189140_c1 3300050507 Bacteria 2501
524 nmdc:mga05p37_361471_c1 3300050507 Bacteria 1706
525 nmdc:mga05p37_3693_c1 3300050507 Bacteria 17901
526 nmdc:mga06r32_290896_c1 3300050510 Bacteria 1620
527 nmdc:mga08y16_587591_c1 3300050511 Bacteria 1123
528 nmdc:mga08y16_72082_c1 3300050511 Bacteria 3600
529 nmdc:mga08y16_78205_c1 3300050511 Bacteria 3448
530 nmdc:mga0n895_113340_c1 3300050512 Bacteria 2729
531 nmdc:mga0n895_378899_c1 3300050512 Bacteria 1432
532 nmdc:mga0n895_8511_c1 3300050512 Bacteria 8889
533 nmdc:mga0rr50_240978_c1 3300050513 Bacteria 1499
534 nmdc:mga0rr50_287209_c1 3300050513 Bacteria 1374
535 nmdc:mga0rr50_3454_c1 3300050513 Bacteria 9094
536 nmdc:mga0rr50_365737_c1 3300050513 Archaea 1214
537 nmdc:mga0rr50_467821_c1 3300050513 Bacteria 1070
538 nmdc:mga0rr50_516124_c1 3300050513 Bacteria 1016
539 nmdc:mga08x19_86884_c1 3300050514 Bacteria 2060
540 nmdc:mga0a205_110564_c1 3300050515 Bacteria 2647
541 nmdc:mga0a205_11591_c1 3300050515 Bacteria 7037
542 nmdc:mga0a205_12828_c1 3300050515 Bacteria 7773
543 nmdc:mga0a205_170991_c1 3300050515 Bacteria 2069
544 nmdc:mga0a205_20306_c1 3300050515 Bacteria 6265
545 nmdc:mga0a205_383836_c1 3300050515 Bacteria 1270
546 Ga0495601_0064832 3300053077 Bacteria 2324
547 Ga0495595_0004345 3300053084 Bacteria 5705
548 Ga0495619_0014504 3300053085 Bacteria 4978
549 Ga0501082_0136934 3300060353 Bacteria 2125
550 Ga0530510_0028463 3300061734 Bacteria 4007
551 Ga0496100_0000257
552 JGI24751J29686_10002009
553 JGI25406J46586_10031033
554 JGI25407J50210_10001917
555 JGI25407J50210_10003496
556 JGI25407J50210_10014344
557 JGI25407J50210_10019130
558 Ga0058862_12876957
559 Ga0070658_10006560
560 Ga0070658_10377456
561 Ga0070683_100034301
562 Ga0070683_100058113
563 Ga0070670_100005744
564 Ga0068869_100001470
565 Ga0068869_100075308
566 Ga0070680_100010663
567 Ga0070682_100018321
568 Ga0070682_100027032
569 Ga0068868_100002936
570 Ga0068868_100011183
571 Ga0068868_100040994
572 Ga0068868_100147687
573 Ga0070660_100008359
574 Ga0070660_100019853
575 Ga0070660_100295679
576 Ga0070689_100245694
577 Ga0070691_10040537
578 Ga0070691_10054478
579 Ga0070661_100003306
580 Ga0070661_100080849
581 Ga0070668_100034866
582 Ga0070675_100017374
583 Ga0070675_100140791
584 Ga0070671_100004157
585 Ga0070671_100043762
586 Ga0070674_100078642
587 Ga0070673_100140844
588 Ga0070659_100012632
589 Ga0070659_100044216
590 Ga0070709_10158626
591 Ga0070714_100021350
592 Ga0070714_100177616
593 Ga0070714_100388044
594 Ga0070713_100213701
595 Ga0070713_100381836
596 Ga0070710_10030380
597 Ga0070710_10172077
598 Ga0070711_100187567
599 Ga0070700_100074066
600 Ga0070700_100075767
601 Ga0070663_100033461
602 Ga0070663_100126144
603 Ga0070678_100002579
604 Ga0070662_100068011
605 Ga0070662_100312940
606 Ga0070681_10004311
607 Ga0070685_10258057
608 Ga0070706_100022791
609 Ga0070707_100128446
610 Ga0070698_100003489
611 Ga0070684_100024628
612 Ga0070697_100297665
613 Ga0070672_100006945
614 Ga0070695_100412526
615 Ga0070693_100050284
616 Ga0070665_100040951
617 Ga0070704_100068418
618 Ga0068855_100006271
619 Ga0068855_100040991
620 Ga0070664_100006643
621 Ga0068857_100367713
622 Ga0068854_100014745
623 Ga0068856_100001346
624 Ga0068856_100003992
625 Ga0068856_100019431
626 Ga0070702_100018007
627 Ga0070702_100025557
628 Ga0070702_100154748
629 Ga0070702_100206609
630 Ga0068852_100049529
631 Ga0068852_100410335
632 Ga0068859_100220599
633 Ga0068864_100005057
634 Ga0068864_100081915
635 Ga0068866_10061027
636 Ga0068851_10131140
637 Ga0068870_10010138
638 Ga0081455_10012526
639 Ga0081455_10058166
640 Ga0081538_10000736
641 Ga0081538_10002319
642 Ga0081538_10002644
643 Ga0081538_10007388
644 Ga0081538_10012670
645 Ga0081538_10013358
646 Ga0081538_10013470
647 Ga0081538_10021637
648 Ga0081538_10028543
649 Ga0081538_10034945
650 Ga0081538_10053065
651 Ga0081538_10070259
652 Ga0081538_10122165
653 Ga0081540_1000153
654 Ga0081540_1012199
655 Ga0081540_1020468
656 Ga0081539_10001486
657 Ga0081539_10009074
658 Ga0081539_10031052
659 Ga0070717_10003371
660 Ga0070717_10022862
661 Ga0070717_10027285
662 Ga0070717_10054091
663 Ga0070717_10074951
664 Ga0070717_10195820
665 Ga0075365_10143316
666 Ga0070715_10016838
667 Ga0070716_100089718
668 Ga0070712_100008884
669 Ga0070712_100053675
670 Ga0075428_100111011
671 Ga0075431_100048416
672 Ga0075431_100658221
673 Ga0075433_10011881
674 Ga0075433_10024922
675 Ga0075433_10041906
676 Ga0075433_10062924
677 Ga0075433_10064649
678 Ga0075433_10108371
679 Ga0075433_10259299
680 Ga0075434_100016278
681 Ga0075434_100038860
682 Ga0075434_100238179
683 Ga0075434_100455458
684 Ga0075429_100109406
685 Ga0075429_100230822
686 Ga0075436_100030107
687 Ga0075436_100128158
688 Ga0097620_100220586
689 Ga0075435_100015519
690 Ga0075435_100047246
691 Ga0105251_10027842
692 Ga0105240_10375452
693 Ga0111539_10018228
694 Ga0111539_10031887
695 Ga0105245_10001298
696 Ga0105245_10001761
697 Ga0105245_10006869
698 Ga0105245_10075308
699 Ga0105245_10665550
700 Ga0105247_10016361
701 Ga0114129_10013014
702 Ga0114129_10198135
703 Ga0114129_10209045
704 Ga0105243_10227051
705 Ga0105241_10022621
706 Ga0105241_10049163
707 Ga0105241_10236257
708 Ga0105242_10035365
709 Ga0105242_10195670
710 Ga0105242_10231655
711 Ga0105248_10070208
712 Ga0105237_10004798
713 Ga0105238_10002808
714 Ga0105239_10003707
715 Ga0105239_10045425
716 Ga0105239_10049061
717 Ga0105239_10714539
718 Ga0105246_10001969
719 Ga0105246_10002811
720 Ga0105246_10028440
721 Ga0157373_10148847
722 Ga0157373_10199848
723 Ga0157371_10078054
724 Ga0157370_10011763
725 Ga0157369_10010311
726 Ga0157369_10188976
727 Ga0157374_10002678
728 Ga0157374_10003301
729 Ga0157374_10003342
730 Ga0157374_10012715
731 Ga0163162_10005424
732 Ga0163162_10019631
733 Ga0157372_10003850
734 Ga0157372_10013574
735 Ga0157372_10022423
736 Ga0157375_10017434
737 Ga0157375_10042086
738 Ga0157375_10111147
739 Ga0157375_10274510
740 Ga0157375_10630571
741 Ga0163163_10027558
742 Ga0163163_10067237
743 Ga0163163_10081626
744 Ga0163163_10245185
745 Ga0157380_10084091
746 Ga0157377_10001237
747 Ga0157377_10009737
748 Ga0157377_10037033
749 Ga0157379_10175115
750 Ga0157379_10256140
751 Ga0157376_10132446
752 Ga0206356_10842373
753 Ga0206356_11122414
754 Ga0206349_1339099
755 Ga0206352_11301019
756 Ga0206354_10245646
757 Ga0206353_11975239
758 Ga0224712_10006275
759 Ga0224712_10010843
760 Ga0209672_100006
761 Ga0209147_100361
762 Ga0209258_104363
763 Ga0209148_1000152
764 Ga0209455_1000134
765 Ga0207692_10054037
766 Ga0207710_10034819
767 Ga0207688_10001423
768 Ga0207688_10003499
769 Ga0207688_10014599
770 Ga0207688_10226646
771 Ga0207643_10000606
772 Ga0207705_10004986
773 Ga0207684_10009419
774 Ga0207684_10228830
775 Ga0207654_10134390
776 Ga0207654_10310518
777 Ga0207707_10025058
778 Ga0207671_10020732
779 Ga0207693_10007941
780 Ga0207693_10038941
781 Ga0207693_10044881
782 Ga0207693_10334605
783 Ga0207663_10007749
784 Ga0207663_10142862
785 Ga0207660_10019868
786 Ga0207657_10001341
787 Ga0207657_10031770
788 Ga0207657_10276977
789 Ga0207649_10002798
790 Ga0207649_10079554
791 Ga0207652_10055353
792 Ga0207694_10008682
793 Ga0207650_10004299
794 Ga0207659_10167633
795 Ga0207659_10333847
796 Ga0207687_10000308
797 Ga0207687_10092976
798 Ga0207687_10101168
799 Ga0207687_10468177
800 Ga0207664_10010767
801 Ga0207664_10037154
802 Ga0207664_10068479
803 Ga0207664_10157440
804 Ga0207664_10371412
805 Ga0207644_10033384
806 Ga0207644_10104217
807 Ga0207690_10008529
808 Ga0207690_10029086
809 Ga0207706_10020067
810 Ga0207686_10055085
811 Ga0207686_10258499
812 Ga0207709_10062604
813 Ga0207709_10088994
814 Ga0207670_10085041
815 Ga0207670_10305996
816 Ga0207669_10096645
817 Ga0207691_10008044
818 Ga0207711_10211823
819 Ga0207689_10004531
820 Ga0207689_10131676
821 Ga0207661_10005582
822 Ga0207661_10067753
823 Ga0207661_10081819
824 Ga0207661_10173529
825 Ga0207679_10004889
826 Ga0207667_10019174
827 Ga0207667_10242372
828 Ga0207712_10018704
829 Ga0207712_10160315
830 Ga0207677_10004622
831 Ga0207677_10017538
832 Ga0207677_10271143
833 Ga0207677_10402500
834 Ga0207677_10598889
835 Ga0207703_10106398
836 Ga0207678_10001514
837 Ga0207678_10082132
838 Ga0207678_10129985
839 Ga0207708_10002246
840 Ga0207708_10022166
841 Ga0207708_10085518
842 Ga0207702_10005744
843 Ga0207702_10007043
844 Ga0207702_10036963
845 Ga0207702_10295183
846 Ga0207648_10049975
847 Ga0207648_10169743
848 Ga0207676_10256271
849 Ga0207676_10453318
850 Ga0207676_10594311
851 Ga0207674_10011283
852 Ga0207674_10386134
853 Ga0207683_10006736
854 Ga0207683_10187637
855 Ga0207698_10004488
856 Ga0207698_10591631
857 Ga0207428_10020174
858 Ga0307509_10259163
859 Ga0307405_10086042
860 Ga0307413_10046128
861 Ga0307406_10194412
862 Ga0307409_100032457
863 Ga0307416_100010252
864 Ga0307414_10233562
865 Ga0307415_100002942
866 Ga0373927_0092856
867 Ga0373933_0055012
868 Ga0373937_0007413
869 Ga0373937_0010438
870 Ga0373925_0031109
871 Ga0395899_0004454
872 Ga0395899_0022829
873 Ga0395899_0033141
874 Ga0395899_0070992
875 Ga0395899_0126097
876 Ga0395899_0158588
877 Ga0395899_0187587
878 Ga0395899_0229490
879 Ga0395900_0009015
880 Ga0395900_0012667
881 Ga0395900_0020713
882 Ga0395900_0033873
883 Ga0395900_0036646
884 Ga0395900_0048658
885 Ga0395900_0085170
886 Ga0395900_0093112
887 Ga0395900_0199500
888 Ga0395900_0242465
889 Ga0395900_0290917
890 Ga0395900_0390205
891 Ga0395900_0393563
892 Ga0395900_0640278
893 Ga0395898_0007072
894 Ga0395898_0009812
895 Ga0395898_0012957
896 Ga0395898_0021157
897 Ga0395898_0033139
898 Ga0395898_0034189
899 Ga0395898_0089085
900 Ga0395898_0109690
901 Ga0395898_0124948
902 Ga0395898_0138046
903 Ga0395898_0217976
904 Ga0395898_0257091
905 Ga0395898_0534191
906 Ga0395905_0012110
907 Ga0395905_0025084
908 Ga0395905_0035827
909 Ga0395905_0045264
910 Ga0395905_0124316
911 Ga0395905_0162269
912 Ga0395905_0163959
913 Ga0395905_0236485
914 Ga0436364_0179355
915 Ga0395901_0005566
916 Ga0395901_0006511
917 Ga0395901_0012654
918 Ga0395901_0032337
919 Ga0395901_0085479
920 Ga0395901_0111453
921 Ga0395901_0123553
922 Ga0395901_0161710
923 Ga0395901_0201433
924 Ga0395901_0400900
925 Ga0395901_0467690
926 Ga0436365_0946849
927 Ga0436365_0986683
928 Ga0436363_0975008
929 Ga0451798_0100400
930 Ga0451802_0902154
931 Ga0451845_0639757
932 Ga0451851_0156690
933 Ga0439448_0004109
934 Ga0439451_011968
935 Ga0439455_0028328
936 Ga0450888_001904
937 Ga0439464_0021857
938 Ga0466965_0048420
939 Ga0466963_0097509
940 Ga0466970_0075546
941 Ga0451576_0042306
942 Ga0466967_0062794
943 Ga0466967_0146862
944 Ga0495603_0052945
945 Ga0495651_0005106
946 Ga0495653_0004642
947 Ga0495653_0038990
948 Ga0495582_0020593
949 Ga0495582_0194395
950 Ga0495639_0032721
951 Ga0495608_0006566
952 Ga0495608_0268039
953 Ga0495628_0045358
954 Ga0495630_0034250
955 Ga0495666_0064715
956 Ga0495652_0027595
957 Ga0495652_0051745
958 Ga0495652_0165908
959 Ga0495665_0072690
960 Ga0495640_0043331
961 Ga0495587_0113969
962 Ga0495587_0149890
963 Ga0495645_0149163
964 Ga0495667_0016910
965 Ga0495656_0016073
966 Ga0495634_0004967
967 Ga0495634_0031602
968 Ga0495634_0056080
969 Ga0495657_0022719
970 Ga0495599_0040669
971 Ga0495599_0200045
972 Ga0495646_0055005
973 Ga0495613_0054033
974 Ga0495613_0095444
975 Ga0495600_0026139
976 Ga0495581_0103861
977 Ga0495604_0007873
978 Ga0495674_0050888
979 Ga0495674_0064109
980 Ga0495674_0079824
981 Ga0495674_0303462
982 Ga0495676_0031810
983 Ga0495680_0053614
984 Ga0495684_0152449
985 Ga0495684_0261948
986 Ga0495602_0030474
987 Ga0496100_0002156
988 Ga0496100_0132665
989 Ga0496100_0146841
990 Ga0496100_0215549
991 Ga0496100_0342630
992 Ga0496101_0000780
993 Ga0496101_0001309
994 Ga0496101_0002353
995 Ga0496101_0027517
996 Ga0496101_0080374
997 Ga0496101_0097918
998 Ga0496101_0217119
999 Ga0496102_0001015
1000 Ga0496102_0001610
1001 Ga0496102_0186018
1002 Ga0496102_0243947
1003 Ga0496102_0368783
1004 Ga0496102_0523283
1005 Ga0496103_0001378
1006 Ga0496104_0000973
1007 Ga0496104_0007124
1008 Ga0496104_0012523
1009 Ga0496104_0018325
1010 Ga0496104_0094224
1011 Ga0496105_0000354
1012 Ga0496105_0001124
1013 Ga0496105_0003356
1014 Ga0496105_0005631
1015 Ga0496105_0107491
1016 Ga0496106_0000879
1017 Ga0496106_0004729
1018 Ga0496106_0062937
1019 Ga0496106_0112488
1020 Ga0496106_0200763
1021 Ga0496106_0324674
1022 Ga0496107_0005128
1023 Ga0496107_0012119
1024 Ga0496107_0031199
1025 Ga0496107_0031239
1026 Ga0496107_0132136
1027 Ga0496107_0136468
1028 Ga0496108_0002694
1029 Ga0496108_0005110
1030 Ga0496108_0015641
1031 Ga0496108_0023875
1032 Ga0496108_0269973
1033 Ga0496108_0440542
1034 Ga0496109_0008576
1035 Ga0496109_0013102
1036 Ga0496109_0013288
1037 Ga0496109_0024528
1038 Ga0496109_0024864
1039 Ga0496109_0038952
1040 Ga0496109_0443373
1041 Ga0496110_0005681
1042 Ga0496110_0006141
1043 Ga0496110_0007129
1044 Ga0496110_0011636
1045 Ga0496110_0035148
1046 Ga0496111_0000385
1047 Ga0496111_0010997
1048 Ga0496111_0316291
1049 Ga0496112_0000154
1050 Ga0496112_0000227
1051 Ga0496112_0004226
1052 Ga0496112_0009739
1053 Ga0496112_0095908
1054 Ga0496113_0003446
1055 Ga0496113_0096644
1056 Ga0496113_0220692
1057 Ga0496114_0000503
1058 Ga0496114_0018248
1059 Ga0496114_0075546
1060 Ga0496114_0140331
1061 Ga0496114_0349840
1062 Ga0496114_0407489
1063 Ga0496114_0449650
1064 Ga0496115_0000321
1065 Ga0496115_0001224
1066 Ga0496115_0016300
1067 Ga0496115_0086734
1068 Ga0496115_0113108
1069 Ga0496115_0206202
1070 Ga0501068_0243170
1071 Ga0501071_0491281
1072 nmdc:mga05p37_166947_c1
1073 nmdc:mga05p37_189140_c1
1074 nmdc:mga05p37_361471_c1
1075 nmdc:mga05p37_3693_c1
1076 nmdc:mga06r32_290896_c1
1077 nmdc:mga08y16_587591_c1
1078 nmdc:mga08y16_72082_c1
1079 nmdc:mga08y16_78205_c1
1080 nmdc:mga0n895_113340_c1
1081 nmdc:mga0n895_378899_c1
1082 nmdc:mga0n895_8511_c1
1083 nmdc:mga0rr50_240978_c1
1084 nmdc:mga0rr50_287209_c1
1085 nmdc:mga0rr50_3454_c1
1086 nmdc:mga0rr50_365737_c1
1087 nmdc:mga0rr50_467821_c1
1088 nmdc:mga0rr50_516124_c1
1089 nmdc:mga08x19_86884_c1
1090 nmdc:mga0a205_110564_c1
1091 nmdc:mga0a205_11591_c1
1092 nmdc:mga0a205_12828_c1
1093 nmdc:mga0a205_170991_c1
1094 nmdc:mga0a205_20306_c1
1095 nmdc:mga0a205_383836_c1
1096 Ga0495601_0064832
1097 Ga0495595_0004345
1098 Ga0495619_0014504
1099 Ga0501082_0136934
1100 Ga0530510_0028463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

71

317

0.73

PF12146

Hydrolase_4

Serine aminopeptidase, S33

69

317

0.69

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

73

323

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ng7-assembly1.cif.gz_A novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments 0.9009 8 291
4o08-assembly2.cif.gz_B crystal structure of bacillus megaterium epoxide hydrolase in complex with an inhibitor 0.8836 11 288
4inz-assembly2.cif.gz_B the crystal structure of m145a mutant of an epoxide hydrolase from bacillus megaterium 0.8759 11 288
5ng7-assembly1.cif.gz_A novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments 0.8744 8 291
3qyj-assembly1.cif.gz_A crystal structure of alr0039, a putative alpha/beta hydrolase from nostoc sp pcc 7120. 0.8722 4 287
ID Description Score Start End Superfamily
5ng7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9314 8 287 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9119 7 96 3.40.50.12270
af_I6YCQ4_15_321_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.908 9 285 3.40.50.1820
af_A0A0R4ILH2_75_359_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9073 11 285 3.40.50.1820
af_G5EBI4_116_401_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9003 7 285 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A538G0T9-F1-model_v4 Alpha/beta hydrolase 0.9922 72 287 GO:0016787
AF-A0A1E3L2N2-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.9661 4 286 GO:0018786
AF-A0A538G0T9-F1-model_v4 Alpha/beta hydrolase 0.9612 72 287 GO:0016787
AF-A0A1E3L2N2-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.9464 4 286 GO:0018786
AF-A0A6L9IK50-F1-model_v4 Alpha/beta hydrolase 0.9418 6 284 GO:0016787

Map