metagRoot

F462514

General Info

Members	Datasets	Scaffolds	Average Seq Length
550	288	541	144

Family's Representative Sequence

Representative Sequence	3300028794\|Ga0307515_10774266\|Ga0307515_107742661
Length	133
Sequence	MTMDWTLEVVVLPVSDIARSIEFYRDLVGFHLDHDTTNEWMHVVQLTPQGSGCSIVIGDLPSQNEMAPGSMRALQLVVSDAAAGRAELVARGVECSELMSFGDQDGSTWSVQELRVRAEKPLIPVEARGRFAE

Samples

	Sample ID	Description	Type	Environment
1	2585428094	Herbiconiux sp. YR403	Isolate	Rhizosphere
2	2643221572	Leifsonia sp. Root60	Isolate	Unclassified
3	2643221649	Leifsonia sp. Root4	Isolate	Unclassified
4	2643221669	Leifsonia sp. Root1293	Isolate	Unclassified
5	2852643534	Leifsonia sp. AK011	Isolate	Rhizosphere
6	2857481737	Nocardioides sp. R-74106	Isolate	Unclassified
7	2895660088	Leifsonia flava SYP-B2174	Isolate	Rhizosphere
8	2920879853	Kocuria salina CV6	Isolate	Unclassified
9	2945941187	Arthrobacter pascens W1I14	Isolate	Rhizosphere
10	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
11	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
12	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
13	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
14	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
15	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
16	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
17	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
18	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
19	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
20	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
21	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
24	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
25	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
26	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
27	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
28	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
29	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
30	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
31	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
32	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
33	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
34	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
35	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
36	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
37	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
38	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
39	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
40	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
41	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
42	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
43	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
44	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
45	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
46	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
47	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
48	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
49	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
50	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
51	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
52	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
53	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
54	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
55	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
56	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
57	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
58	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
59	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
60	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
61	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
62	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
63	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
64	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
65	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
66	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
67	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
68	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
69	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
70	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
71	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
72	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
73	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
74	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
75	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
76	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
77	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
78	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
79	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
80	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
81	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
82	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
83	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
84	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
85	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
86	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
88	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
89	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
91	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
92	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
93	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
94	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
95	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
96	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
97	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
98	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
99	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
100	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
101	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
102	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
103	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
104	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
105	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
106	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
107	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
108	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
109	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
110	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
111	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
112	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
113	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
114	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
168	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
172	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
173	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
174	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
175	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
176	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
177	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
178	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
179	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
180	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
181	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
182	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
183	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
184	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
185	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
186	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
187	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
188	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
189	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
190	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
191	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
192	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
193	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
194	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
195	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
196	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
197	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
198	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
199	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
200	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
201	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
202	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
203	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
204	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
205	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
206	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
207	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
208	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
209	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
210	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
211	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
212	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
213	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
214	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
215	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
216	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
217	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
218	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
219	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
220	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
221	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
222	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
223	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
224	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
225	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
226	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
227	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
228	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
229	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
230	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
231	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
232	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
233	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
234	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
235	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
236	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
237	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
238	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
239	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
240	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
241	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
242	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
243	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
244	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
245	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
246	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
247	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
248	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
249	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
251	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
252	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
253	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
254	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
255	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
256	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
257	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
258	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
259	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
260	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
261	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
262	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
263	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
264	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
265	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
266	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
267	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
268	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
269	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
270	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
271	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
272	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
273	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
274	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
275	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
276	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
277	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
278	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
279	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
280	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
281	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
282	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
283	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
284	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
285	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
286	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
287	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
288	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.36
Metatranscriptomes	0
Isolates	1.64

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.36
Nodule	0
Rhizoplane	8.36
Rhizosphere	88.36
Stem	0
Stem Tuber	0
Unclassified	2.91

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1027163	3300001977	Bacteria	790
2	JGI24743J22301_10025260	3300001991	Bacteria	1150
3	JGI24748J21848_1036866	3300002074	Bacteria	615
4	JGI24749J21850_1005044	3300002076	Bacteria	1852
5	JGI24034J26672_10039108	3300002239	Bacteria	792
6	Ga0065714_10169750	3300005288	Bacteria	1010
7	Ga0065714_10219366	3300005288	Bacteria	845
8	Ga0070683_100017680	3300005329	Bacteria	6300
9	Ga0070683_100179987	3300005329	Bacteria	2006
10	Ga0070690_100019145	3300005330	Bacteria	4149
11	Ga0070690_100579838	3300005330	Bacteria	849
12	Ga0070670_100341391	3300005331	Unclassified	1315
13	Ga0068869_100229728	3300005334	Unclassified	1474
14	Ga0068869_100842459	3300005334	Bacteria	790
15	Ga0070666_10180155	3300005335	Unclassified	1482
16	Ga0070682_100015143	3300005337	Bacteria	4465
17	Ga0070682_100018034	3300005337	Bacteria	4119
18	Ga0070682_100049254	3300005337	Bacteria	2626
19	Ga0068868_100619650	3300005338	Bacteria	960
20	Ga0070660_100010411	3300005339	Bacteria	6573
21	Ga0070660_100225909	3300005339	Unclassified	1522
22	Ga0070660_100931865	3300005339	Bacteria	733
23	Ga0070691_10024237	3300005341	Bacteria	2820
24	Ga0070691_10060550	3300005341	Unclassified	1820
25	Ga0070691_10175071	3300005341	Bacteria	1114
26	Ga0070687_100023497	3300005343	Bacteria	2931
27	Ga0070687_100102173	3300005343	Bacteria	1607
28	Ga0070661_100222704	3300005344	Unclassified	1447
29	Ga0070692_10023028	3300005345	Bacteria	3048
30	Ga0070692_10025843	3300005345	Bacteria	2898
31	Ga0070692_10167984	3300005345	Bacteria	1262
32	Ga0070692_10528520	3300005345	Bacteria	769
33	Ga0070668_100055407	3300005347	Bacteria	3060
34	Ga0070668_100092877	3300005347	Bacteria	2381
35	Ga0070669_100025427	3300005353	Bacteria	4252
36	Ga0070669_100263101	3300005353	Bacteria	1377
37	Ga0070669_100630736	3300005353	Bacteria	900
38	Ga0070669_101550776	3300005353	Bacteria	576
39	Ga0070675_100004289	3300005354	Bacteria	10863
40	Ga0070675_100238316	3300005354	Bacteria	1589
41	Ga0070675_100922685	3300005354	Bacteria	801
42	Ga0070671_101976695	3300005355	Bacteria	519
43	Ga0070674_100011904	3300005356	Bacteria	5318
44	Ga0070674_100105358	3300005356	Unclassified	2062
45	Ga0070673_100023884	3300005364	Bacteria	4473
46	Ga0070673_100043691	3300005364	Bacteria	3464
47	Ga0070688_100020775	3300005365	Bacteria	3824
48	Ga0070688_100232962	3300005365	Bacteria	1304
49	Ga0070659_100052392	3300005366	Bacteria	3209
50	Ga0070703_10179676	3300005406	Unclassified	816
51	Ga0070709_10232160	3300005434	Bacteria	1321
52	Ga0070710_10314854	3300005437	Bacteria	1025
53	Ga0070701_10056913	3300005438	Unclassified	2048
54	Ga0070701_10081540	3300005438	Unclassified	1752
55	Ga0070711_100782291	3300005439	Bacteria	808
56	Ga0070705_100118724	3300005440	Unclassified	1704
57	Ga0070705_100938735	3300005440	Bacteria	698
58	Ga0070700_100006741	3300005441	Bacteria	6153
59	Ga0070700_100360942	3300005441	Bacteria	1080
60	Ga0070700_100738168	3300005441	Unclassified	787
61	Ga0070694_100039011	3300005444	Bacteria	3159
62	Ga0070663_100031380	3300005455	Bacteria	3652
63	Ga0070678_100043563	3300005456	Bacteria	3198
64	Ga0070662_100254922	3300005457	Unclassified	1412
65	Ga0070662_100766602	3300005457	Bacteria	819
66	Ga0068867_100002329	3300005459	Bacteria	13369
67	Ga0068867_100003080	3300005459	Bacteria	11747
68	Ga0068867_100327391	3300005459	Bacteria	1271
69	Ga0070685_10016879	3300005466	Bacteria	3896
70	Ga0070707_100231107	3300005468	Bacteria	1800
71	Ga0070698_100007299	3300005471	Bacteria	11966
72	Ga0070684_100120394	3300005535	Unclassified	2361
73	Ga0070684_100170327	3300005535	Bacteria	1978
74	Ga0068853_100010945	3300005539	Bacteria	7351
75	Ga0070672_100030240	3300005543	Bacteria	4068
76	Ga0070686_100030685	3300005544	Bacteria	3280
77	Ga0070686_100296486	3300005544	Bacteria	1198
78	Ga0070695_100041728	3300005545	Bacteria	2909
79	Ga0070695_100282981	3300005545	Bacteria	1219
80	Ga0070695_100616658	3300005545	Bacteria	853
81	Ga0070696_100707464	3300005546	Bacteria	822
82	Ga0070696_100821194	3300005546	Bacteria	766
83	Ga0070693_100011644	3300005547	Bacteria	4433
84	Ga0070665_101510666	3300005548	Bacteria	680
85	Ga0070704_100598107	3300005549	Bacteria	969
86	Ga0068855_100046982	3300005563	Bacteria	5102
87	Ga0070664_100033681	3300005564	Bacteria	4293
88	Ga0070664_100764941	3300005564	Bacteria	902
89	Ga0070664_101125238	3300005564	Bacteria	740
90	Ga0068857_100137162	3300005577	Unclassified	2209
91	Ga0068854_100020357	3300005578	Bacteria	4488
92	Ga0068854_100029523	3300005578	Bacteria	3796
93	Ga0068854_100065990	3300005578	Bacteria	2633
94	Ga0068856_100445646	3300005614	Bacteria	1315
95	Ga0070702_100001994	3300005615	Bacteria	8606
96	Ga0070702_100003308	3300005615	Bacteria	7189
97	Ga0070702_100026896	3300005615	Unclassified	3097
98	Ga0070702_100229975	3300005615	Bacteria	1245
99	Ga0070702_100630045	3300005615	Bacteria	808
100	Ga0070702_100778240	3300005615	Bacteria	738
101	Ga0068852_100010552	3300005616	Bacteria	6910
102	Ga0068852_100147265	3300005616	Bacteria	2186
103	Ga0068859_100255334	3300005617	Bacteria	1843
104	Ga0068859_100363646	3300005617	Bacteria	1542
105	Ga0068859_100887054	3300005617	Bacteria	977
106	Ga0068864_100009166	3300005618	Bacteria	8159
107	Ga0068864_101019165	3300005618	Bacteria	822
108	Ga0068866_10071642	3300005718	Bacteria	1834
109	Ga0068866_10096898	3300005718	Bacteria	1619
110	Ga0068861_100005215	3300005719	Bacteria	8753
111	Ga0068861_100008280	3300005719	Bacteria	7152
112	Ga0068861_100059212	3300005719	Bacteria	2931
113	Ga0068861_100184638	3300005719	Bacteria	1738
114	Ga0068851_10152040	3300005834	Bacteria	1266
115	Ga0068851_10351823	3300005834	Bacteria	857
116	Ga0068870_10016739	3300005840	Bacteria	3511
117	Ga0068870_10386880	3300005840	Bacteria	907
118	Ga0068858_100079240	3300005842	Bacteria	3053
119	Ga0068860_100077330	3300005843	Bacteria	3164
120	Ga0068860_100197200	3300005843	Bacteria	1950
121	Ga0068860_100942818	3300005843	Bacteria	880
122	Ga0068860_101264880	3300005843	Bacteria	758
123	Ga0068862_100099747	3300005844	Bacteria	2539
124	Ga0068862_100229878	3300005844	Bacteria	1682
125	Ga0070717_10026348	3300006028	Bacteria	4636
126	Ga0075365_10022040	3300006038	Bacteria	3984
127	Ga0070716_100032581	3300006173	Bacteria	2843
128	Ga0070712_100380879	3300006175	Bacteria	1161
129	Ga0075428_101034621	3300006844	Bacteria	869
130	Ga0075430_100513001	3300006846	Bacteria	989
131	Ga0075433_10002932	3300006852	Bacteria	13092
132	Ga0075434_100018093	3300006871	Bacteria	6798
133	Ga0075434_100412014	3300006871	Bacteria	1372
134	Ga0068865_100031907	3300006881	Bacteria	3515
135	Ga0068865_100569262	3300006881	Bacteria	954
136	Ga0075436_100604632	3300006914	Bacteria	808
137	Ga0075436_100618769	3300006914	Bacteria	799
138	Ga0075436_101078510	3300006914	Bacteria	604
139	Ga0097620_100255333	3300006931	Bacteria	1843
140	Ga0097620_100363644	3300006931	Bacteria	1542
141	Ga0097620_100887088	3300006931	Bacteria	977
142	Ga0075435_100003524	3300007076	Bacteria	10618
143	Ga0075435_100665779	3300007076	Bacteria	904
144	Ga0105244_10076490	3300009036	Bacteria	1662
145	Ga0111539_10195343	3300009094	Bacteria	2360
146	Ga0111539_10327844	3300009094	Bacteria	1782
147	Ga0111539_10657495	3300009094	Bacteria	1220
148	Ga0111539_10677577	3300009094	Bacteria	1200
149	Ga0111539_11074586	3300009094	Bacteria	935
150	Ga0111539_12402459	3300009094	Bacteria	611
151	Ga0105245_10011121	3300009098	Bacteria	7834
152	Ga0105245_10160734	3300009098	Bacteria	2131
153	Ga0105245_10242040	3300009098	Bacteria	1749
154	Ga0105245_10352190	3300009098	Bacteria	1459
155	Ga0105245_10384371	3300009098	Bacteria	1399
156	Ga0105245_10774556	3300009098	Bacteria	996
157	Ga0105245_11147955	3300009098	Bacteria	824
158	Ga0105245_11643158	3300009098	Bacteria	694
159	Ga0114129_10184867	3300009147	Bacteria	2833
160	Ga0114129_11032643	3300009147	Bacteria	1033
161	Ga0105243_10011725	3300009148	Bacteria	6629
162	Ga0105243_10026356	3300009148	Bacteria	4449
163	Ga0105241_10032265	3300009174	Bacteria	3926
164	Ga0105242_10121319	3300009176	Unclassified	2244
165	Ga0105248_10016314	3300009177	Bacteria	8175
166	Ga0105248_10042633	3300009177	Bacteria	5089
167	Ga0105248_10151357	3300009177	Bacteria	2618
168	Ga0105238_10035198	3300009551	Bacteria	5092
169	Ga0105238_10321226	3300009551	Bacteria	1534
170	Ga0105249_10003830	3300009553	Bacteria	12981
171	Ga0105249_10004453	3300009553	Bacteria	12116
172	Ga0105249_10315666	3300009553	Bacteria	1573
173	Ga0105239_10063899	3300010375	Bacteria	4041
174	Ga0105239_10157508	3300010375	Bacteria	2537
175	Ga0105246_10116781	3300011119	Bacteria	1970
176	Ga0105246_10182732	3300011119	Bacteria	1616
177	Ga0105246_10206742	3300011119	Bacteria	1530
178	Ga0105246_11785302	3300011119	Bacteria	587
179	Ga0157373_10861580	3300013100	Bacteria	671
180	Ga0157371_10395846	3300013102	Bacteria	1010
181	Ga0157370_10167237	3300013104	Unclassified	2045
182	Ga0157374_10085497	3300013296	Unclassified	2999
183	Ga0157374_12487214	3300013296	Bacteria	545
184	Ga0157378_10080359	3300013297	Bacteria	2945
185	Ga0157378_10233951	3300013297	Bacteria	1752
186	Ga0163162_10018039	3300013306	Bacteria	6907
187	Ga0163162_10043886	3300013306	Bacteria	4476
188	Ga0163162_11443018	3300013306	Bacteria	783
189	Ga0163162_12011244	3300013306	Bacteria	662
190	Ga0157372_10025132	3300013307	Bacteria	6472
191	Ga0157375_10027510	3300013308	Bacteria	5316
192	Ga0157375_10751275	3300013308	Bacteria	1126
193	Ga0157375_10992611	3300013308	Bacteria	980
194	Ga0163163_10022290	3300014325	Bacteria	5994
195	Ga0163163_10231606	3300014325	Unclassified	1896
196	Ga0163163_10247460	3300014325	Bacteria	1833
197	Ga0163163_10338542	3300014325	Bacteria	1559
198	Ga0163163_10560905	3300014325	Bacteria	1205
199	Ga0163163_11211221	3300014325	Bacteria	818
200	Ga0163163_11327734	3300014325	Bacteria	781
201	Ga0157380_10060165	3300014326	Bacteria	3034
202	Ga0157380_10062648	3300014326	Bacteria	2980
203	Ga0157380_10605913	3300014326	Bacteria	1084
204	Ga0157380_10642867	3300014326	Bacteria	1057
205	Ga0157377_10004040	3300014745	Bacteria	6697
206	Ga0157377_10044661	3300014745	Bacteria	2471
207	Ga0157377_10051292	3300014745	Bacteria	2326
208	Ga0157379_10011520	3300014968	Bacteria	7717
209	Ga0157379_11101254	3300014968	Bacteria	761
210	Ga0157376_10335732	3300014969	Bacteria	1442
211	Ga0157376_10619149	3300014969	Bacteria	1079
212	Ga0163161_10006047	3300017792	Bacteria	8389
213	Ga0163161_10016049	3300017792	Bacteria	5228
214	Ga0163161_10038212	3300017792	Bacteria	3443
215	Ga0207697_10101114	3300025315	Bacteria	1229
216	Ga0207656_10493127	3300025321	Bacteria	621
217	Ga0207653_10013265	3300025885	Bacteria	2579
218	Ga0207692_10154457	3300025898	Bacteria	1317
219	Ga0207642_10088339	3300025899	Bacteria	1524
220	Ga0207642_10322963	3300025899	Bacteria	902
221	Ga0207688_10024504	3300025901	Bacteria	3309
222	Ga0207688_10856048	3300025901	Bacteria	576
223	Ga0207680_10164187	3300025903	Unclassified	1492
224	Ga0207647_10335314	3300025904	Bacteria	858
225	Ga0207647_10354550	3300025904	Bacteria	830
226	Ga0207699_10023079	3300025906	Bacteria	3382
227	Ga0207643_10619556	3300025908	Bacteria	697
228	Ga0207684_10574577	3300025910	Bacteria	964
229	Ga0207654_10687156	3300025911	Bacteria	735
230	Ga0207693_10325849	3300025915	Bacteria	1202
231	Ga0207660_10468752	3300025917	Bacteria	1020
232	Ga0207662_10012983	3300025918	Bacteria	4652
233	Ga0207662_10116062	3300025918	Bacteria	1674
234	Ga0207657_10008669	3300025919	Bacteria	10296
235	Ga0207657_10062695	3300025919	Bacteria	3182
236	Ga0207646_10381989	3300025922	Bacteria	1272
237	Ga0207681_10114087	3300025923	Bacteria	1971
238	Ga0207681_10555629	3300025923	Bacteria	945
239	Ga0207694_10045219	3300025924	Bacteria	3401
240	Ga0207694_10825444	3300025924	Bacteria	783
241	Ga0207694_11241296	3300025924	Bacteria	630
242	Ga0207650_10691561	3300025925	Unclassified	861
243	Ga0207659_10012239	3300025926	Bacteria	5448
244	Ga0207659_10392719	3300025926	Bacteria	1159
245	Ga0207659_10844812	3300025926	Bacteria	787
246	Ga0207659_10975802	3300025926	Bacteria	729
247	Ga0207659_11056882	3300025926	Bacteria	699
248	Ga0207687_10043372	3300025927	Bacteria	3099
249	Ga0207687_10399733	3300025927	Bacteria	1130
250	Ga0207687_10470866	3300025927	Bacteria	1045
251	Ga0207664_10034614	3300025929	Bacteria	3891
252	Ga0207644_10036425	3300025931	Unclassified	3454
253	Ga0207644_10426587	3300025931	Unclassified	1087
254	Ga0207706_10016631	3300025933	Bacteria	6639
255	Ga0207706_10706574	3300025933	Bacteria	861
256	Ga0207686_10132540	3300025934	Bacteria	1711
257	Ga0207686_10196304	3300025934	Unclassified	1442
258	Ga0207709_10072659	3300025935	Bacteria	2189
259	Ga0207709_10350168	3300025935	Unclassified	1115
260	Ga0207670_10644063	3300025936	Unclassified	873
261	Ga0207669_10034260	3300025937	Bacteria	2875
262	Ga0207669_10796155	3300025937	Bacteria	784
263	Ga0207704_10034504	3300025938	Bacteria	2888
264	Ga0207704_10040115	3300025938	Bacteria	2733
265	Ga0207704_10172993	3300025938	Bacteria	1551
266	Ga0207704_11032686	3300025938	Bacteria	696
267	Ga0207665_10000643	3300025939	Bacteria	23553
268	Ga0207691_10014438	3300025940	Bacteria	7533
269	Ga0207711_10742282	3300025941	Unclassified	915
270	Ga0207689_10051188	3300025942	Bacteria	3404
271	Ga0207689_10120606	3300025942	Bacteria	2157
272	Ga0207661_11872463	3300025944	Bacteria	545
273	Ga0207679_10122549	3300025945	Bacteria	2072
274	Ga0207667_10390639	3300025949	Bacteria	1417
275	Ga0207651_10076336	3300025960	Bacteria	2395
276	Ga0207712_10027030	3300025961	Bacteria	3829
277	Ga0207712_10162481	3300025961	Bacteria	1737
278	Ga0207668_10043353	3300025972	Bacteria	3053
279	Ga0207668_10216240	3300025972	Unclassified	1536
280	Ga0207668_10317082	3300025972	Bacteria	1292
281	Ga0207640_10033235	3300025981	Bacteria	3207
282	Ga0207640_10214765	3300025981	Bacteria	1468
283	Ga0207640_10396845	3300025981	Bacteria	1122
284	Ga0207677_10525171	3300026023	Bacteria	1027
285	Ga0207677_10798260	3300026023	Bacteria	845
286	Ga0207677_10873098	3300026023	Bacteria	809
287	Ga0207703_10091224	3300026035	Bacteria	2562
288	Ga0207639_10055115	3300026041	Bacteria	3041
289	Ga0207678_10033285	3300026067	Bacteria	4491
290	Ga0207708_10024423	3300026075	Bacteria	4572
291	Ga0207708_10118369	3300026075	Bacteria	2062
292	Ga0207708_10139955	3300026075	Unclassified	1897
293	Ga0207702_10352674	3300026078	Bacteria	1408
294	Ga0207648_10005360	3300026089	Bacteria	12927
295	Ga0207648_10046835	3300026089	Bacteria	3791
296	Ga0207648_10549761	3300026089	Bacteria	1060
297	Ga0207676_10321122	3300026095	Unclassified	1421
298	Ga0207674_10008900	3300026116	Bacteria	11542
299	Ga0207675_100001020	3300026118	Bacteria	27757
300	Ga0207675_100008691	3300026118	Bacteria	9547
301	Ga0207675_100168248	3300026118	Bacteria	2094
302	Ga0207675_100279712	3300026118	Unclassified	1621
303	Ga0207683_10006448	3300026121	Bacteria	10047
304	Ga0207683_10007709	3300026121	Bacteria	9220
305	Ga0207683_10062840	3300026121	Bacteria	3271
306	Ga0207698_10238497	3300026142	Unclassified	1655
307	Ga0207698_11233959	3300026142	Bacteria	762
308	Ga0207428_10098599	3300027907	Bacteria	2261
309	Ga0207428_10301748	3300027907	Bacteria	1185
310	Ga0207428_10631442	3300027907	Bacteria	770
311	Ga0268266_11087580	3300028379	Unclassified	774
312	Ga0268265_10156410	3300028380	Bacteria	1930
313	Ga0268265_10218426	3300028380	Bacteria	1666
314	Ga0268265_12340812	3300028380	Bacteria	541
315	Ga0268264_10083232	3300028381	Bacteria	2740
316	Ga0268264_10158681	3300028381	Bacteria	2035
317	Ga0268264_10226615	3300028381	Bacteria	1723
318	Ga0307515_10774266	3300028794	Bacteria	580
319	Ga0307408_101138563	3300031548	Bacteria	725
320	Ga0307405_10370156	3300031731	Bacteria	1112
321	Ga0307518_10403972	3300031838	Bacteria	760
322	Ga0307410_10149749	3300031852	Bacteria	1736
323	Ga0307412_10201501	3300031911	Bacteria	1512
324	Ga0307412_10758028	3300031911	Bacteria	839
325	Ga0307409_100608959	3300031995	Bacteria	1080
326	Ga0307416_100391036	3300032002	Bacteria	1425
327	Ga0307416_100656112	3300032002	Bacteria	1134
328	Ga0307411_11996145	3300032005	Bacteria	541
329	Ga0307415_100325171	3300032126	Bacteria	1284
330	Ga0307415_100951673	3300032126	Bacteria	795
331	Ga0373948_0069175	3300034817	Bacteria	789
332	Ga0373938_0036562	3300034957	Bacteria	1075
333	Ga0373951_0031045	3300035091	Bacteria	1259
334	Ga0373952_0014053	3300035092	Bacteria	1597
335	Ga0373923_0437397	3300035111	Bacteria	633
336	Ga0373941_0244565	3300035115	Bacteria	698
337	Ga0373960_0120121	3300035121	Bacteria	871
338	Ga0373962_0042996	3300035242	Unclassified	1279
339	Ga0373931_0013131	3300035691	Bacteria	4028
340	Ga0373937_1135789	3300036401	Bacteria	730
341	Ga0395899_0003233	3300037312	Bacteria	12926
342	Ga0395899_0115458	3300037312	Bacteria	1927
343	Ga0395900_0044232	3300037418	Bacteria	4589
344	Ga0395900_0052409	3300037418	Bacteria	4200
345	Ga0395900_0118634	3300037418	Bacteria	2715
346	Ga0395900_0729345	3300037418	Bacteria	923
347	Ga0395900_1072508	3300037418	Bacteria	723
348	Ga0395898_0000960	3300037466	Bacteria	45916
349	Ga0395898_0022883	3300037466	Bacteria	6320
350	Ga0395898_0067998	3300037466	Bacteria	3448
351	Ga0395898_0107214	3300037466	Bacteria	2679
352	Ga0395905_0096321	3300037471	Bacteria	2778
353	Ga0395905_0276837	3300037471	Bacteria	1564
354	Ga0436364_1368686	3300037853	Bacteria	563
355	Ga0395901_0003969	3300038443	Bacteria	14874
356	Ga0395901_0012326	3300038443	Bacteria	8675
357	Ga0395901_0048574	3300038443	Bacteria	4407
358	Ga0395901_0136388	3300038443	Bacteria	2579
359	Ga0395901_0218956	3300038443	Bacteria	1990
360	Ga0451789_1314264	3300041443	Bacteria	2897
361	Ga0451793_0093699	3300041452	Bacteria	9029
362	Ga0451797_0297220	3300041453	Bacteria	2747
363	Ga0451800_0483208	3300041459	Bacteria	596
364	Ga0451802_0415942	3300041460	Bacteria	604
365	Ga0451802_1654161	3300041460	Bacteria	1017
366	Ga0451839_0304920	3300041496	Bacteria	4512
367	Ga0451841_0142418	3300041498	Bacteria	5272
368	Ga0451847_0754899	3300041503	Bacteria	670
369	Ga0451843_0487693	3300041509	Bacteria	4339
370	Ga0451853_1124205	3300041512	Bacteria	1329
371	Ga0451853_3116693	3300041512	Bacteria	2680
372	Ga0439442_000129	3300042002	Bacteria	18814
373	Ga0450920_109271	3300042122	Bacteria	577
374	Ga0450910_026861	3300042147	Bacteria	891
375	Ga0450908_023822	3300042184	Bacteria	1071
376	Ga0466972_0006498	3300044658	Bacteria	5872
377	Ga0466972_0055307	3300044658	Bacteria	1909
378	Ga0466970_0969755	3300044765	Bacteria	501
379	Ga0451576_0341005	3300045051	Bacteria	1569
380	Ga0466967_0916436	3300045976	Bacteria	872
381	Ga0466967_1335537	3300045976	Bacteria	714
382	Ga0495617_244393	3300046452	Bacteria	554
383	Ga0495629_0032960	3300046459	Bacteria	3666
384	Ga0495650_0001841	3300046471	Bacteria	18974
385	Ga0495580_0020865	3300046472	Bacteria	4841
386	Ga0495665_0057391	3300046531	Bacteria	2055
387	Ga0495586_0257306	3300046535	Bacteria	997
388	Ga0495656_0217502	3300046615	Bacteria	954
389	Ga0495658_0464781	3300046683	Bacteria	809
390	Ga0495613_0946859	3300046689	Bacteria	555
391	Ga0495589_0151593	3300046794	Bacteria	1107
392	Ga0495581_0380436	3300047315	Bacteria	824
393	Ga0495593_0304215	3300047673	Bacteria	797
394	Ga0495602_0495499	3300048088	Bacteria	855
395	Ga0496100_0462656	3300048903	Bacteria	974
396	Ga0496100_0667942	3300048903	Bacteria	810
397	Ga0496101_0231307	3300048904	Unclassified	1437
398	Ga0496101_0288933	3300048904	Bacteria	1283
399	Ga0496101_0629094	3300048904	Bacteria	848
400	Ga0496102_0108049	3300048905	Bacteria	2591
401	Ga0496102_0111454	3300048905	Bacteria	2551
402	Ga0496102_0314426	3300048905	Bacteria	1476
403	Ga0496102_0430626	3300048905	Bacteria	1239
404	Ga0496102_1494701	3300048905	Bacteria	594
405	Ga0496103_0361013	3300048906	Bacteria	934
406	Ga0496104_0524590	3300048907	Bacteria	1095
407	Ga0496104_1100283	3300048907	Bacteria	698
408	Ga0496106_0164958	3300048909	Unclassified	1753
409	Ga0496107_0946058	3300048910	Bacteria	627
410	Ga0496108_0036165	3300048911	Bacteria	4107
411	Ga0496108_0128583	3300048911	Unclassified	2176
412	Ga0496108_0351626	3300048911	Bacteria	1286
413	Ga0496108_0462300	3300048911	Bacteria	1109
414	Ga0496108_1047519	3300048911	Bacteria	695
415	Ga0496109_0033681	3300048912	Bacteria	4609
416	Ga0496109_0033775	3300048912	Bacteria	4604
417	Ga0496109_0362878	3300048912	Unclassified	1368
418	Ga0496109_0420858	3300048912	Bacteria	1262
419	Ga0496109_0606167	3300048912	Bacteria	1031
420	Ga0496109_0624954	3300048912	Bacteria	1014
421	Ga0496109_0943181	3300048912	Bacteria	801
422	Ga0496109_1152770	3300048912	Bacteria	712
423	Ga0496110_0030485	3300048913	Bacteria	4650
424	Ga0496110_0148950	3300048913	Bacteria	2118
425	Ga0496111_0542270	3300048914	Bacteria	854
426	Ga0496113_0072663	3300048916	Bacteria	2619
427	Ga0496113_0218067	3300048916	Bacteria	1520
428	Ga0496113_0549188	3300048916	Bacteria	927
429	Ga0496114_0056043	3300048917	Bacteria	3288
430	Ga0496114_0060545	3300048917	Bacteria	3165
431	Ga0496114_0109033	3300048917	Bacteria	2371
432	Ga0496114_0285047	3300048917	Bacteria	1457
433	Ga0496114_0530993	3300048917	Bacteria	1040
434	Ga0496115_0848508	3300048918	Bacteria	708
435	Ga0496126_0000003	3300048929	Bacteria	961576
436	Ga0496126_0067297	3300048929	Bacteria	3201
437	Ga0501031_0000916	3300049568	Bacteria	17781
438	Ga0501031_0005121	3300049568	Bacteria	8540
439	Ga0501031_0555354	3300049568	Bacteria	739
440	Ga0501032_0078111	3300049569	Bacteria	2204
441	Ga0501032_0109151	3300049569	Bacteria	1832
442	Ga0501033_0106557	3300049570	Bacteria	2042
443	Ga0501034_1092433	3300049571	Bacteria	679
444	Ga0501036_0009194	3300049572	Bacteria	8125
445	Ga0501036_0020476	3300049572	Bacteria	5556
446	Ga0501036_0175610	3300049572	Bacteria	1804
447	Ga0501037_0047604	3300049573	Bacteria	3142
448	Ga0501037_0443191	3300049573	Bacteria	887
449	Ga0501038_0019107	3300049574	Bacteria	6180
450	Ga0501038_0029454	3300049574	Bacteria	4864
451	Ga0501038_0294057	3300049574	Bacteria	1276
452	Ga0501039_0012748	3300049575	Bacteria	6424
453	Ga0501039_0014602	3300049575	Bacteria	6013
454	Ga0501039_0052196	3300049575	Bacteria	3164
455	Ga0501040_0003505	3300049576	Bacteria	10134
456	Ga0501040_0005402	3300049576	Bacteria	8269
457	Ga0501041_0000527	3300049577	Bacteria	19759
458	Ga0501041_0006195	3300049577	Bacteria	6994
459	Ga0501042_0005738	3300049578	Bacteria	8018
460	Ga0501042_0011045	3300049578	Bacteria	6080
461	Ga0501043_0113044	3300049579	Bacteria	2132
462	Ga0501046_0021854	3300049580	Bacteria	5274
463	Ga0501046_0031401	3300049580	Bacteria	4305
464	Ga0501048_0002465	3300049582	Bacteria	14123
465	Ga0501048_0024616	3300049582	Bacteria	4392
466	Ga0501048_0098774	3300049582	Bacteria	2059
467	Ga0501067_0009586	3300049583	Bacteria	5363
468	Ga0501067_0198433	3300049583	Bacteria	1117
469	Ga0501068_0059395	3300049584	Bacteria	2322
470	Ga0501068_0244303	3300049584	Bacteria	1143
471	Ga0501069_0001785	3300049585	Bacteria	10758
472	Ga0501069_0018704	3300049585	Bacteria	3742
473	Ga0501070_0043457	3300049586	Bacteria	3739
474	Ga0501070_0263183	3300049586	Bacteria	1409
475	Ga0501070_0681911	3300049586	Bacteria	814
476	Ga0501071_0011630	3300049587	Bacteria	5940
477	Ga0501071_0015467	3300049587	Bacteria	5237
478	Ga0501072_0004435	3300049588	Bacteria	10660
479	Ga0501072_0170381	3300049588	Bacteria	1737
480	Ga0501073_0049587	3300049589	Bacteria	2944
481	Ga0501073_0140728	3300049589	Bacteria	1672
482	Ga0501074_0026980	3300049590	Bacteria	4162
483	Ga0501075_0018248	3300049591	Bacteria	5074
484	Ga0501075_0045463	3300049591	Bacteria	3295
485	Ga0501075_0301118	3300049591	Bacteria	1222
486	Ga0501076_0006866	3300049592	Bacteria	8265
487	Ga0501076_0015028	3300049592	Bacteria	5846
488	Ga0501076_0314910	3300049592	Bacteria	1284
489	Ga0501077_0010648	3300049593	Bacteria	5727
490	Ga0501077_0013750	3300049593	Bacteria	5075
491	Ga0501245_128172	3300049708	Bacteria	541
492	Ga0501079_0002050	3300049741	Bacteria	14430
493	Ga0501079_0032252	3300049741	Bacteria	4027
494	Ga0501079_0207922	3300049741	Bacteria	1529
495	Ga0501080_0029675	3300049742	Bacteria	5090
496	Ga0501080_0143966	3300049742	Bacteria	2203
497	Ga0501081_0003929	3300049743	Bacteria	9526
498	Ga0501081_0132419	3300049743	Bacteria	1782
499	Ga0501081_0463460	3300049743	Bacteria	942
500	Ga0501035_0256843	3300049822	Bacteria	1482
501	Ga0501035_0258924	3300049822	Bacteria	1475
502	Ga0501044_0170547	3300049823	Bacteria	2148
503	Ga0501044_0284859	3300049823	Bacteria	1585
504	Ga0501045_0001145	3300049824	Bacteria	17564
505	Ga0501045_0010334	3300049824	Bacteria	6538
506	Ga0501045_0054909	3300049824	Bacteria	2913
507	nmdc:mga0yw44_81755_c1	3300050492	Bacteria	2026
508	nmdc:mga05p37_1182918_c1	3300050507	Bacteria	792
509	nmdc:mga05p37_158865_c1	3300050507	Bacteria	2761
510	nmdc:mga05p37_300248_c1	3300050507	Bacteria	1908
511	nmdc:mga09592_626881_c1	3300050508	Bacteria	919
512	nmdc:mga0qj67_163608_c1	3300050509	Bacteria	1806
513	nmdc:mga06r32_2085104_c1	3300050510	Bacteria	500
514	nmdc:mga08y16_10945_c1	3300050511	Bacteria	9527
515	nmdc:mga08y16_1232018_c1	3300050511	Bacteria	718
516	nmdc:mga08y16_439601_c1	3300050511	Bacteria	1331
517	nmdc:mga08y16_54494_c1	3300050511	Bacteria	4178
518	nmdc:mga08y16_58595_c1	3300050511	Bacteria	4024
519	nmdc:mga08y16_612666_c1	3300050511	Bacteria	1096
520	nmdc:mga08y16_723913_c1	3300050511	Bacteria	993
521	nmdc:mga0n895_126038_c1	3300050512	Bacteria	2584
522	nmdc:mga0n895_45482_c1	3300050512	Bacteria	4284
523	nmdc:mga0rr50_53195_c1	3300050513	Bacteria	3012
524	nmdc:mga08x19_369103_c1	3300050514	Bacteria	1004
525	nmdc:mga08x19_440439_c1	3300050514	Bacteria	916
526	nmdc:mga08x19_796800_c1	3300050514	Bacteria	671
527	nmdc:mga08x19_937565_c1	3300050514	Bacteria	615
528	nmdc:mga0a205_129858_c1	3300050515	Bacteria	2420
529	nmdc:mga0a205_246081_c1	3300050515	Bacteria	1668
530	nmdc:mga0a205_55004_c1	3300050515	Bacteria	3843
531	nmdc:mga0a205_7152_c1	3300050515	Bacteria	10087
532	Ga0501084_0019516	3300054114	Bacteria	5647
533	Ga0501084_0023400	3300054114	Bacteria	5155
534	Ga0590071_085524	3300059421	Bacteria	786
535	Ga0501082_0006920	3300060353	Bacteria	9802
536	Ga0501082_0051364	3300060353	Bacteria	3553
537	Ga0530510_0013039	3300061734	Bacteria	5846
538	Ga0530510_0013519	3300061734	Bacteria	5740
539	Ga0530510_0290674	3300061734	Bacteria	1222
540	Ga0530510_0427197	3300061734	Bacteria	1000
541	Ga0530510_0667143	3300061734	Bacteria	792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300037853	Ga0436364_1368686	Ga0436364_1368686_108_500	130
2	3300028794	Ga0307515_10774266	Ga0307515_107742661	131
3	iso_pu_bacteria	2852643534	2852644638	131
4	3300049583	Ga0501067_0009586	Ga0501067_0009586_4720_5154	132
5	3300049585	Ga0501069_0001785	Ga0501069_0001785_4950_5384	132
6	3300049586	Ga0501070_0043457	Ga0501070_0043457_71_505	132
7	3300061734	Ga0530510_0427197	Ga0530510_0427197_505_939	132
8	3300025910	Ga0207684_10574577	Ga0207684_105745772	134
9	iso_pu_bacteria	2920879853	2920881360	134
10	3300006914	Ga0075436_100604632	Ga0075436_1006046322	135
11	3300048929	Ga0496126_0067297	Ga0496126_0067297_844_1251	135
12	3300049708	Ga0501245_128172	Ga0501245_128172_20_430	136
13	iso_pu_bacteria	2585428094	2587863467	139
14	iso_pu_bacteria	2945941187	2945942035	139
15	iso_pu_bacteria	2643221649	2644278064	140
16	3300013100	Ga0157373_10861580	Ga0157373_108615801	141
17	3300035111	Ga0373923_0437397	Ga0373923_0437397_197_622	141
18	3300036401	Ga0373937_1135789	Ga0373937_1135789_174_599	141
19	3300046689	Ga0495613_0946859	Ga0495613_0946859_64_489	141
20	3300005339	Ga0070660_100931865	Ga0070660_1009318652	142
21	3300005439	Ga0070711_100782291	Ga0070711_1007822911	142
22	3300005468	Ga0070707_100231107	Ga0070707_1002311072	142
23	3300005471	Ga0070698_100007299	Ga0070698_10000729913	142
24	3300005545	Ga0070695_100616658	Ga0070695_1006166581	142
25	3300006175	Ga0070712_100380879	Ga0070712_1003808793	142
26	3300006846	Ga0075430_100513001	Ga0075430_1005130011	142
27	3300006871	Ga0075434_100412014	Ga0075434_1004120142	142
28	3300009098	Ga0105245_11147955	Ga0105245_111479552	142
29	3300009147	Ga0114129_10184867	Ga0114129_101848674	142
30	3300013297	Ga0157378_10233951	Ga0157378_102339513	142
31	3300014745	Ga0157377_10051292	Ga0157377_100512923	142
32	3300025904	Ga0207647_10335314	Ga0207647_103353141	142
33	3300025915	Ga0207693_10325849	Ga0207693_103258493	142
34	3300025922	Ga0207646_10381989	Ga0207646_103819892	142
35	3300031838	Ga0307518_10403972	Ga0307518_104039722	142
36	3300032005	Ga0307411_11996145	Ga0307411_119961451	142
37	3300032126	Ga0307415_100325171	Ga0307415_1003251712	142
38	3300037312	Ga0395899_0003233	Ga0395899_0003233_5532_5960	142
39	3300037312	Ga0395899_0115458	Ga0395899_0115458_1073_1501	142
40	3300037418	Ga0395900_0044232	Ga0395900_0044232_3519_3947	142
41	3300037418	Ga0395900_0052409	Ga0395900_0052409_48_476	142
42	3300037418	Ga0395900_0118634	Ga0395900_0118634_1251_1679	142
43	3300037418	Ga0395900_0729345	Ga0395900_0729345_434_862	142
44	3300037418	Ga0395900_1072508	Ga0395900_1072508_100_528	142
45	3300037466	Ga0395898_0000960	Ga0395898_0000960_42655_43083	142
46	3300037466	Ga0395898_0022883	Ga0395898_0022883_2341_2769	142
47	3300037466	Ga0395898_0067998	Ga0395898_0067998_1400_1828	142
48	3300037466	Ga0395898_0107214	Ga0395898_0107214_1048_1476	142
49	3300037471	Ga0395905_0096321	Ga0395905_0096321_1509_1937	142
50	3300037471	Ga0395905_0276837	Ga0395905_0276837_18_446	142
51	3300038443	Ga0395901_0003969	Ga0395901_0003969_8767_9195	142
52	3300038443	Ga0395901_0012326	Ga0395901_0012326_7394_7822	142
53	3300038443	Ga0395901_0048574	Ga0395901_0048574_3810_4238	142
54	3300038443	Ga0395901_0136388	Ga0395901_0136388_252_680	142
55	3300038443	Ga0395901_0218956	Ga0395901_0218956_378_806	142
56	3300041460	Ga0451802_0415942	Ga0451802_0415942_129_557	142
57	3300044658	Ga0466972_0055307	Ga0466972_0055307_1350_1778	142
58	3300044765	Ga0466970_0969755	Ga0466970_0969755_23_451	142
59	3300045976	Ga0466967_0916436	Ga0466967_0916436_409_837	142
60	3300045976	Ga0466967_1335537	Ga0466967_1335537_187_660	142
61	3300046472	Ga0495580_0020865	Ga0495580_0020865_2782_3210	142
62	3300046535	Ga0495586_0257306	Ga0495586_0257306_287_715	142
63	3300046794	Ga0495589_0151593	Ga0495589_0151593_58_486	142
64	3300048905	Ga0496102_0430626	Ga0496102_0430626_457_885	142
65	3300048907	Ga0496104_1100283	Ga0496104_1100283_161_589	142
66	3300048911	Ga0496108_1047519	Ga0496108_1047519_232_660	142
67	3300048912	Ga0496109_0943181	Ga0496109_0943181_302_730	142
68	3300048914	Ga0496111_0542270	Ga0496111_0542270_244_672	142
69	3300049568	Ga0501031_0555354	Ga0501031_0555354_117_545	142
70	3300049572	Ga0501036_0175610	Ga0501036_0175610_284_712	142
71	3300049573	Ga0501037_0443191	Ga0501037_0443191_366_794	142
72	3300049575	Ga0501039_0052196	Ga0501039_0052196_1425_1853	142
73	3300049582	Ga0501048_0098774	Ga0501048_0098774_397_825	142
74	3300049591	Ga0501075_0301118	Ga0501075_0301118_567_995	142
75	3300049741	Ga0501079_0207922	Ga0501079_0207922_21_449	142
76	3300049824	Ga0501045_0054909	Ga0501045_0054909_984_1412	142
77	3300050507	nmdc:mga05p37_158865_c1	nmdc:mga05p37_158865_c1_2067_2495	142
78	3300050509	nmdc:mga0qj67_163608_c1	nmdc:mga0qj67_163608_c1_69_497	142
79	3300050510	nmdc:mga06r32_2085104_c1	nmdc:mga06r32_2085104_c1_32_460	142
80	3300050514	nmdc:mga08x19_440439_c1	nmdc:mga08x19_440439_c1_190_618	142
81	3300050515	nmdc:mga0a205_55004_c1	nmdc:mga0a205_55004_c1_3067_3495	142
82	3300061734	Ga0530510_0667143	Ga0530510_0667143_154_582	142
83	iso_pu_bacteria	2643221572	2643876611	142
84	iso_pu_bacteria	2643221669	2644383666	142
85	3300005288	Ga0065714_10219366	Ga0065714_102193661	143
86	3300005334	Ga0068869_100229728	Ga0068869_1002297281	143
87	3300005337	Ga0070682_100015143	Ga0070682_1000151433	143
88	3300005338	Ga0068868_100619650	Ga0068868_1006196501	143
89	3300005339	Ga0070660_100225909	Ga0070660_1002259092	143
90	3300005345	Ga0070692_10025843	Ga0070692_100258431	143
91	3300005347	Ga0070668_100092877	Ga0070668_1000928774	143
92	3300005353	Ga0070669_100263101	Ga0070669_1002631012	143
93	3300005354	Ga0070675_100238316	Ga0070675_1002383162	143
94	3300005354	Ga0070675_100922685	Ga0070675_1009226851	143
95	3300005356	Ga0070674_100105358	Ga0070674_1001053583	143
96	3300005366	Ga0070659_100052392	Ga0070659_1000523922	143
97	3300005434	Ga0070709_10232160	Ga0070709_102321602	143
98	3300005437	Ga0070710_10314854	Ga0070710_103148541	143
99	3300005438	Ga0070701_10056913	Ga0070701_100569132	143
100	3300005441	Ga0070700_100738168	Ga0070700_1007381682	143
101	3300005459	Ga0068867_100327391	Ga0068867_1003273912	143
102	3300005539	Ga0068853_100010945	Ga0068853_1000109456	143
103	3300005545	Ga0070695_100041728	Ga0070695_1000417283	143
104	3300005563	Ga0068855_100046982	Ga0068855_1000469826	143
105	3300005578	Ga0068854_100065990	Ga0068854_1000659904	143
106	3300005615	Ga0070702_100026896	Ga0070702_1000268964	143
107	3300005615	Ga0070702_100229975	Ga0070702_1002299752	143
108	3300005617	Ga0068859_100887054	Ga0068859_1008870542	143
109	3300005618	Ga0068864_101019165	Ga0068864_1010191652	143
110	3300005718	Ga0068866_10071642	Ga0068866_100716422	143
111	3300005719	Ga0068861_100008280	Ga0068861_1000082802	143
112	3300005834	Ga0068851_10152040	Ga0068851_101520401	143
113	3300005843	Ga0068860_101264880	Ga0068860_1012648801	143
114	3300006028	Ga0070717_10026348	Ga0070717_100263483	143
115	3300006173	Ga0070716_100032581	Ga0070716_1000325812	143
116	3300006852	Ga0075433_10002932	Ga0075433_100029328	143
117	3300006871	Ga0075434_100018093	Ga0075434_1000180936	143
118	3300006881	Ga0068865_100569262	Ga0068865_1005692621	143
119	3300006914	Ga0075436_100618769	Ga0075436_1006187691	143
120	3300006931	Ga0097620_100887088	Ga0097620_1008870881	143
121	3300007076	Ga0075435_100003524	Ga0075435_1000035247	143
122	3300007076	Ga0075435_100665779	Ga0075435_1006657792	143
123	3300009094	Ga0111539_10327844	Ga0111539_103278441	143
124	3300009098	Ga0105245_10160734	Ga0105245_101607343	143
125	3300009098	Ga0105245_10352190	Ga0105245_103521901	143
126	3300009098	Ga0105245_10774556	Ga0105245_107745562	143
127	3300009147	Ga0114129_11032643	Ga0114129_110326432	143
128	3300009148	Ga0105243_10026356	Ga0105243_100263561	143
129	3300009174	Ga0105241_10032265	Ga0105241_100322654	143
130	3300009177	Ga0105248_10151357	Ga0105248_101513572	143
131	3300009551	Ga0105238_10035198	Ga0105238_100351987	143
132	3300009553	Ga0105249_10003830	Ga0105249_100038309	143
133	3300010375	Ga0105239_10157508	Ga0105239_101575082	143
134	3300011119	Ga0105246_10116781	Ga0105246_101167811	143
135	3300013104	Ga0157370_10167237	Ga0157370_101672373	143
136	3300013296	Ga0157374_10085497	Ga0157374_100854973	143
137	3300013306	Ga0163162_10043886	Ga0163162_100438862	143
138	3300014325	Ga0163163_10247460	Ga0163163_102474603	143
139	3300014325	Ga0163163_11211221	Ga0163163_112112211	143
140	3300014326	Ga0157380_10642867	Ga0157380_106428672	143
141	3300014968	Ga0157379_11101254	Ga0157379_111012541	143
142	3300014969	Ga0157376_10335732	Ga0157376_103357321	143
143	3300017792	Ga0163161_10006047	Ga0163161_100060474	143
144	3300025885	Ga0207653_10013265	Ga0207653_100132654	143
145	3300025898	Ga0207692_10154457	Ga0207692_101544572	143
146	3300025901	Ga0207688_10856048	Ga0207688_108560481	143
147	3300025904	Ga0207647_10354550	Ga0207647_103545501	143
148	3300025906	Ga0207699_10023079	Ga0207699_100230793	143
149	3300025911	Ga0207654_10687156	Ga0207654_106871562	143
150	3300025919	Ga0207657_10008669	Ga0207657_1000866911	143
151	3300025923	Ga0207681_10114087	Ga0207681_101140873	143
152	3300025924	Ga0207694_10825444	Ga0207694_108254441	143
153	3300025926	Ga0207659_10844812	Ga0207659_108448122	143
154	3300025926	Ga0207659_11056882	Ga0207659_110568821	143
155	3300025929	Ga0207664_10034614	Ga0207664_100346143	143
156	3300025931	Ga0207644_10036425	Ga0207644_100364253	143
157	3300025937	Ga0207669_10796155	Ga0207669_107961551	143
158	3300025938	Ga0207704_10172993	Ga0207704_101729932	143
159	3300025939	Ga0207665_10000643	Ga0207665_1000064318	143
160	3300025942	Ga0207689_10051188	Ga0207689_100511884	143
161	3300025949	Ga0207667_10390639	Ga0207667_103906392	143
162	3300025961	Ga0207712_10027030	Ga0207712_100270305	143
163	3300025972	Ga0207668_10317082	Ga0207668_103170821	143
164	3300025981	Ga0207640_10396845	Ga0207640_103968451	143
165	3300026023	Ga0207677_10525171	Ga0207677_105251711	143
166	3300026035	Ga0207703_10091224	Ga0207703_100912242	143
167	3300026041	Ga0207639_10055115	Ga0207639_100551152	143
168	3300026075	Ga0207708_10139955	Ga0207708_101399553	143
169	3300026078	Ga0207702_10352674	Ga0207702_103526741	143
170	3300026118	Ga0207675_100001020	Ga0207675_10000102015	143
171	3300026121	Ga0207683_10006448	Ga0207683_100064485	143
172	3300026121	Ga0207683_10062840	Ga0207683_100628402	143
173	3300027907	Ga0207428_10631442	Ga0207428_106314422	143
174	3300028381	Ga0268264_10226615	Ga0268264_102266151	143
175	3300031548	Ga0307408_101138563	Ga0307408_1011385631	143
176	3300031731	Ga0307405_10370156	Ga0307405_103701561	143
177	3300031852	Ga0307410_10149749	Ga0307410_101497492	143
178	3300031911	Ga0307412_10201501	Ga0307412_102015012	143
179	3300031995	Ga0307409_100608959	Ga0307409_1006089592	143
180	3300032002	Ga0307416_100391036	Ga0307416_1003910363	143
181	3300032002	Ga0307416_100656112	Ga0307416_1006561122	143
182	3300032126	Ga0307415_100951673	Ga0307415_1009516731	143
183	3300034817	Ga0373948_0069175	Ga0373948_0069175_112_543	143
184	3300034957	Ga0373938_0036562	Ga0373938_0036562_570_1001	143
185	3300035091	Ga0373951_0031045	Ga0373951_0031045_52_483	143
186	3300035092	Ga0373952_0014053	Ga0373952_0014053_1121_1552	143
187	3300035115	Ga0373941_0244565	Ga0373941_0244565_46_477	143
188	3300035121	Ga0373960_0120121	Ga0373960_0120121_341_772	143
189	3300041443	Ga0451789_1314264	Ga0451789_1314264_1314_1745	143
190	3300041452	Ga0451793_0093699	Ga0451793_0093699_5733_6164	143
191	3300041453	Ga0451797_0297220	Ga0451797_0297220_2192_2623	143
192	3300041459	Ga0451800_0483208	Ga0451800_0483208_131_562	143
193	3300041460	Ga0451802_1654161	Ga0451802_1654161_104_535	143
194	3300041496	Ga0451839_0304920	Ga0451839_0304920_671_1102	143
195	3300041498	Ga0451841_0142418	Ga0451841_0142418_3431_3862	143
196	3300041509	Ga0451843_0487693	Ga0451843_0487693_2920_3351	143
197	3300048907	Ga0496104_0524590	Ga0496104_0524590_179_610	143
198	3300048911	Ga0496108_0128583	Ga0496108_0128583_54_485	143
199	3300048912	Ga0496109_0362878	Ga0496109_0362878_156_587	143
200	3300048917	Ga0496114_0109033	Ga0496114_0109033_1574_2005	143
201	3300049568	Ga0501031_0000916	Ga0501031_0000916_15781_16212	143
202	3300049569	Ga0501032_0109151	Ga0501032_0109151_237_668	143
203	3300049572	Ga0501036_0020476	Ga0501036_0020476_4193_4624	143
204	3300049574	Ga0501038_0019107	Ga0501038_0019107_4137_4568	143
205	3300049575	Ga0501039_0012748	Ga0501039_0012748_1390_1821	143
206	3300049576	Ga0501040_0003505	Ga0501040_0003505_5204_5635	143
207	3300049577	Ga0501041_0000527	Ga0501041_0000527_6593_7024	143
208	3300049578	Ga0501042_0011045	Ga0501042_0011045_2491_2922	143
209	3300049580	Ga0501046_0021854	Ga0501046_0021854_1800_2231	143
210	3300049582	Ga0501048_0024616	Ga0501048_0024616_3297_3728	143
211	3300049584	Ga0501068_0244303	Ga0501068_0244303_644_1075	143
212	3300049587	Ga0501071_0015467	Ga0501071_0015467_1124_1555	143
213	3300049588	Ga0501072_0170381	Ga0501072_0170381_48_479	143
214	3300049589	Ga0501073_0140728	Ga0501073_0140728_1221_1652	143
215	3300049590	Ga0501074_0026980	Ga0501074_0026980_3023_3454	143
216	3300049591	Ga0501075_0045463	Ga0501075_0045463_201_632	143
217	3300049592	Ga0501076_0006866	Ga0501076_0006866_1239_1670	143
218	3300049593	Ga0501077_0010648	Ga0501077_0010648_1206_1637	143
219	3300049741	Ga0501079_0032252	Ga0501079_0032252_480_911	143
220	3300049742	Ga0501080_0143966	Ga0501080_0143966_1721_2152	143
221	3300049743	Ga0501081_0132419	Ga0501081_0132419_841_1272	143
222	3300049743	Ga0501081_0463460	Ga0501081_0463460_470_901	143
223	3300049822	Ga0501035_0256843	Ga0501035_0256843_81_512	143
224	3300049823	Ga0501044_0284859	Ga0501044_0284859_533_964	143
225	3300049824	Ga0501045_0001145	Ga0501045_0001145_16653_17084	143
226	3300050507	nmdc:mga05p37_1182918_c1	nmdc:mga05p37_1182918_c1_198_629	143
227	3300050511	nmdc:mga08y16_1232018_c1	nmdc:mga08y16_1232018_c1_38_469	143
228	3300050512	nmdc:mga0n895_45482_c1	nmdc:mga0n895_45482_c1_2701_3132	143
229	3300050513	nmdc:mga0rr50_53195_c1	nmdc:mga0rr50_53195_c1_1052_1483	143
230	3300050514	nmdc:mga08x19_369103_c1	nmdc:mga08x19_369103_c1_231_662	143
231	3300050514	nmdc:mga08x19_796800_c1	nmdc:mga08x19_796800_c1_16_447	143
232	3300050515	nmdc:mga0a205_246081_c1	nmdc:mga0a205_246081_c1_499_930	143
233	3300050515	nmdc:mga0a205_7152_c1	nmdc:mga0a205_7152_c1_3749_4180	143
234	3300054114	Ga0501084_0019516	Ga0501084_0019516_714_1145	143
235	3300060353	Ga0501082_0051364	Ga0501082_0051364_1280_1711	143
236	3300061734	Ga0530510_0013039	Ga0530510_0013039_5166_5597	143
237	iso_pu_bacteria	2857481737	2857484990	143
238	iso_pu_bacteria	2895660088	2895660819	143
239	3300005288	Ga0065714_10169750	Ga0065714_101697502	144
240	3300031911	Ga0307412_10758028	Ga0307412_107580281	144
241	3300046531	Ga0495665_0057391	Ga0495665_0057391_863_1297	144
242	3300047673	Ga0495593_0304215	Ga0495593_0304215_37_471	144
243	3300050507	nmdc:mga05p37_300248_c1	nmdc:mga05p37_300248_c1_552_986	144
244	3300002074	JGI24748J21848_1036866	JGI24748J21848_10368661	145
245	3300005329	Ga0070683_100017680	Ga0070683_1000176802	145
246	3300005330	Ga0070690_100019145	Ga0070690_1000191456	145
247	3300005331	Ga0070670_100341391	Ga0070670_1003413912	145
248	3300005334	Ga0068869_100842459	Ga0068869_1008424591	145
249	3300005335	Ga0070666_10180155	Ga0070666_101801552	145
250	3300005337	Ga0070682_100049254	Ga0070682_1000492542	145
251	3300005339	Ga0070660_100010411	Ga0070660_1000104114	145
252	3300005341	Ga0070691_10060550	Ga0070691_100605502	145
253	3300005343	Ga0070687_100023497	Ga0070687_1000234973	145
254	3300005344	Ga0070661_100222704	Ga0070661_1002227042	145
255	3300005345	Ga0070692_10023028	Ga0070692_100230283	145
256	3300005347	Ga0070668_100055407	Ga0070668_1000554072	145
257	3300005353	Ga0070669_100025427	Ga0070669_1000254272	145
258	3300005354	Ga0070675_100004289	Ga0070675_1000042892	145
259	3300005356	Ga0070674_100011904	Ga0070674_1000119042	145
260	3300005364	Ga0070673_100043691	Ga0070673_1000436912	145
261	3300005365	Ga0070688_100020775	Ga0070688_1000207752	145
262	3300005406	Ga0070703_10179676	Ga0070703_101796762	145
263	3300005438	Ga0070701_10081540	Ga0070701_100815403	145
264	3300005440	Ga0070705_100118724	Ga0070705_1001187242	145
265	3300005441	Ga0070700_100006741	Ga0070700_1000067417	145
266	3300005444	Ga0070694_100039011	Ga0070694_1000390112	145
267	3300005455	Ga0070663_100031380	Ga0070663_1000313805	145
268	3300005456	Ga0070678_100043563	Ga0070678_1000435634	145
269	3300005457	Ga0070662_100254922	Ga0070662_1002549221	145
270	3300005459	Ga0068867_100002329	Ga0068867_1000023296	145
271	3300005466	Ga0070685_10016879	Ga0070685_100168792	145
272	3300005535	Ga0070684_100120394	Ga0070684_1001203942	145
273	3300005544	Ga0070686_100030685	Ga0070686_1000306852	145
274	3300005546	Ga0070696_100821194	Ga0070696_1008211942	145
275	3300005547	Ga0070693_100011644	Ga0070693_1000116442	145
276	3300005548	Ga0070665_101510666	Ga0070665_1015106661	145
277	3300005564	Ga0070664_100033681	Ga0070664_1000336817	145
278	3300005577	Ga0068857_100137162	Ga0068857_1001371622	145
279	3300005578	Ga0068854_100029523	Ga0068854_1000295234	145
280	3300005614	Ga0068856_100445646	Ga0068856_1004456462	145
281	3300005615	Ga0070702_100003308	Ga0070702_1000033082	145
282	3300005616	Ga0068852_100147265	Ga0068852_1001472654	145
283	3300005617	Ga0068859_100255334	Ga0068859_1002553341	145
284	3300005618	Ga0068864_100009166	Ga0068864_1000091664	145
285	3300005719	Ga0068861_100059212	Ga0068861_1000592123	145
286	3300005840	Ga0068870_10016739	Ga0068870_100167397	145
287	3300005842	Ga0068858_100079240	Ga0068858_1000792405	145
288	3300005843	Ga0068860_100077330	Ga0068860_1000773305	145
289	3300005844	Ga0068862_100099747	Ga0068862_1000997475	145
290	3300006914	Ga0075436_101078510	Ga0075436_1010785101	145
291	3300006931	Ga0097620_100255333	Ga0097620_1002553331	145
292	3300009094	Ga0111539_11074586	Ga0111539_110745862	145
293	3300009094	Ga0111539_12402459	Ga0111539_124024591	145
294	3300009098	Ga0105245_10011121	Ga0105245_1001112110	145
295	3300009148	Ga0105243_10011725	Ga0105243_100117254	145
296	3300009176	Ga0105242_10121319	Ga0105242_101213194	145
297	3300009177	Ga0105248_10042633	Ga0105248_100426338	145
298	3300009553	Ga0105249_10004453	Ga0105249_100044539	145
299	3300010375	Ga0105239_10063899	Ga0105239_100638992	145
300	3300011119	Ga0105246_10182732	Ga0105246_101827322	145
301	3300013297	Ga0157378_10080359	Ga0157378_100803595	145
302	3300013306	Ga0163162_10018039	Ga0163162_100180393	145
303	3300013308	Ga0157375_10027510	Ga0157375_100275107	145
304	3300014325	Ga0163163_10231606	Ga0163163_102316062	145
305	3300014326	Ga0157380_10060165	Ga0157380_100601653	145
306	3300014745	Ga0157377_10004040	Ga0157377_100040405	145
307	3300014968	Ga0157379_10011520	Ga0157379_100115204	145
308	3300017792	Ga0163161_10038212	Ga0163161_100382121	145
309	3300025901	Ga0207688_10024504	Ga0207688_100245046	145
310	3300025903	Ga0207680_10164187	Ga0207680_101641872	145
311	3300025908	Ga0207643_10619556	Ga0207643_106195561	145
312	3300025918	Ga0207662_10012983	Ga0207662_100129835	145
313	3300025919	Ga0207657_10062695	Ga0207657_100626955	145
314	3300025924	Ga0207694_10045219	Ga0207694_100452196	145
315	3300025925	Ga0207650_10691561	Ga0207650_106915611	145
316	3300025926	Ga0207659_10012239	Ga0207659_100122395	145
317	3300025931	Ga0207644_10426587	Ga0207644_104265872	145
318	3300025933	Ga0207706_10016631	Ga0207706_100166311	145
319	3300025934	Ga0207686_10196304	Ga0207686_101963042	145
320	3300025935	Ga0207709_10350168	Ga0207709_103501682	145
321	3300025936	Ga0207670_10644063	Ga0207670_106440631	145
322	3300025937	Ga0207669_10034260	Ga0207669_100342602	145
323	3300025938	Ga0207704_10040115	Ga0207704_100401152	145
324	3300025941	Ga0207711_10742282	Ga0207711_107422822	145
325	3300025942	Ga0207689_10120606	Ga0207689_101206063	145
326	3300025944	Ga0207661_11872463	Ga0207661_118724631	145
327	3300025945	Ga0207679_10122549	Ga0207679_101225492	145
328	3300025960	Ga0207651_10076336	Ga0207651_100763362	145
329	3300025972	Ga0207668_10216240	Ga0207668_102162402	145
330	3300025981	Ga0207640_10033235	Ga0207640_100332352	145
331	3300026067	Ga0207678_10033285	Ga0207678_100332856	145
332	3300026075	Ga0207708_10024423	Ga0207708_100244233	145
333	3300026089	Ga0207648_10046835	Ga0207648_100468352	145
334	3300026095	Ga0207676_10321122	Ga0207676_103211222	145
335	3300026116	Ga0207674_10008900	Ga0207674_100089005	145
336	3300026118	Ga0207675_100279712	Ga0207675_1002797122	145
337	3300026121	Ga0207683_10007709	Ga0207683_100077095	145
338	3300026142	Ga0207698_10238497	Ga0207698_102384972	145
339	3300027907	Ga0207428_10098599	Ga0207428_100985992	145
340	3300028379	Ga0268266_11087580	Ga0268266_110875801	145
341	3300028380	Ga0268265_10156410	Ga0268265_101564102	145
342	3300028381	Ga0268264_10083232	Ga0268264_100832321	145
343	3300035242	Ga0373962_0042996	Ga0373962_0042996_377_814	145
344	3300035691	Ga0373931_0013131	Ga0373931_0013131_594_1031	145
345	3300045051	Ga0451576_0341005	Ga0451576_0341005_536_973	145
346	3300046471	Ga0495650_0001841	Ga0495650_0001841_4031_4468	145
347	3300048904	Ga0496101_0231307	Ga0496101_0231307_962_1399	145
348	3300048905	Ga0496102_0108049	Ga0496102_0108049_555_992	145
349	3300048909	Ga0496106_0164958	Ga0496106_0164958_524_961	145
350	3300048911	Ga0496108_0036165	Ga0496108_0036165_1588_2025	145
351	3300048912	Ga0496109_0033681	Ga0496109_0033681_1226_1663	145
352	3300048913	Ga0496110_0030485	Ga0496110_0030485_3560_3997	145
353	3300048916	Ga0496113_0218067	Ga0496113_0218067_288_725	145
354	3300048917	Ga0496114_0060545	Ga0496114_0060545_2054_2491	145
355	3300050511	nmdc:mga08y16_10945_c1	nmdc:mga08y16_10945_c1_3421_3858	145
356	3300050511	nmdc:mga08y16_439601_c1	nmdc:mga08y16_439601_c1_27_464	145
357	3300050512	nmdc:mga0n895_126038_c1	nmdc:mga0n895_126038_c1_888_1325	145
358	3300050514	nmdc:mga08x19_937565_c1	nmdc:mga08x19_937565_c1_125_562	145
359	3300050515	nmdc:mga0a205_129858_c1	nmdc:mga0a205_129858_c1_1524_1961	145
360	3300005337	Ga0070682_100018034	Ga0070682_1000180344	146
361	3300005341	Ga0070691_10175071	Ga0070691_101750712	146
362	3300005345	Ga0070692_10167984	Ga0070692_101679841	146
363	3300005345	Ga0070692_10528520	Ga0070692_105285201	146
364	3300005353	Ga0070669_101550776	Ga0070669_1015507761	146
365	3300005355	Ga0070671_101976695	Ga0070671_1019766951	146
366	3300005365	Ga0070688_100232962	Ga0070688_1002329623	146
367	3300005440	Ga0070705_100938735	Ga0070705_1009387351	146
368	3300005441	Ga0070700_100360942	Ga0070700_1003609422	146
369	3300005545	Ga0070695_100282981	Ga0070695_1002829811	146
370	3300005546	Ga0070696_100707464	Ga0070696_1007074641	146
371	3300005564	Ga0070664_100764941	Ga0070664_1007649412	146
372	3300005615	Ga0070702_100630045	Ga0070702_1006300451	146
373	3300005615	Ga0070702_100778240	Ga0070702_1007782401	146
374	3300005719	Ga0068861_100184638	Ga0068861_1001846383	146
375	3300005840	Ga0068870_10386880	Ga0068870_103868801	146
376	3300009036	Ga0105244_10076490	Ga0105244_100764902	146
377	3300009094	Ga0111539_10657495	Ga0111539_106574952	146
378	3300009098	Ga0105245_10384371	Ga0105245_103843712	146
379	3300009098	Ga0105245_11643158	Ga0105245_116431582	146
380	3300009551	Ga0105238_10321226	Ga0105238_103212263	146
381	3300009553	Ga0105249_10315666	Ga0105249_103156662	146
382	3300011119	Ga0105246_10206742	Ga0105246_102067423	146
383	3300011119	Ga0105246_11785302	Ga0105246_117853021	146
384	3300013296	Ga0157374_12487214	Ga0157374_124872141	146
385	3300013306	Ga0163162_11443018	Ga0163162_114430181	146
386	3300013306	Ga0163162_12011244	Ga0163162_120112441	146
387	3300013308	Ga0157375_10751275	Ga0157375_107512752	146
388	3300013308	Ga0157375_10992611	Ga0157375_109926112	146
389	3300014325	Ga0163163_10022290	Ga0163163_100222905	146
390	3300014325	Ga0163163_10338542	Ga0163163_103385422	146
391	3300014325	Ga0163163_10560905	Ga0163163_105609052	146
392	3300014325	Ga0163163_11327734	Ga0163163_113277341	146
393	3300014326	Ga0157380_10062648	Ga0157380_100626484	146
394	3300014969	Ga0157376_10619149	Ga0157376_106191492	146
395	3300017792	Ga0163161_10016049	Ga0163161_100160492	146
396	3300025899	Ga0207642_10322963	Ga0207642_103229631	146
397	3300025917	Ga0207660_10468752	Ga0207660_104687522	146
398	3300025924	Ga0207694_11241296	Ga0207694_112412961	146
399	3300025926	Ga0207659_10392719	Ga0207659_103927193	146
400	3300025926	Ga0207659_10975802	Ga0207659_109758021	146
401	3300025927	Ga0207687_10043372	Ga0207687_100433723	146
402	3300025927	Ga0207687_10399733	Ga0207687_103997332	146
403	3300025938	Ga0207704_11032686	Ga0207704_110326862	146
404	3300025961	Ga0207712_10162481	Ga0207712_101624812	146
405	3300025972	Ga0207668_10043353	Ga0207668_100433533	146
406	3300026023	Ga0207677_10798260	Ga0207677_107982602	146
407	3300026023	Ga0207677_10873098	Ga0207677_108730982	146
408	3300026075	Ga0207708_10118369	Ga0207708_101183693	146
409	3300026118	Ga0207675_100168248	Ga0207675_1001682482	146
410	3300026142	Ga0207698_11233959	Ga0207698_112339591	146
411	3300027907	Ga0207428_10301748	Ga0207428_103017482	146
412	3300028380	Ga0268265_12340812	Ga0268265_123408121	146
413	3300041503	Ga0451847_0754899	Ga0451847_0754899_175_615	146
414	3300041512	Ga0451853_1124205	Ga0451853_1124205_200_640	146
415	3300041512	Ga0451853_3116693	Ga0451853_3116693_1417_1857	146
416	3300042122	Ga0450920_109271	Ga0450920_109271_13_453	146
417	3300042147	Ga0450910_026861	Ga0450910_026861_215_655	146
418	3300042184	Ga0450908_023822	Ga0450908_023822_55_495	146
419	3300044658	Ga0466972_0006498	Ga0466972_0006498_4630_5070	146
420	3300046452	Ga0495617_244393	Ga0495617_244393_29_469	146
421	3300046459	Ga0495629_0032960	Ga0495629_0032960_153_593	146
422	3300046615	Ga0495656_0217502	Ga0495656_0217502_137_577	146
423	3300046683	Ga0495658_0464781	Ga0495658_0464781_241_681	146
424	3300047315	Ga0495581_0380436	Ga0495581_0380436_363_803	146
425	3300048088	Ga0495602_0495499	Ga0495602_0495499_31_471	146
426	3300048903	Ga0496100_0667942	Ga0496100_0667942_21_461	146
427	3300048904	Ga0496101_0629094	Ga0496101_0629094_69_509	146
428	3300048905	Ga0496102_0111454	Ga0496102_0111454_241_681	146
429	3300048905	Ga0496102_0314426	Ga0496102_0314426_184_624	146
430	3300048906	Ga0496103_0361013	Ga0496103_0361013_354_794	146
431	3300048911	Ga0496108_0351626	Ga0496108_0351626_506_946	146
432	3300048912	Ga0496109_0420858	Ga0496109_0420858_511_951	146
433	3300048912	Ga0496109_0606167	Ga0496109_0606167_17_457	146
434	3300048912	Ga0496109_0624954	Ga0496109_0624954_538_978	146
435	3300048912	Ga0496109_1152770	Ga0496109_1152770_103_543	146
436	3300048916	Ga0496113_0072663	Ga0496113_0072663_713_1153	146
437	3300048917	Ga0496114_0056043	Ga0496114_0056043_2802_3242	146
438	3300048917	Ga0496114_0530993	Ga0496114_0530993_374_814	146
439	3300048918	Ga0496115_0848508	Ga0496115_0848508_212_652	146
440	3300048929	Ga0496126_0000003	Ga0496126_0000003_478672_479121	146
441	3300049568	Ga0501031_0005121	Ga0501031_0005121_5010_5450	146
442	3300049569	Ga0501032_0078111	Ga0501032_0078111_85_525	146
443	3300049570	Ga0501033_0106557	Ga0501033_0106557_1369_1809	146
444	3300049571	Ga0501034_1092433	Ga0501034_1092433_44_484	146
445	3300049572	Ga0501036_0009194	Ga0501036_0009194_3870_4310	146
446	3300049573	Ga0501037_0047604	Ga0501037_0047604_1151_1591	146
447	3300049574	Ga0501038_0029454	Ga0501038_0029454_2743_3183	146
448	3300049574	Ga0501038_0294057	Ga0501038_0294057_71_511	146
449	3300049575	Ga0501039_0014602	Ga0501039_0014602_3725_4165	146
450	3300049576	Ga0501040_0005402	Ga0501040_0005402_3992_4432	146
451	3300049577	Ga0501041_0006195	Ga0501041_0006195_3479_3919	146
452	3300049578	Ga0501042_0005738	Ga0501042_0005738_3801_4241	146
453	3300049579	Ga0501043_0113044	Ga0501043_0113044_1637_2077	146
454	3300049580	Ga0501046_0031401	Ga0501046_0031401_3831_4271	146
455	3300049582	Ga0501048_0002465	Ga0501048_0002465_9566_10006	146
456	3300049583	Ga0501067_0198433	Ga0501067_0198433_639_1079	146
457	3300049584	Ga0501068_0059395	Ga0501068_0059395_1061_1501	146
458	3300049585	Ga0501069_0018704	Ga0501069_0018704_2381_2821	146
459	3300049586	Ga0501070_0263183	Ga0501070_0263183_867_1307	146
460	3300049586	Ga0501070_0681911	Ga0501070_0681911_300_740	146
461	3300049587	Ga0501071_0011630	Ga0501071_0011630_3819_4259	146
462	3300049588	Ga0501072_0004435	Ga0501072_0004435_9300_9740	146
463	3300049589	Ga0501073_0049587	Ga0501073_0049587_2311_2751	146
464	3300049591	Ga0501075_0018248	Ga0501075_0018248_828_1268	146
465	3300049592	Ga0501076_0015028	Ga0501076_0015028_1682_2122	146
466	3300049592	Ga0501076_0314910	Ga0501076_0314910_800_1240	146
467	3300049593	Ga0501077_0013750	Ga0501077_0013750_3613_4053	146
468	3300049741	Ga0501079_0002050	Ga0501079_0002050_1682_2122	146
469	3300049742	Ga0501080_0029675	Ga0501080_0029675_3808_4248	146
470	3300049743	Ga0501081_0003929	Ga0501081_0003929_3793_4233	146
471	3300049822	Ga0501035_0258924	Ga0501035_0258924_375_815	146
472	3300049823	Ga0501044_0170547	Ga0501044_0170547_694_1134	146
473	3300049824	Ga0501045_0010334	Ga0501045_0010334_3843_4283	146
474	3300050511	nmdc:mga08y16_612666_c1	nmdc:mga08y16_612666_c1_227_667	146
475	3300050511	nmdc:mga08y16_723913_c1	nmdc:mga08y16_723913_c1_212_652	146
476	3300054114	Ga0501084_0023400	Ga0501084_0023400_2465_2905	146
477	3300059421	Ga0590071_085524	Ga0590071_085524_221_664	146
478	3300060353	Ga0501082_0006920	Ga0501082_0006920_5562_6002	146
479	3300061734	Ga0530510_0013519	Ga0530510_0013519_4387_4827	146
480	3300061734	Ga0530510_0290674	Ga0530510_0290674_182_622	146
481	3300005330	Ga0070690_100579838	Ga0070690_1005798382	147
482	3300005341	Ga0070691_10024237	Ga0070691_100242374	147
483	3300005343	Ga0070687_100102173	Ga0070687_1001021731	147
484	3300005364	Ga0070673_100023884	Ga0070673_1000238844	147
485	3300005459	Ga0068867_100003080	Ga0068867_1000030804	147
486	3300005535	Ga0070684_100170327	Ga0070684_1001703272	147
487	3300005543	Ga0070672_100030240	Ga0070672_1000302405	147
488	3300005578	Ga0068854_100020357	Ga0068854_1000203573	147
489	3300005615	Ga0070702_100001994	Ga0070702_1000019949	147
490	3300005616	Ga0068852_100010552	Ga0068852_1000105527	147
491	3300005617	Ga0068859_100363646	Ga0068859_1003636462	147
492	3300005718	Ga0068866_10096898	Ga0068866_100968982	147
493	3300005719	Ga0068861_100005215	Ga0068861_1000052155	147
494	3300005834	Ga0068851_10351823	Ga0068851_103518232	147
495	3300005844	Ga0068862_100229878	Ga0068862_1002298782	147
496	3300006038	Ga0075365_10022040	Ga0075365_100220402	147
497	3300006881	Ga0068865_100031907	Ga0068865_1000319074	147
498	3300006931	Ga0097620_100363644	Ga0097620_1003636442	147
499	3300009094	Ga0111539_10195343	Ga0111539_101953432	147
500	3300009098	Ga0105245_10242040	Ga0105245_102420402	147
501	3300009177	Ga0105248_10016314	Ga0105248_100163145	147
502	3300013102	Ga0157371_10395846	Ga0157371_103958462	147
503	3300013307	Ga0157372_10025132	Ga0157372_100251324	147
504	3300014326	Ga0157380_10605913	Ga0157380_106059132	147
505	3300014745	Ga0157377_10044661	Ga0157377_100446612	147
506	3300025315	Ga0207697_10101114	Ga0207697_101011142	147
507	3300025899	Ga0207642_10088339	Ga0207642_100883392	147
508	3300025918	Ga0207662_10116062	Ga0207662_101160622	147
509	3300025933	Ga0207706_10706574	Ga0207706_107065742	147
510	3300025935	Ga0207709_10072659	Ga0207709_100726592	147
511	3300025938	Ga0207704_10034504	Ga0207704_100345043	147
512	3300025940	Ga0207691_10014438	Ga0207691_100144385	147
513	3300025981	Ga0207640_10214765	Ga0207640_102147652	147
514	3300026089	Ga0207648_10005360	Ga0207648_100053608	147
515	3300026089	Ga0207648_10549761	Ga0207648_105497612	147
516	3300026118	Ga0207675_100008691	Ga0207675_1000086916	147
517	3300028380	Ga0268265_10218426	Ga0268265_102184263	147
518	3300042002	Ga0439442_000129	Ga0439442_000129_9658_10146	147
519	3300048903	Ga0496100_0462656	Ga0496100_0462656_439_882	147
520	3300048904	Ga0496101_0288933	Ga0496101_0288933_430_873	147
521	3300048905	Ga0496102_1494701	Ga0496102_1494701_49_492	147
522	3300048910	Ga0496107_0946058	Ga0496107_0946058_80_523	147
523	3300048911	Ga0496108_0462300	Ga0496108_0462300_450_893	147
524	3300048912	Ga0496109_0033775	Ga0496109_0033775_2043_2486	147
525	3300048913	Ga0496110_0148950	Ga0496110_0148950_192_635	147
526	3300048916	Ga0496113_0549188	Ga0496113_0549188_118_561	147
527	3300048917	Ga0496114_0285047	Ga0496114_0285047_285_728	147
528	3300050492	nmdc:mga0yw44_81755_c1	nmdc:mga0yw44_81755_c1_146_589	147
529	3300050508	nmdc:mga09592_626881_c1	nmdc:mga09592_626881_c1_213_656	147
530	3300050511	nmdc:mga08y16_54494_c1	nmdc:mga08y16_54494_c1_2498_2941	147
531	3300050511	nmdc:mga08y16_58595_c1	nmdc:mga08y16_58595_c1_3103_3546	147
532	3300028381	Ga0268264_10158681	Ga0268264_101586814	149
533	3300005843	Ga0068860_100942818	Ga0068860_1009428182	150
534	3300001977	JGI24746J21847_1027163	JGI24746J21847_10271631	151
535	3300001991	JGI24743J22301_10025260	JGI24743J22301_100252602	151
536	3300002076	JGI24749J21850_1005044	JGI24749J21850_10050443	151
537	3300002239	JGI24034J26672_10039108	JGI24034J26672_100391082	151
538	3300005329	Ga0070683_100179987	Ga0070683_1001799871	151
539	3300005353	Ga0070669_100630736	Ga0070669_1006307362	151
540	3300005457	Ga0070662_100766602	Ga0070662_1007666021	151
541	3300005544	Ga0070686_100296486	Ga0070686_1002964862	151
542	3300005549	Ga0070704_100598107	Ga0070704_1005981072	151
543	3300005564	Ga0070664_101125238	Ga0070664_1011252382	151
544	3300005843	Ga0068860_100197200	Ga0068860_1001972004	151
545	3300006844	Ga0075428_101034621	Ga0075428_1010346212	151
546	3300009094	Ga0111539_10677577	Ga0111539_106775772	151
547	3300025321	Ga0207656_10493127	Ga0207656_104931272	151
548	3300025923	Ga0207681_10555629	Ga0207681_105556292	151
549	3300025927	Ga0207687_10470866	Ga0207687_104708662	151
550	3300025934	Ga0207686_10132540	Ga0207686_101325403	151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

111

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5umq-assembly1.cif.gz_A	crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234	0.8617	4	126
5ump-assembly1.cif.gz_B	crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234	0.8599	3	127
5ujp-assembly1.cif.gz_B	the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234	0.8573	8	126
5ujp-assembly1.cif.gz_B	the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234	0.8504	8	126
5ump-assembly1.cif.gz_B	crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234	0.8468	3	127

ID	Description	Score	Start	End	Superfamily
5ujpB00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8538	8	126	3.10.180.10
5ujpB00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8468	8	126	3.10.180.10
5uhjB00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8176	8	128	3.10.180.10
4hc5C00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8079	8	126	3.10.180.10
5uhjB00	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.7804	8	128	3.10.180.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2A5JF16-F1-model_v4	Glyoxalase	0.9884	5	145
AF-A0A838PUE2-F1-model_v4	VOC family protein	0.9879	5	145
AF-A0A2A9CVY3-F1-model_v4	Pimeloyl-ACP methyl ester carboxylesterase	0.986	4	137
AF-A0A1H1P3Z8-F1-model_v4	Catechol 2,3-dioxygenase	0.9832	5	147	GO:0051213
AF-A0A2A5JF16-F1-model_v4	Glyoxalase	0.9746	5	145

Feature Viewer

pLDDT	pTM	Quality
91.45	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F462514

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

111

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map