F462511

General Info

Members Datasets Scaffolds Average Seq Length
550 192 550 246

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10569712|Ga0207678_105697121
Length 274
Sequence MPSVETSFSQHPRQHRRAAHPKKGTDMRRFAPLLLVAAIALPIGAAAPSGNGVIAKAVADPARPADAKAADALRLPAQTLAFSGVRPGMAVGEFFPGGGYYTRMLSDVVGPRGHVYGLENAGWKGAVDADNKVLAEGKWKNVSMDAKPFGTVSFPKPLDLVWITQNYHDLKVPQFGNVDTVAFDRAVYKALKPGGIFFVLDHQGAAGLTNAQIAKLHRINRDVVVKEVTSAGFKLAGEGKFLRRSGDDHTLPIFDKAIQGHTDQYALRFVKPAH

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 2.55
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1011558 3300001904 Bacteria 1435
2 JGI24740J21852_10000967 3300001979 Bacteria 12788
3 JGI24739J22299_10000790 3300001989 Bacteria 11557
4 JGI24737J22298_10000117 3300001990 Bacteria 24179
5 JGI24737J22298_10033480 3300001990 Bacteria 1596
6 JGI24735J21928_10024538 3300002067 Bacteria 1823
7 JGI24738J21930_10001166 3300002075 Bacteria 7419
8 JGI24742J22300_10014984 3300002244 Unclassified 1303
9 JGI25165J46597_1000133 3300003214 Bacteria 124543
10 rootL2_10205807 3300003322 Bacteria 2507
11 Ga0070658_10028774 3300005327 Bacteria 4461
12 Ga0070658_10035672 3300005327 Bacteria 4007
13 Ga0070658_10147989 3300005327 Bacteria 1965
14 Ga0070658_10311888 3300005327 Bacteria 1342
15 Ga0070676_10000679 3300005328 Bacteria 16652
16 Ga0070676_10088841 3300005328 Bacteria 1889
17 Ga0070676_10119149 3300005328 Bacteria 1654
18 Ga0070676_10213862 3300005328 Bacteria 1270
19 Ga0070683_100121814 3300005329 Bacteria 2464
20 Ga0070683_100407994 3300005329 Unclassified 1296
21 Ga0070683_100441902 3300005329 Unclassified 1241
22 Ga0070690_100045847 3300005330 Bacteria 2778
23 Ga0070670_100013411 3300005331 Bacteria 7020
24 Ga0070670_100027769 3300005331 Bacteria 4868
25 Ga0070670_100099710 3300005331 Bacteria 2499
26 Ga0068869_100000215 3300005334 Bacteria 30140
27 Ga0068869_100187308 3300005334 Bacteria 1625
28 Ga0070666_10021333 3300005335 Bacteria 4198
29 Ga0070666_10059494 3300005335 Bacteria 2584
30 Ga0070680_100118332 3300005336 Bacteria 2210
31 Ga0070680_100340964 3300005336 Bacteria 1273
32 Ga0068868_100000041 3300005338 Bacteria 69601
33 Ga0068868_100160591 3300005338 Bacteria 1856
34 Ga0070660_100000306 3300005339 Bacteria 32494
35 Ga0070660_100009651 3300005339 Bacteria 6797
36 Ga0070660_100088381 3300005339 Bacteria 2440
37 Ga0070660_100180121 3300005339 Bacteria 1710
38 Ga0070660_100192119 3300005339 Bacteria 1654
39 Ga0070661_100024191 3300005344 Bacteria 4356
40 Ga0070661_100026533 3300005344 Bacteria 4167
41 Ga0070661_100031910 3300005344 Bacteria 3811
42 Ga0070661_100362245 3300005344 Bacteria 1140
43 Ga0070692_10054069 3300005345 Bacteria 2095
44 Ga0070668_100011961 3300005347 Bacteria 6465
45 Ga0070668_100017056 3300005347 Bacteria 5433
46 Ga0070668_100115500 3300005347 Bacteria 2140
47 Ga0070668_100154959 3300005347 Bacteria 1855
48 Ga0070668_100359183 3300005347 Bacteria 1235
49 Ga0070668_100388131 3300005347 Bacteria 1190
50 Ga0070668_100487232 3300005347 Bacteria 1065
51 Ga0070669_100000556 3300005353 Bacteria 27730
52 Ga0070669_100028526 3300005353 Bacteria 4020
53 Ga0070669_100033087 3300005353 Bacteria 3737
54 Ga0070669_100140003 3300005353 Bacteria 1865
55 Ga0070669_100300597 3300005353 Bacteria 1290
56 Ga0070675_100049667 3300005354 Bacteria 3443
57 Ga0070675_100253791 3300005354 Bacteria 1540
58 Ga0070671_100005631 3300005355 Bacteria 9970
59 Ga0070671_100020496 3300005355 Bacteria 5392
60 Ga0070671_100056433 3300005355 Bacteria 3267
61 Ga0070671_100188333 3300005355 Bacteria 1749
62 Ga0070671_100511224 3300005355 Bacteria 1034
63 Ga0070674_100087156 3300005356 Bacteria 2244
64 Ga0070674_100241787 3300005356 Bacteria 1414
65 Ga0070674_100295685 3300005356 Bacteria 1289
66 Ga0070673_100001837 3300005364 Bacteria 12679
67 Ga0070673_100025102 3300005364 Bacteria 4381
68 Ga0070673_100030023 3300005364 Bacteria 4062
69 Ga0070659_100001959 3300005366 Bacteria 14698
70 Ga0070659_100011874 3300005366 Bacteria 6447
71 Ga0070659_100044301 3300005366 Bacteria 3483
72 Ga0070659_100054560 3300005366 Bacteria 3148
73 Ga0070659_100126229 3300005366 Bacteria 2076
74 Ga0070659_100222476 3300005366 Unclassified 1558
75 Ga0070667_100000368 3300005367 Bacteria 49069
76 Ga0070667_100001538 3300005367 Bacteria 20662
77 Ga0070667_100010677 3300005367 Bacteria 7587
78 Ga0070667_100063709 3300005367 Bacteria 3125
79 Ga0070667_100375180 3300005367 Unclassified 1291
80 Ga0070667_100486041 3300005367 Bacteria 1131
81 Ga0070667_100531090 3300005367 Unclassified 1080
82 Ga0070709_10086191 3300005434 Bacteria 2061
83 Ga0070714_100027398 3300005435 Bacteria 4719
84 Ga0070714_100046412 3300005435 Bacteria 3685
85 Ga0070714_100239015 3300005435 Bacteria 1676
86 Ga0070714_100711467 3300005435 Unclassified 969
87 Ga0070713_100006260 3300005436 Bacteria 8239
88 Ga0070713_100307198 3300005436 Bacteria 1462
89 Ga0070694_100017546 3300005444 Bacteria 4524
90 Ga0070663_100081089 3300005455 Bacteria 2384
91 Ga0070663_100336264 3300005455 Unclassified 1218
92 Ga0070678_100011782 3300005456 Bacteria 5408
93 Ga0070678_100183717 3300005456 Bacteria 1714
94 Ga0070662_100000733 3300005457 Bacteria 20056
95 Ga0070662_100017087 3300005457 Bacteria 4883
96 Ga0070662_100038179 3300005457 Bacteria 3410
97 Ga0070662_100168305 3300005457 Bacteria 1719
98 Ga0070662_100192805 3300005457 Unclassified 1613
99 Ga0070662_100206862 3300005457 Bacteria 1560
100 Ga0070681_10144861 3300005458 Bacteria 2305
101 Ga0070681_10231087 3300005458 Unclassified 1764
102 Ga0068867_100006812 3300005459 Bacteria 8078
103 Ga0068867_100019965 3300005459 Bacteria 4774
104 Ga0068867_100153679 3300005459 Bacteria 1809
105 Ga0070685_10051204 3300005466 Bacteria 2387
106 Ga0070685_10282313 3300005466 Unclassified 1112
107 Ga0070679_100162831 3300005530 Bacteria 2204
108 Ga0070684_100967614 3300005535 Bacteria 798
109 Ga0068853_100004031 3300005539 Bacteria 11299
110 Ga0068853_100136549 3300005539 Bacteria 2199
111 Ga0068853_100173714 3300005539 Bacteria 1951
112 Ga0070672_100000461 3300005543 Bacteria 23612
113 Ga0070672_100008182 3300005543 Bacteria 7146
114 Ga0070672_100012486 3300005543 Bacteria 5967
115 Ga0070672_100060288 3300005543 Bacteria 2987
116 Ga0070672_100242128 3300005543 Bacteria 1517
117 Ga0070696_100290863 3300005546 Bacteria 1248
118 Ga0070665_100000511 3300005548 Bacteria 55709
119 Ga0070665_100034387 3300005548 Bacteria 5097
120 Ga0068855_100021054 3300005563 Bacteria 7819
121 Ga0068855_100054497 3300005563 Bacteria 4700
122 Ga0068855_100106141 3300005563 Bacteria 3229
123 Ga0070664_100026124 3300005564 Bacteria 4842
124 Ga0070664_100028887 3300005564 Bacteria 4618
125 Ga0070664_100045194 3300005564 Bacteria 3719
126 Ga0070664_100049577 3300005564 Bacteria 3551
127 Ga0070664_100139634 3300005564 Unclassified 2133
128 Ga0070664_100182388 3300005564 Bacteria 1866
129 Ga0070664_100209227 3300005564 Bacteria 1743
130 Ga0068857_100001554 3300005577 Bacteria 18393
131 Ga0068857_100279496 3300005577 Bacteria 1535
132 Ga0068854_100039388 3300005578 Bacteria 3329
133 Ga0068854_100059279 3300005578 Bacteria 2766
134 Ga0068856_100011061 3300005614 Bacteria 8763
135 Ga0068856_100376588 3300005614 Bacteria 1438
136 Ga0068852_100004942 3300005616 Bacteria 9470
137 Ga0068852_100119684 3300005616 Bacteria 2408
138 Ga0068852_100184907 3300005616 Bacteria 1962
139 Ga0068852_100243439 3300005616 Unclassified 1720
140 Ga0068859_100000281 3300005617 Bacteria 50775
141 Ga0068859_100007305 3300005617 Bacteria 11205
142 Ga0068859_100076269 3300005617 Bacteria 3393
143 Ga0068859_100105148 3300005617 Bacteria 2882
144 Ga0068859_100222180 3300005617 Bacteria 1976
145 Ga0068859_100349919 3300005617 Unclassified 1572
146 Ga0068859_100374944 3300005617 Bacteria 1518
147 Ga0068864_100000261 3300005618 Bacteria 47015
148 Ga0068864_100000721 3300005618 Bacteria 27640
149 Ga0068864_100058391 3300005618 Bacteria 3334
150 Ga0068864_100058789 3300005618 Bacteria 3324
151 Ga0068864_100073834 3300005618 Bacteria 2975
152 Ga0068864_100179894 3300005618 Bacteria 1933
153 Ga0068864_100239595 3300005618 Bacteria 1680
154 Ga0068861_100209770 3300005719 Bacteria 1640
155 Ga0068861_100257743 3300005719 Bacteria 1492
156 Ga0068851_10005386 3300005834 Bacteria 5802
157 Ga0068851_10020610 3300005834 Bacteria 3193
158 Ga0068870_10218191 3300005840 Unclassified 1166
159 Ga0068863_100015602 3300005841 Bacteria 7299
160 Ga0068863_100029810 3300005841 Bacteria 5210
161 Ga0068863_100072482 3300005841 Bacteria 3258
162 Ga0068863_100089898 3300005841 Bacteria 2912
163 Ga0068863_100203616 3300005841 Bacteria 1904
164 Ga0068863_100401173 3300005841 Bacteria 1341
165 Ga0068863_100561468 3300005841 Bacteria 1128
166 Ga0068858_100000313 3300005842 Bacteria 51649
167 Ga0068858_100000919 3300005842 Bacteria 30552
168 Ga0068858_100004078 3300005842 Bacteria 14394
169 Ga0068858_100008371 3300005842 Bacteria 9949
170 Ga0068858_100041013 3300005842 Bacteria 4293
171 Ga0068858_100431929 3300005842 Bacteria 1267
172 Ga0068860_100000867 3300005843 Bacteria 33656
173 Ga0068860_100004735 3300005843 Bacteria 13869
174 Ga0068860_100007585 3300005843 Bacteria 10857
175 Ga0068860_100293410 3300005843 Bacteria 1592
176 Ga0068860_100536909 3300005843 Bacteria 1170
177 Ga0068860_100576102 3300005843 Bacteria 1129
178 Ga0068862_100004671 3300005844 Bacteria 11530
179 Ga0068862_100005057 3300005844 Bacteria 11094
180 Ga0068862_100022478 3300005844 Bacteria 5275
181 Ga0068862_100101333 3300005844 Bacteria 2519
182 Ga0068862_100115531 3300005844 Bacteria 2360
183 Ga0068862_100355299 3300005844 Bacteria 1360
184 Ga0068862_100541351 3300005844 Unclassified 1111
185 Ga0070717_10002915 3300006028 Bacteria 12148
186 Ga0097621_100068653 3300006237 Bacteria 2924
187 Ga0097621_100158634 3300006237 Bacteria 1943
188 Ga0097621_100209501 3300006237 Bacteria 1695
189 Ga0097621_100412421 3300006237 Unclassified 1211
190 Ga0068871_100020888 3300006358 Bacteria 5022
191 Ga0068871_100079789 3300006358 Bacteria 2709
192 Ga0075431_100385950 3300006847 Bacteria 1404
193 Ga0075433_10011356 3300006852 Bacteria 7169
194 Ga0068865_100013656 3300006881 Bacteria 5141
195 Ga0068865_100050933 3300006881 Bacteria 2863
196 Ga0068865_100194949 3300006881 Unclassified 1569
197 Ga0068865_100256131 3300006881 Unclassified 1383
198 Ga0097620_100000281 3300006931 Bacteria 50775
199 Ga0097620_100007305 3300006931 Bacteria 11205
200 Ga0097620_100076271 3300006931 Bacteria 3393
201 Ga0097620_100105146 3300006931 Bacteria 2882
202 Ga0097620_100222191 3300006931 Bacteria 1976
203 Ga0097620_100349896 3300006931 Unclassified 1572
204 Ga0097620_100374950 3300006931 Bacteria 1518
205 Ga0075435_100277658 3300007076 Bacteria 1430
206 Ga0099795_10004655 3300007788 Bacteria 3567
207 Ga0105251_10046744 3300009011 Bacteria 2082
208 Ga0105250_10025746 3300009092 Bacteria 2370
209 Ga0105240_10121220 3300009093 Bacteria 3148
210 Ga0105240_11157728 3300009093 Bacteria 821
211 Ga0105245_10000433 3300009098 Bacteria 38731
212 Ga0105245_10113305 3300009098 Bacteria 2525
213 Ga0105243_10105188 3300009148 Bacteria 2350
214 Ga0105243_10663833 3300009148 Bacteria 1012
215 Ga0105242_10078575 3300009176 Bacteria 2755
216 Ga0105248_10000502 3300009177 Bacteria 44596
217 Ga0105248_10003885 3300009177 Bacteria 16517
218 Ga0105248_10009109 3300009177 Bacteria 10918
219 Ga0105248_10015210 3300009177 Bacteria 8480
220 Ga0105248_10024503 3300009177 Bacteria 6708
221 Ga0105248_10026767 3300009177 Bacteria 6414
222 Ga0105248_10118392 3300009177 Bacteria 2988
223 Ga0105248_11121417 3300009177 Unclassified 889
224 Ga0105237_10517520 3300009545 Bacteria 1200
225 Ga0105238_10020835 3300009551 Bacteria 6679
226 Ga0105238_10049795 3300009551 Bacteria 4218
227 Ga0105238_10135699 3300009551 Bacteria 2438
228 Ga0105238_10203978 3300009551 Bacteria 1953
229 Ga0105249_10044928 3300009553 Bacteria 4017
230 Ga0105249_10081986 3300009553 Bacteria 3000
231 Ga0105249_10246399 3300009553 Bacteria 1769
232 Ga0105249_10428546 3300009553 Bacteria 1358
233 Ga0105249_10626279 3300009553 Bacteria 1132
234 Ga0099796_10037327 3300010159 Bacteria 1623
235 Ga0105239_10029465 3300010375 Bacteria 6035
236 Ga0105246_10041178 3300011119 Bacteria 3121
237 Ga0105246_10553927 3300011119 Unclassified 986
238 Ga0157373_10005459 3300013100 Bacteria 9546
239 Ga0157373_10010183 3300013100 Bacteria 6925
240 Ga0157373_10058868 3300013100 Bacteria 2723
241 Ga0157371_10001574 3300013102 Bacteria 23422
242 Ga0157371_10172867 3300013102 Unclassified 1544
243 Ga0157371_10325756 3300013102 Bacteria 1115
244 Ga0157370_10000289 3300013104 Bacteria 63849
245 Ga0157370_10189864 3300013104 Bacteria 1907
246 Ga0157370_10345513 3300013104 Bacteria 1371
247 Ga0157369_10029167 3300013105 Bacteria 6099
248 Ga0157374_10021305 3300013296 Bacteria 5766
249 Ga0157374_10136351 3300013296 Bacteria 2380
250 Ga0157374_10588273 3300013296 Bacteria 1122
251 Ga0157374_10590291 3300013296 Bacteria 1120
252 Ga0157378_10004424 3300013297 Bacteria 12369
253 Ga0157378_10359996 3300013297 Bacteria 1424
254 Ga0163162_10013232 3300013306 Bacteria 8059
255 Ga0163162_10019183 3300013306 Bacteria 6706
256 Ga0163162_10027339 3300013306 Bacteria 5641
257 Ga0163162_10164220 3300013306 Bacteria 2344
258 Ga0163162_10518562 3300013306 Bacteria 1321
259 Ga0157372_10729891 3300013307 Bacteria 1152
260 Ga0157375_10019402 3300013308 Bacteria 6184
261 Ga0157375_10112470 3300013308 Bacteria 2823
262 Ga0157375_10180136 3300013308 Bacteria 2264
263 Ga0157375_10420301 3300013308 Bacteria 1503
264 Ga0163163_10000164 3300014325 Bacteria 69244
265 Ga0182008_10109885 3300014497 Bacteria 1366
266 Ga0157379_10050940 3300014968 Bacteria 3697
267 Ga0213876_10015773 3300021384 Bacteria 3998
268 Ga0209233_1000042 3300025261 Bacteria 510519
269 Ga0207673_1000631 3300025290 Bacteria 3761
270 Ga0207697_10000296 3300025315 Bacteria 27773
271 Ga0207697_10009281 3300025315 Bacteria 4256
272 Ga0207656_10007390 3300025321 Bacteria 3999
273 Ga0207656_10048095 3300025321 Bacteria 1835
274 Ga0207696_1025276 3300025711 Unclassified 1854
275 Ga0207682_10088411 3300025893 Bacteria 1339
276 Ga0207688_10003923 3300025901 Bacteria 8111
277 Ga0207688_10190201 3300025901 Bacteria 1227
278 Ga0207680_10041170 3300025903 Bacteria 2694
279 Ga0207680_10178288 3300025903 Unclassified 1435
280 Ga0207680_10220462 3300025903 Unclassified 1300
281 Ga0207647_10000047 3300025904 Bacteria 89112
282 Ga0207647_10006533 3300025904 Bacteria 8472
283 Ga0207647_10031148 3300025904 Bacteria 3434
284 Ga0207699_10203292 3300025906 Unclassified 1344
285 Ga0207645_10001679 3300025907 Bacteria 18006
286 Ga0207645_10008603 3300025907 Bacteria 7108
287 Ga0207645_10084228 3300025907 Bacteria 2040
288 Ga0207645_10213870 3300025907 Bacteria 1270
289 Ga0207705_10000162 3300025909 Bacteria 71983
290 Ga0207705_10001025 3300025909 Bacteria 22684
291 Ga0207705_10049848 3300025909 Bacteria 3014
292 Ga0207705_10111690 3300025909 Bacteria 2020
293 Ga0207705_10111996 3300025909 Bacteria 2017
294 Ga0207705_10136139 3300025909 Bacteria 1831
295 Ga0207705_10252542 3300025909 Bacteria 1345
296 Ga0207705_10543259 3300025909 Bacteria 903
297 Ga0207707_10192099 3300025912 Bacteria 1781
298 Ga0207657_10003423 3300025919 Bacteria 16942
299 Ga0207657_10010654 3300025919 Bacteria 9157
300 Ga0207657_10081830 3300025919 Bacteria 2711
301 Ga0207649_10038367 3300025920 Bacteria 2900
302 Ga0207649_10098492 3300025920 Bacteria 1930
303 Ga0207649_10244322 3300025920 Unclassified 1290
304 Ga0207681_10006102 3300025923 Bacteria 7390
305 Ga0207681_10010628 3300025923 Bacteria 5644
306 Ga0207681_10034532 3300025923 Bacteria 3326
307 Ga0207681_10046048 3300025923 Bacteria 2932
308 Ga0207694_10045319 3300025924 Bacteria 3397
309 Ga0207694_10049293 3300025924 Bacteria 3260
310 Ga0207694_10066367 3300025924 Bacteria 2815
311 Ga0207694_10104477 3300025924 Bacteria 2248
312 Ga0207650_10005752 3300025925 Bacteria 8457
313 Ga0207650_10039942 3300025925 Bacteria 3431
314 Ga0207650_10225413 3300025925 Bacteria 1510
315 Ga0207659_10618235 3300025926 Bacteria 924
316 Ga0207687_10008683 3300025927 Bacteria 6639
317 Ga0207687_10051772 3300025927 Bacteria 2863
318 Ga0207700_10026323 3300025928 Bacteria 4054
319 Ga0207664_10041819 3300025929 Bacteria 3573
320 Ga0207664_10141920 3300025929 Bacteria 2033
321 Ga0207644_10007993 3300025931 Bacteria 6917
322 Ga0207644_10023819 3300025931 Bacteria 4197
323 Ga0207644_10054024 3300025931 Bacteria 2892
324 Ga0207644_10076217 3300025931 Bacteria 2467
325 Ga0207690_10003458 3300025932 Bacteria 9422
326 Ga0207690_10027068 3300025932 Bacteria 3620
327 Ga0207706_10000103 3300025933 Bacteria 89756
328 Ga0207706_10008086 3300025933 Bacteria 9707
329 Ga0207706_10008319 3300025933 Bacteria 9566
330 Ga0207706_10030172 3300025933 Bacteria 4838
331 Ga0207706_10038076 3300025933 Bacteria 4267
332 Ga0207706_10090419 3300025933 Bacteria 2692
333 Ga0207706_10180044 3300025933 Bacteria 1856
334 Ga0207706_10217881 3300025933 Bacteria 1672
335 Ga0207709_10064959 3300025935 Bacteria 2293
336 Ga0207669_10049176 3300025937 Bacteria 2511
337 Ga0207669_10063846 3300025937 Bacteria 2276
338 Ga0207669_10199891 3300025937 Bacteria 1450
339 Ga0207704_10029477 3300025938 Bacteria 3061
340 Ga0207704_10481079 3300025938 Bacteria 997
341 Ga0207665_10037167 3300025939 Bacteria 3240
342 Ga0207691_10000586 3300025940 Bacteria 36317
343 Ga0207691_10004673 3300025940 Bacteria 13258
344 Ga0207691_10015125 3300025940 Bacteria 7343
345 Ga0207691_10029981 3300025940 Bacteria 5087
346 Ga0207691_10067499 3300025940 Bacteria 3233
347 Ga0207691_10517223 3300025940 Unclassified 1013
348 Ga0207711_10000042 3300025941 Bacteria 158782
349 Ga0207711_10005337 3300025941 Bacteria 10898
350 Ga0207711_10005454 3300025941 Bacteria 10751
351 Ga0207711_10011758 3300025941 Bacteria 7271
352 Ga0207711_10015735 3300025941 Bacteria 6274
353 Ga0207711_10070576 3300025941 Bacteria 3030
354 Ga0207689_10000242 3300025942 Bacteria 48659
355 Ga0207689_10015415 3300025942 Bacteria 6472
356 Ga0207689_10031212 3300025942 Bacteria 4438
357 Ga0207689_10155344 3300025942 Bacteria 1886
358 Ga0207661_10617437 3300025944 Bacteria 996
359 Ga0207679_10010627 3300025945 Bacteria 5932
360 Ga0207679_10018031 3300025945 Bacteria 4720
361 Ga0207679_10020448 3300025945 Bacteria 4467
362 Ga0207679_10414087 3300025945 Bacteria 1188
363 Ga0207679_10550650 3300025945 Unclassified 1035
364 Ga0207667_10021080 3300025949 Bacteria 7228
365 Ga0207667_10026635 3300025949 Bacteria 6311
366 Ga0207667_10028946 3300025949 Bacteria 6013
367 Ga0207651_10010629 3300025960 Bacteria 5110
368 Ga0207651_10017768 3300025960 Bacteria 4210
369 Ga0207712_10022903 3300025961 Bacteria 4118
370 Ga0207712_10042877 3300025961 Bacteria 3119
371 Ga0207712_10173591 3300025961 Bacteria 1687
372 Ga0207712_10238034 3300025961 Bacteria 1465
373 Ga0207712_10242446 3300025961 Bacteria 1453
374 Ga0207668_10001278 3300025972 Bacteria 14997
375 Ga0207668_10022726 3300025972 Bacteria 4020
376 Ga0207668_10149285 3300025972 Bacteria 1807
377 Ga0207668_10232461 3300025972 Bacteria 1487
378 Ga0207640_10000173 3300025981 Bacteria 46801
379 Ga0207640_10005481 3300025981 Bacteria 6919
380 Ga0207640_10085533 3300025981 Bacteria 2169
381 Ga0207640_10209522 3300025981 Bacteria 1484
382 Ga0207640_10471114 3300025981 Bacteria 1039
383 Ga0207640_10568424 3300025981 Bacteria 955
384 Ga0207658_10011011 3300025986 Bacteria 6156
385 Ga0207658_10011801 3300025986 Bacteria 5953
386 Ga0207658_10093519 3300025986 Bacteria 2337
387 Ga0207658_10109421 3300025986 Bacteria 2181
388 Ga0207658_10409026 3300025986 Unclassified 1194
389 Ga0207658_10432661 3300025986 Unclassified 1162
390 Ga0207677_10016929 3300026023 Bacteria 4331
391 Ga0207677_10382272 3300026023 Unclassified 1189
392 Ga0207703_10000961 3300026035 Bacteria 27866
393 Ga0207703_10005559 3300026035 Bacteria 10116
394 Ga0207703_10008455 3300026035 Bacteria 8132
395 Ga0207639_10002541 3300026041 Bacteria 12243
396 Ga0207639_10053881 3300026041 Bacteria 3071
397 Ga0207639_10112720 3300026041 Bacteria 2220
398 Ga0207639_10284089 3300026041 Bacteria 1456
399 Ga0207678_10009081 3300026067 Bacteria 8752
400 Ga0207678_10033246 3300026067 Bacteria 4494
401 Ga0207678_10121133 3300026067 Bacteria 2233
402 Ga0207678_10273353 3300026067 Bacteria 1449
403 Ga0207678_10569712 3300026067 Bacteria 991
404 Ga0207702_10055296 3300026078 Bacteria 3366
405 Ga0207641_10000415 3300026088 Bacteria 49760
406 Ga0207641_10066781 3300026088 Bacteria 3079
407 Ga0207641_10075612 3300026088 Bacteria 2908
408 Ga0207641_10144727 3300026088 Bacteria 2148
409 Ga0207641_10299079 3300026088 Bacteria 1519
410 Ga0207641_10475697 3300026088 Bacteria 1210
411 Ga0207648_10001953 3300026089 Bacteria 22530
412 Ga0207648_10010578 3300026089 Bacteria 8729
413 Ga0207676_10000456 3300026095 Bacteria 34458
414 Ga0207676_10001202 3300026095 Bacteria 19413
415 Ga0207676_10001763 3300026095 Bacteria 15856
416 Ga0207676_10033010 3300026095 Bacteria 3907
417 Ga0207676_10061310 3300026095 Bacteria 2977
418 Ga0207676_10158935 3300026095 Bacteria 1956
419 Ga0207676_10290229 3300026095 Bacteria 1489
420 Ga0207674_10000283 3300026116 Bacteria 64153
421 Ga0207674_10000632 3300026116 Bacteria 45854
422 Ga0207674_10050506 3300026116 Bacteria 4248
423 Ga0207674_10053445 3300026116 Bacteria 4117
424 Ga0207674_10381785 3300026116 Bacteria 1362
425 Ga0207675_100056720 3300026118 Bacteria 3653
426 Ga0207675_100210415 3300026118 Bacteria 1870
427 Ga0207675_100325746 3300026118 Bacteria 1501
428 Ga0207675_100770851 3300026118 Unclassified 974
429 Ga0207683_10001172 3300026121 Bacteria 23710
430 Ga0207683_10014680 3300026121 Bacteria 6670
431 Ga0207683_10027184 3300026121 Bacteria 4944
432 Ga0207683_10120321 3300026121 Bacteria 2357
433 Ga0207683_10146273 3300026121 Bacteria 2131
434 Ga0207683_10161119 3300026121 Bacteria 2028
435 Ga0207698_10028473 3300026142 Bacteria 3983
436 Ga0207698_10584222 3300026142 Bacteria 1099
437 Ga0268266_10002822 3300028379 Bacteria 18125
438 Ga0268266_10029135 3300028379 Bacteria 4693
439 Ga0268266_10283710 3300028379 Bacteria 1540
440 Ga0268265_10005411 3300028380 Bacteria 8737
441 Ga0268265_10006133 3300028380 Bacteria 8155
442 Ga0268265_10010146 3300028380 Bacteria 6359
443 Ga0268265_10033066 3300028380 Bacteria 3756
444 Ga0268265_10041273 3300028380 Bacteria 3413
445 Ga0268265_10060565 3300028380 Bacteria 2901
446 Ga0268265_10154224 3300028380 Bacteria 1941
447 Ga0268265_10600773 3300028380 Unclassified 1051
448 Ga0268264_10000710 3300028381 Bacteria 38345
449 Ga0268264_10000750 3300028381 Bacteria 36591
450 Ga0268264_10002499 3300028381 Bacteria 16169
451 Ga0268264_10074606 3300028381 Bacteria 2882
452 Ga0268264_10365975 3300028381 Unclassified 1377
453 Ga0307517_10014765 3300028786 Bacteria 10456
454 Ga0307508_10027339 3300031616 Bacteria 5164
455 Ga0373923_0135582 3300035111 Bacteria 1110
456 Ga0395899_0000900 3300037312 Bacteria 28020
457 Ga0395899_0026216 3300037312 Bacteria 4398
458 Ga0395899_0030363 3300037312 Bacteria 4065
459 Ga0395899_0034781 3300037312 Bacteria 3784
460 Ga0395899_0038124 3300037312 Bacteria 3601
461 Ga0395899_0175708 3300037312 Bacteria 1506
462 Ga0395900_0019728 3300037418 Bacteria 6872
463 Ga0395900_0021839 3300037418 Bacteria 6544
464 Ga0395900_0035040 3300037418 Bacteria 5169
465 Ga0395900_0035633 3300037418 Bacteria 5126
466 Ga0395900_0037392 3300037418 Bacteria 5005
467 Ga0395900_0134864 3300037418 Bacteria 2529
468 Ga0395900_0173728 3300037418 Bacteria 2192
469 Ga0395900_0223808 3300037418 Bacteria 1895
470 Ga0395900_0282477 3300037418 Bacteria 1651
471 Ga0395900_0619243 3300037418 Unclassified 1021
472 Ga0395900_0792890 3300037418 Bacteria 876
473 Ga0395898_0032519 3300037466 Bacteria 5207
474 Ga0395898_0033000 3300037466 Bacteria 5168
475 Ga0395898_0055823 3300037466 Bacteria 3852
476 Ga0395898_0124579 3300037466 Bacteria 2469
477 Ga0395898_0287398 3300037466 Bacteria 1569
478 Ga0395898_0349605 3300037466 Bacteria 1410
479 Ga0395905_0003695 3300037471 Bacteria 16195
480 Ga0395905_0008567 3300037471 Bacteria 10083
481 Ga0395905_0031710 3300037471 Bacteria 4972
482 Ga0395905_0039162 3300037471 Bacteria 4447
483 Ga0395905_0041077 3300037471 Bacteria 4340
484 Ga0395905_0070282 3300037471 Bacteria 3280
485 Ga0395905_0073573 3300037471 Bacteria 3203
486 Ga0395905_0075851 3300037471 Bacteria 3151
487 Ga0395905_0076530 3300037471 Bacteria 3136
488 Ga0395905_0099596 3300037471 Bacteria 2729
489 Ga0395905_0139421 3300037471 Bacteria 2281
490 Ga0395905_0147267 3300037471 Bacteria 2215
491 Ga0395905_0167698 3300037471 Bacteria 2063
492 Ga0395905_0184549 3300037471 Bacteria 1958
493 Ga0395905_0205863 3300037471 Bacteria 1844
494 Ga0395905_0371659 3300037471 Bacteria 1323
495 Ga0436364_0211064 3300037853 Bacteria 2607
496 Ga0436364_0678788 3300037853 Bacteria 2410
497 Ga0395901_0010819 3300038443 Bacteria 9248
498 Ga0395901_0045294 3300038443 Bacteria 4564
499 Ga0395901_0060462 3300038443 Bacteria 3943
500 Ga0395901_0060863 3300038443 Bacteria 3929
501 Ga0395901_0080846 3300038443 Bacteria 3394
502 Ga0395901_0158839 3300038443 Bacteria 2374
503 Ga0395901_0266013 3300038443 Bacteria 1784
504 Ga0436365_0481817 3300039437 Bacteria 15552
505 Ga0436365_1217136 3300039437 Bacteria 2215
506 Ga0439464_0044966 3300042439 Bacteria 1266
507 Ga0466972_0132149 3300044658 Unclassified 1176
508 Ga0466961_0285121 3300044693 Bacteria 1010
509 Ga0466963_0003989 3300044694 Bacteria 8537
510 Ga0466963_0024156 3300044694 Bacteria 3868
511 Ga0466963_0068259 3300044694 Bacteria 2387
512 Ga0466971_0239970 3300044719 Bacteria 862
513 Ga0466968_0110502 3300044735 Bacteria 1236
514 Ga0466970_0125952 3300044765 Bacteria 1405
515 Ga0466957_0224152 3300044842 Bacteria 1242
516 Ga0466957_0351226 3300044842 Unclassified 1000
517 Ga0466959_0473107 3300045049 Unclassified 848
518 Ga0466958_0017883 3300045836 Bacteria 4107
519 Ga0466967_0059800 3300045976 Bacteria 3374
520 Ga0466967_0244289 3300045976 Bacteria 1713
521 Ga0466967_0277194 3300045976 Bacteria 1608
522 Ga0466967_0568195 3300045976 Bacteria 1117
523 Ga0495606_0248922 3300046507 Unclassified 987
524 Ga0495668_0009427 3300046616 Bacteria 5997
525 Ga0495669_0005424 3300046684 Bacteria 5322
526 Ga0495686_0000183 3300047472 Bacteria 119585
527 Ga0495686_0001393 3300047472 Bacteria 26806
528 Ga0496101_0058863 3300048904 Bacteria 2784
529 Ga0496106_0240869 3300048909 Bacteria 1445
530 Ga0496107_0067058 3300048910 Bacteria 2603
531 Ga0496107_0380075 3300048910 Bacteria 1051
532 Ga0496108_0046784 3300048911 Bacteria 3615
533 Ga0496109_0034955 3300048912 Bacteria 4530
534 Ga0496112_0012266 3300048915 Bacteria 7870
535 Ga0496112_0125563 3300048915 Bacteria 2537
536 Ga0496112_0257461 3300048915 Bacteria 1695
537 Ga0496112_0334405 3300048915 Bacteria 1458
538 Ga0496113_0052991 3300048916 Bacteria 3032
539 Ga0496114_0742432 3300048917 Bacteria 859
540 Ga0496115_0054892 3300048918 Bacteria 3199
541 Ga0496115_0185939 3300048918 Bacteria 1717
542 Ga0501067_0034496 3300049583 Bacteria 2808
543 Ga0501074_0035046 3300049590 Bacteria 3637
544 Ga0501080_0173418 3300049742 Bacteria 1988
545 nmdc:mga06r32_379167_c1 3300050510 Bacteria 1397
546 nmdc:mga0a205_6815_c1 3300050515 Bacteria 10335
547 Ga0500658_0000329 3300053134 Bacteria 21052
548 Ga0500559_0016966 3300053136 Bacteria 3076
549 Ga0466962_0078942 3300061719 Bacteria 1573
550 Ga0466962_0146785 3300061719 Unclassified 1144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100000511 Ga0070665_10000051142 208
2 3300028379 Ga0268266_10002822 Ga0268266_1000282213 208
3 3300037471 Ga0395905_0167698 Ga0395905_0167698_1241_1972 210
4 3300009093 Ga0105240_10121220 Ga0105240_101212203 212
5 3300005546 Ga0070696_100290863 Ga0070696_1002908632 215
6 3300025907 Ga0207645_10213870 Ga0207645_102138703 215
7 3300025981 Ga0207640_10005481 Ga0207640_100054816 215
8 3300037471 Ga0395905_0371659 Ga0395905_0371659_366_1112 215
9 3300038443 Ga0395901_0080846 Ga0395901_0080846_835_1581 215
10 3300042439 Ga0439464_0044966 Ga0439464_0044966_330_1070 217
11 3300005327 Ga0070658_10147989 Ga0070658_101479892 219
12 3300005366 Ga0070659_100054560 Ga0070659_1000545603 219
13 3300013100 Ga0157373_10058868 Ga0157373_100588682 219
14 3300025909 Ga0207705_10111690 Ga0207705_101116902 219
15 3300037853 Ga0436364_0211064 Ga0436364_0211064_1767_2510 219
16 3300028380 Ga0268265_10154224 Ga0268265_101542242 221
17 3300025940 Ga0207691_10517223 Ga0207691_105172231 222
18 3300028786 Ga0307517_10014765 Ga0307517_100147653 222
19 3300037471 Ga0395905_0041077 Ga0395905_0041077_1278_2006 225
20 3300044693 Ga0466961_0285121 Ga0466961_0285121_44_784 225
21 3300005339 Ga0070660_100000306 Ga0070660_10000030625 226
22 3300005366 Ga0070659_100222476 Ga0070659_1002224762 226
23 3300005548 Ga0070665_100034387 Ga0070665_1000343874 226
24 3300025909 Ga0207705_10000162 Ga0207705_1000016250 226
25 3300025919 Ga0207657_10010654 Ga0207657_100106544 226
26 3300025925 Ga0207650_10225413 Ga0207650_102254133 226
27 3300026118 Ga0207675_100210415 Ga0207675_1002104152 226
28 3300037312 Ga0395899_0026216 Ga0395899_0026216_422_1168 226
29 3300037466 Ga0395898_0033000 Ga0395898_0033000_3885_4631 226
30 3300045836 Ga0466958_0017883 Ga0466958_0017883_2678_3439 226
31 3300005844 Ga0068862_100005057 Ga0068862_1000050577 227
32 3300006237 Ga0097621_100068653 Ga0097621_1000686533 227
33 3300006237 Ga0097621_100158634 Ga0097621_1001586343 227
34 3300006358 Ga0068871_100020888 Ga0068871_1000208884 227
35 3300009177 Ga0105248_10024503 Ga0105248_100245037 227
36 3300009553 Ga0105249_10246399 Ga0105249_102463992 227
37 3300025909 Ga0207705_10136139 Ga0207705_101361392 227
38 3300025924 Ga0207694_10066367 Ga0207694_100663672 227
39 3300028380 Ga0268265_10010146 Ga0268265_100101466 227
40 3300037471 Ga0395905_0070282 Ga0395905_0070282_1837_2580 227
41 3300045976 Ga0466967_0277194 Ga0466967_0277194_476_1210 228
42 3300005328 Ga0070676_10213862 Ga0070676_102138622 229
43 3300005331 Ga0070670_100027769 Ga0070670_1000277693 229
44 3300005344 Ga0070661_100024191 Ga0070661_1000241913 229
45 3300005535 Ga0070684_100967614 Ga0070684_1009676141 229
46 3300005564 Ga0070664_100049577 Ga0070664_1000495772 229
47 3300025920 Ga0207649_10038367 Ga0207649_100383672 229
48 3300025925 Ga0207650_10039942 Ga0207650_100399422 229
49 3300025940 Ga0207691_10029981 Ga0207691_100299816 229
50 3300025945 Ga0207679_10018031 Ga0207679_100180314 229
51 3300005347 Ga0070668_100487232 Ga0070668_1004872321 230
52 3300005618 Ga0068864_100058789 Ga0068864_1000587895 230
53 3300025321 Ga0207656_10048095 Ga0207656_100480953 230
54 3300025933 Ga0207706_10030172 Ga0207706_100301725 230
55 3300025937 Ga0207669_10199891 Ga0207669_101998912 230
56 3300026095 Ga0207676_10290229 Ga0207676_102902292 230
57 3300026121 Ga0207683_10027184 Ga0207683_100271846 230
58 3300014497 Ga0182008_10109885 Ga0182008_101098852 231
59 3300048915 Ga0496112_0125563 Ga0496112_0125563_495_1238 231
60 3300005355 Ga0070671_100005631 Ga0070671_1000056317 232
61 3300005356 Ga0070674_100241787 Ga0070674_1002417872 232
62 3300005456 Ga0070678_100011782 Ga0070678_1000117825 232
63 3300005457 Ga0070662_100017087 Ga0070662_1000170874 232
64 3300005459 Ga0068867_100153679 Ga0068867_1001536792 232
65 3300025903 Ga0207680_10178288 Ga0207680_101782882 232
66 3300025931 Ga0207644_10007993 Ga0207644_100079938 232
67 3300025933 Ga0207706_10090419 Ga0207706_100904192 232
68 3300026121 Ga0207683_10001172 Ga0207683_1000117212 232
69 3300037418 Ga0395900_0223808 Ga0395900_0223808_577_1335 232
70 3300037471 Ga0395905_0147267 Ga0395905_0147267_19_777 232
71 3300005356 Ga0070674_100295685 Ga0070674_1002956851 233
72 3300005458 Ga0070681_10231087 Ga0070681_102310872 233
73 3300026121 Ga0207683_10120321 Ga0207683_101203213 233
74 3300005339 Ga0070660_100180121 Ga0070660_1001801211 234
75 3300005617 Ga0068859_100349919 Ga0068859_1003499192 234
76 3300005618 Ga0068864_100239595 Ga0068864_1002395952 234
77 3300005844 Ga0068862_100541351 Ga0068862_1005413512 234
78 3300006931 Ga0097620_100349896 Ga0097620_1003498962 234
79 3300009148 Ga0105243_10663833 Ga0105243_106638331 234
80 3300028380 Ga0268265_10600773 Ga0268265_106007732 234
81 3300003322 rootL2_10205807 rootL2_102058072 235
82 3300005844 Ga0068862_100004671 Ga0068862_10000467111 236
83 3300026118 Ga0207675_100770851 Ga0207675_1007708512 236
84 3300028380 Ga0268265_10005411 Ga0268265_100054115 236
85 3300044842 Ga0466957_0351226 Ga0466957_0351226_54_767 236
86 3300045049 Ga0466959_0473107 Ga0466959_0473107_13_726 236
87 3300047472 Ga0495686_0000183 Ga0495686_0000183_114834_115589 236
88 3300061719 Ga0466962_0146785 Ga0466962_0146785_88_801 236
89 3300035111 Ga0373923_0135582 Ga0373923_0135582_319_1044 237
90 3300044694 Ga0466963_0068259 Ga0466963_0068259_405_1133 237
91 3300045976 Ga0466967_0568195 Ga0466967_0568195_147_875 237
92 3300037418 Ga0395900_0035633 Ga0395900_0035633_4088_4813 238
93 3300037312 Ga0395899_0175708 Ga0395899_0175708_398_1126 239
94 3300037471 Ga0395905_0031710 Ga0395905_0031710_3477_4205 239
95 3300053136 Ga0500559_0016966 Ga0500559_0016966_2245_3006 239
96 3300039437 Ga0436365_1217136 Ga0436365_1217136_875_1618 240
97 3300046616 Ga0495668_0009427 Ga0495668_0009427_2639_3379 240
98 3300005435 Ga0070714_100239015 Ga0070714_1002390152 241
99 3300005564 Ga0070664_100045194 Ga0070664_1000451943 241
100 3300037418 Ga0395900_0019728 Ga0395900_0019728_2427_3176 241
101 3300037418 Ga0395900_0021839 Ga0395900_0021839_4772_5539 241
102 3300037466 Ga0395898_0055823 Ga0395898_0055823_2502_3251 241
103 3300037471 Ga0395905_0003695 Ga0395905_0003695_6560_7309 241
104 3300037471 Ga0395905_0039162 Ga0395905_0039162_3194_3937 241
105 3300038443 Ga0395901_0010819 Ga0395901_0010819_3697_4446 241
106 3300044694 Ga0466963_0003989 Ga0466963_0003989_1334_2155 241
107 3300005327 Ga0070658_10035672 Ga0070658_100356723 242
108 3300005616 Ga0068852_100243439 Ga0068852_1002434393 242
109 3300007788 Ga0099795_10004655 Ga0099795_100046554 242
110 3300010159 Ga0099796_10037327 Ga0099796_100373271 242
111 3300025909 Ga0207705_10049848 Ga0207705_100498483 242
112 3300005539 Ga0068853_100136549 Ga0068853_1001365493 243
113 3300005834 Ga0068851_10005386 Ga0068851_100053865 243
114 3300013296 Ga0157374_10136351 Ga0157374_101363513 243
115 3300025321 Ga0207656_10007390 Ga0207656_100073903 243
116 3300026041 Ga0207639_10112720 Ga0207639_101127201 243
117 3300031616 Ga0307508_10027339 Ga0307508_100273392 243
118 3300037418 Ga0395900_0792890 Ga0395900_0792890_127_864 243
119 3300038443 Ga0395901_0060462 Ga0395901_0060462_1196_1933 243
120 3300048904 Ga0496101_0058863 Ga0496101_0058863_1757_2494 243
121 3300048910 Ga0496107_0067058 Ga0496107_0067058_653_1390 243
122 3300048915 Ga0496112_0334405 Ga0496112_0334405_608_1345 243
123 3300048917 Ga0496114_0742432 Ga0496114_0742432_62_799 243
124 3300048918 Ga0496115_0054892 Ga0496115_0054892_2093_2830 243
125 3300003214 JGI25165J46597_1000133 JGI25165J46597_1000133113 244
126 3300005328 Ga0070676_10119149 Ga0070676_101191492 244
127 3300005339 Ga0070660_100192119 Ga0070660_1001921192 244
128 3300005355 Ga0070671_100511224 Ga0070671_1005112242 244
129 3300005455 Ga0070663_100081089 Ga0070663_1000810893 244
130 3300005457 Ga0070662_100168305 Ga0070662_1001683052 244
131 3300005539 Ga0068853_100173714 Ga0068853_1001737142 244
132 3300005616 Ga0068852_100184907 Ga0068852_1001849072 244
133 3300009545 Ga0105237_10517520 Ga0105237_105175201 244
134 3300009551 Ga0105238_10020835 Ga0105238_100208355 244
135 3300009551 Ga0105238_10049795 Ga0105238_100497953 244
136 3300009551 Ga0105238_10135699 Ga0105238_101356993 244
137 3300013104 Ga0157370_10189864 Ga0157370_101898642 244
138 3300013105 Ga0157369_10029167 Ga0157369_100291672 244
139 3300013306 Ga0163162_10027339 Ga0163162_100273394 244
140 3300021384 Ga0213876_10015773 Ga0213876_100157733 244
141 3300025261 Ga0209233_1000042 Ga0209233_100004217 244
142 3300025924 Ga0207694_10049293 Ga0207694_100492933 244
143 3300025924 Ga0207694_10104477 Ga0207694_101044772 244
144 3300025931 Ga0207644_10076217 Ga0207644_100762172 244
145 3300025933 Ga0207706_10180044 Ga0207706_101800442 244
146 3300025981 Ga0207640_10209522 Ga0207640_102095222 244
147 3300026041 Ga0207639_10053881 Ga0207639_100538812 244
148 3300026067 Ga0207678_10009081 Ga0207678_100090815 244
149 3300037312 Ga0395899_0000900 Ga0395899_0000900_8660_9415 244
150 3300037312 Ga0395899_0034781 Ga0395899_0034781_2319_3068 244
151 3300037312 Ga0395899_0038124 Ga0395899_0038124_1251_1988 244
152 3300037418 Ga0395900_0037392 Ga0395900_0037392_3958_4713 244
153 3300037418 Ga0395900_0282477 Ga0395900_0282477_567_1304 244
154 3300037418 Ga0395900_0619243 Ga0395900_0619243_245_988 244
155 3300037466 Ga0395898_0032519 Ga0395898_0032519_2036_2785 244
156 3300037466 Ga0395898_0124579 Ga0395898_0124579_388_1125 244
157 3300037471 Ga0395905_0008567 Ga0395905_0008567_5621_6358 244
158 3300037471 Ga0395905_0099596 Ga0395905_0099596_829_1578 244
159 3300037471 Ga0395905_0139421 Ga0395905_0139421_909_1664 244
160 3300037471 Ga0395905_0205863 Ga0395905_0205863_964_1707 244
161 3300038443 Ga0395901_0045294 Ga0395901_0045294_1419_2174 244
162 3300038443 Ga0395901_0060863 Ga0395901_0060863_974_1723 244
163 3300038443 Ga0395901_0266013 Ga0395901_0266013_874_1611 244
164 3300039437 Ga0436365_0481817 Ga0436365_0481817_12733_13476 244
165 3300044658 Ga0466972_0132149 Ga0466972_0132149_400_1152 244
166 3300044719 Ga0466971_0239970 Ga0466971_0239970_79_834 244
167 3300044735 Ga0466968_0110502 Ga0466968_0110502_66_818 244
168 3300044765 Ga0466970_0125952 Ga0466970_0125952_503_1258 244
169 3300045976 Ga0466967_0244289 Ga0466967_0244289_85_834 244
170 3300046507 Ga0495606_0248922 Ga0495606_0248922_105_866 244
171 3300049583 Ga0501067_0034496 Ga0501067_0034496_1815_2561 244
172 3300061719 Ga0466962_0078942 Ga0466962_0078942_769_1524 244
173 3300005336 Ga0070680_100118332 Ga0070680_1001183322 245
174 3300005434 Ga0070709_10086191 Ga0070709_100861912 245
175 3300005435 Ga0070714_100046412 Ga0070714_1000464121 245
176 3300005436 Ga0070713_100006260 Ga0070713_1000062605 245
177 3300005530 Ga0070679_100162831 Ga0070679_1001628312 245
178 3300005618 Ga0068864_100073834 Ga0068864_1000738343 245
179 3300005719 Ga0068861_100257743 Ga0068861_1002577432 245
180 3300005842 Ga0068858_100000313 Ga0068858_1000003134 245
181 3300006028 Ga0070717_10002915 Ga0070717_100029156 245
182 3300006237 Ga0097621_100412421 Ga0097621_1004124212 245
183 3300009177 Ga0105248_10009109 Ga0105248_100091095 245
184 3300009553 Ga0105249_10428546 Ga0105249_104285462 245
185 3300013102 Ga0157371_10325756 Ga0157371_103257562 245
186 3300013306 Ga0163162_10013232 Ga0163162_100132327 245
187 3300013306 Ga0163162_10518562 Ga0163162_105185622 245
188 3300025315 Ga0207697_10009281 Ga0207697_100092812 245
189 3300025906 Ga0207699_10203292 Ga0207699_102032922 245
190 3300025909 Ga0207705_10001025 Ga0207705_1000102517 245
191 3300025919 Ga0207657_10081830 Ga0207657_100818302 245
192 3300025928 Ga0207700_10026323 Ga0207700_100263234 245
193 3300025929 Ga0207664_10041819 Ga0207664_100418192 245
194 3300025939 Ga0207665_10037167 Ga0207665_100371673 245
195 3300025941 Ga0207711_10005454 Ga0207711_100054547 245
196 3300026035 Ga0207703_10000961 Ga0207703_100009615 245
197 3300026095 Ga0207676_10001763 Ga0207676_1000176317 245
198 3300026118 Ga0207675_100325746 Ga0207675_1003257462 245
199 3300037471 Ga0395905_0184549 Ga0395905_0184549_712_1467 245
200 3300037853 Ga0436364_0678788 Ga0436364_0678788_25_774 245
201 3300048918 Ga0496115_0185939 Ga0496115_0185939_514_1269 245
202 3300053134 Ga0500658_0000329 Ga0500658_0000329_4800_5540 245
203 3300001979 JGI24740J21852_10000967 JGI24740J21852_100009677 246
204 3300001989 JGI24739J22299_10000790 JGI24739J22299_1000079011 246
205 3300001990 JGI24737J22298_10000117 JGI24737J22298_1000011716 246
206 3300002067 JGI24735J21928_10024538 JGI24735J21928_100245382 246
207 3300002075 JGI24738J21930_10001166 JGI24738J21930_100011666 246
208 3300002244 JGI24742J22300_10014984 JGI24742J22300_100149842 246
209 3300005327 Ga0070658_10028774 Ga0070658_100287743 246
210 3300005327 Ga0070658_10311888 Ga0070658_103118882 246
211 3300005328 Ga0070676_10000679 Ga0070676_1000067920 246
212 3300005328 Ga0070676_10088841 Ga0070676_100888413 246
213 3300005329 Ga0070683_100121814 Ga0070683_1001218142 246
214 3300005329 Ga0070683_100407994 Ga0070683_1004079942 246
215 3300005329 Ga0070683_100441902 Ga0070683_1004419022 246
216 3300005330 Ga0070690_100045847 Ga0070690_1000458472 246
217 3300005331 Ga0070670_100013411 Ga0070670_1000134114 246
218 3300005331 Ga0070670_100099710 Ga0070670_1000997102 246
219 3300005334 Ga0068869_100000215 Ga0068869_1000002152 246
220 3300005334 Ga0068869_100187308 Ga0068869_1001873081 246
221 3300005335 Ga0070666_10021333 Ga0070666_100213334 246
222 3300005335 Ga0070666_10059494 Ga0070666_100594942 246
223 3300005336 Ga0070680_100340964 Ga0070680_1003409642 246
224 3300005338 Ga0068868_100000041 Ga0068868_10000004115 246
225 3300005339 Ga0070660_100009651 Ga0070660_1000096514 246
226 3300005344 Ga0070661_100026533 Ga0070661_1000265334 246
227 3300005344 Ga0070661_100031910 Ga0070661_1000319103 246
228 3300005344 Ga0070661_100362245 Ga0070661_1003622452 246
229 3300005347 Ga0070668_100017056 Ga0070668_1000170564 246
230 3300005347 Ga0070668_100115500 Ga0070668_1001155002 246
231 3300005347 Ga0070668_100154959 Ga0070668_1001549593 246
232 3300005353 Ga0070669_100000556 Ga0070669_10000055616 246
233 3300005353 Ga0070669_100300597 Ga0070669_1003005972 246
234 3300005354 Ga0070675_100049667 Ga0070675_1000496672 246
235 3300005355 Ga0070671_100056433 Ga0070671_1000564333 246
236 3300005356 Ga0070674_100087156 Ga0070674_1000871562 246
237 3300005364 Ga0070673_100001837 Ga0070673_1000018379 246
238 3300005364 Ga0070673_100030023 Ga0070673_1000300233 246
239 3300005366 Ga0070659_100001959 Ga0070659_1000019599 246
240 3300005366 Ga0070659_100011874 Ga0070659_1000118742 246
241 3300005367 Ga0070667_100001538 Ga0070667_10000153831 246
242 3300005367 Ga0070667_100010677 Ga0070667_1000106771 246
243 3300005367 Ga0070667_100486041 Ga0070667_1004860412 246
244 3300005455 Ga0070663_100336264 Ga0070663_1003362642 246
245 3300005456 Ga0070678_100183717 Ga0070678_1001837172 246
246 3300005457 Ga0070662_100000733 Ga0070662_10000073310 246
247 3300005457 Ga0070662_100192805 Ga0070662_1001928051 246
248 3300005457 Ga0070662_100206862 Ga0070662_1002068622 246
249 3300005458 Ga0070681_10144861 Ga0070681_101448612 246
250 3300005459 Ga0068867_100006812 Ga0068867_1000068127 246
251 3300005466 Ga0070685_10051204 Ga0070685_100512041 246
252 3300005466 Ga0070685_10282313 Ga0070685_102823131 246
253 3300005539 Ga0068853_100004031 Ga0068853_1000040317 246
254 3300005543 Ga0070672_100000461 Ga0070672_10000046129 246
255 3300005543 Ga0070672_100008182 Ga0070672_1000081822 246
256 3300005563 Ga0068855_100021054 Ga0068855_1000210547 246
257 3300005563 Ga0068855_100054497 Ga0068855_1000544972 246
258 3300005563 Ga0068855_100106141 Ga0068855_1001061413 246
259 3300005564 Ga0070664_100026124 Ga0070664_1000261244 246
260 3300005564 Ga0070664_100028887 Ga0070664_1000288872 246
261 3300005564 Ga0070664_100209227 Ga0070664_1002092272 246
262 3300005577 Ga0068857_100001554 Ga0068857_10000155423 246
263 3300005577 Ga0068857_100279496 Ga0068857_1002794962 246
264 3300005578 Ga0068854_100039388 Ga0068854_1000393883 246
265 3300005578 Ga0068854_100059279 Ga0068854_1000592793 246
266 3300005614 Ga0068856_100011061 Ga0068856_1000110617 246
267 3300005616 Ga0068852_100004942 Ga0068852_1000049427 246
268 3300005616 Ga0068852_100119684 Ga0068852_1001196844 246
269 3300005617 Ga0068859_100000281 Ga0068859_10000028158 246
270 3300005617 Ga0068859_100076269 Ga0068859_1000762694 246
271 3300005617 Ga0068859_100222180 Ga0068859_1002221802 246
272 3300005618 Ga0068864_100000261 Ga0068864_10000026138 246
273 3300005719 Ga0068861_100209770 Ga0068861_1002097702 246
274 3300005834 Ga0068851_10020610 Ga0068851_100206102 246
275 3300005840 Ga0068870_10218191 Ga0068870_102181912 246
276 3300005841 Ga0068863_100015602 Ga0068863_1000156024 246
277 3300005841 Ga0068863_100029810 Ga0068863_1000298104 246
278 3300005841 Ga0068863_100089898 Ga0068863_1000898984 246
279 3300005841 Ga0068863_100561468 Ga0068863_1005614681 246
280 3300005842 Ga0068858_100004078 Ga0068858_1000040787 246
281 3300005842 Ga0068858_100041013 Ga0068858_1000410133 246
282 3300005843 Ga0068860_100000867 Ga0068860_10000086712 246
283 3300005844 Ga0068862_100022478 Ga0068862_1000224782 246
284 3300005844 Ga0068862_100101333 Ga0068862_1001013332 246
285 3300006237 Ga0097621_100209501 Ga0097621_1002095011 246
286 3300006358 Ga0068871_100079789 Ga0068871_1000797892 246
287 3300006881 Ga0068865_100013656 Ga0068865_1000136566 246
288 3300006881 Ga0068865_100050933 Ga0068865_1000509332 246
289 3300006881 Ga0068865_100194949 Ga0068865_1001949492 246
290 3300006881 Ga0068865_100256131 Ga0068865_1002561312 246
291 3300006931 Ga0097620_100000281 Ga0097620_10000028158 246
292 3300006931 Ga0097620_100076271 Ga0097620_1000762714 246
293 3300006931 Ga0097620_100222191 Ga0097620_1002221912 246
294 3300009098 Ga0105245_10000433 Ga0105245_1000043333 246
295 3300009148 Ga0105243_10105188 Ga0105243_101051882 246
296 3300009177 Ga0105248_10003885 Ga0105248_100038852 246
297 3300009177 Ga0105248_10015210 Ga0105248_100152105 246
298 3300009177 Ga0105248_10026767 Ga0105248_100267671 246
299 3300009177 Ga0105248_11121417 Ga0105248_111214171 246
300 3300009551 Ga0105238_10203978 Ga0105238_102039782 246
301 3300013100 Ga0157373_10005459 Ga0157373_100054597 246
302 3300013100 Ga0157373_10010183 Ga0157373_100101832 246
303 3300013102 Ga0157371_10001574 Ga0157371_1000157427 246
304 3300013102 Ga0157371_10172867 Ga0157371_101728672 246
305 3300013104 Ga0157370_10000289 Ga0157370_1000028951 246
306 3300013104 Ga0157370_10345513 Ga0157370_103455132 246
307 3300013296 Ga0157374_10021305 Ga0157374_100213054 246
308 3300013297 Ga0157378_10004424 Ga0157378_100044248 246
309 3300013306 Ga0163162_10019183 Ga0163162_100191834 246
310 3300013307 Ga0157372_10729891 Ga0157372_107298912 246
311 3300013308 Ga0157375_10112470 Ga0157375_101124704 246
312 3300025315 Ga0207697_10000296 Ga0207697_1000029622 246
313 3300025893 Ga0207682_10088411 Ga0207682_100884111 246
314 3300025901 Ga0207688_10003923 Ga0207688_100039237 246
315 3300025901 Ga0207688_10190201 Ga0207688_101902012 246
316 3300025903 Ga0207680_10041170 Ga0207680_100411702 246
317 3300025903 Ga0207680_10220462 Ga0207680_102204622 246
318 3300025904 Ga0207647_10000047 Ga0207647_100000476 246
319 3300025904 Ga0207647_10031148 Ga0207647_100311482 246
320 3300025907 Ga0207645_10001679 Ga0207645_100016794 246
321 3300025907 Ga0207645_10008603 Ga0207645_100086036 246
322 3300025907 Ga0207645_10084228 Ga0207645_100842283 246
323 3300025909 Ga0207705_10111996 Ga0207705_101119962 246
324 3300025909 Ga0207705_10252542 Ga0207705_102525422 246
325 3300025912 Ga0207707_10192099 Ga0207707_101920991 246
326 3300025919 Ga0207657_10003423 Ga0207657_1000342317 246
327 3300025920 Ga0207649_10098492 Ga0207649_100984923 246
328 3300025920 Ga0207649_10244322 Ga0207649_102443222 246
329 3300025923 Ga0207681_10006102 Ga0207681_100061022 246
330 3300025923 Ga0207681_10046048 Ga0207681_100460484 246
331 3300025924 Ga0207694_10045319 Ga0207694_100453194 246
332 3300025925 Ga0207650_10005752 Ga0207650_100057524 246
333 3300025927 Ga0207687_10008683 Ga0207687_100086832 246
334 3300025931 Ga0207644_10023819 Ga0207644_100238192 246
335 3300025932 Ga0207690_10003458 Ga0207690_100034587 246
336 3300025933 Ga0207706_10000103 Ga0207706_1000010315 246
337 3300025933 Ga0207706_10008319 Ga0207706_100083195 246
338 3300025933 Ga0207706_10038076 Ga0207706_100380763 246
339 3300025935 Ga0207709_10064959 Ga0207709_100649592 246
340 3300025937 Ga0207669_10049176 Ga0207669_100491762 246
341 3300025937 Ga0207669_10063846 Ga0207669_100638462 246
342 3300025938 Ga0207704_10029477 Ga0207704_100294773 246
343 3300025938 Ga0207704_10481079 Ga0207704_104810792 246
344 3300025940 Ga0207691_10000586 Ga0207691_100005862 246
345 3300025940 Ga0207691_10004673 Ga0207691_100046733 246
346 3300025941 Ga0207711_10005337 Ga0207711_100053379 246
347 3300025941 Ga0207711_10011758 Ga0207711_100117585 246
348 3300025941 Ga0207711_10015735 Ga0207711_100157356 246
349 3300025942 Ga0207689_10000242 Ga0207689_100002427 246
350 3300025942 Ga0207689_10155344 Ga0207689_101553442 246
351 3300025944 Ga0207661_10617437 Ga0207661_106174371 246
352 3300025945 Ga0207679_10010627 Ga0207679_100106276 246
353 3300025945 Ga0207679_10020448 Ga0207679_100204484 246
354 3300025949 Ga0207667_10026635 Ga0207667_100266351 246
355 3300025949 Ga0207667_10028946 Ga0207667_100289463 246
356 3300025960 Ga0207651_10017768 Ga0207651_100177683 246
357 3300025961 Ga0207712_10238034 Ga0207712_102380342 246
358 3300025972 Ga0207668_10001278 Ga0207668_100012789 246
359 3300025972 Ga0207668_10022726 Ga0207668_100227262 246
360 3300025972 Ga0207668_10149285 Ga0207668_101492852 246
361 3300025981 Ga0207640_10000173 Ga0207640_1000017351 246
362 3300025981 Ga0207640_10085533 Ga0207640_100855332 246
363 3300025981 Ga0207640_10568424 Ga0207640_105684241 246
364 3300025986 Ga0207658_10093519 Ga0207658_100935193 246
365 3300025986 Ga0207658_10109421 Ga0207658_101094212 246
366 3300026023 Ga0207677_10016929 Ga0207677_100169295 246
367 3300026023 Ga0207677_10382272 Ga0207677_103822722 246
368 3300026035 Ga0207703_10008455 Ga0207703_100084554 246
369 3300026041 Ga0207639_10002541 Ga0207639_100025419 246
370 3300026067 Ga0207678_10033246 Ga0207678_100332462 246
371 3300026067 Ga0207678_10121133 Ga0207678_101211332 246
372 3300026067 Ga0207678_10569712 Ga0207678_105697121 246
373 3300026078 Ga0207702_10055296 Ga0207702_100552963 246
374 3300026088 Ga0207641_10066781 Ga0207641_100667814 246
375 3300026088 Ga0207641_10075612 Ga0207641_100756122 246
376 3300026088 Ga0207641_10299079 Ga0207641_102990792 246
377 3300026089 Ga0207648_10001953 Ga0207648_1000195321 246
378 3300026095 Ga0207676_10001202 Ga0207676_1000120225 246
379 3300026095 Ga0207676_10033010 Ga0207676_100330102 246
380 3300026116 Ga0207674_10000283 Ga0207674_1000028352 246
381 3300026116 Ga0207674_10050506 Ga0207674_100505062 246
382 3300026118 Ga0207675_100056720 Ga0207675_1000567205 246
383 3300026121 Ga0207683_10014680 Ga0207683_100146802 246
384 3300026121 Ga0207683_10146273 Ga0207683_101462732 246
385 3300026121 Ga0207683_10161119 Ga0207683_101611192 246
386 3300026142 Ga0207698_10028473 Ga0207698_100284732 246
387 3300028379 Ga0268266_10029135 Ga0268266_100291351 246
388 3300028379 Ga0268266_10283710 Ga0268266_102837101 246
389 3300028380 Ga0268265_10006133 Ga0268265_100061336 246
390 3300028380 Ga0268265_10033066 Ga0268265_100330662 246
391 3300028381 Ga0268264_10002499 Ga0268264_100024992 246
392 3300037418 Ga0395900_0035040 Ga0395900_0035040_13_756 246
393 3300037418 Ga0395900_0134864 Ga0395900_0134864_789_1550 246
394 3300037466 Ga0395898_0287398 Ga0395898_0287398_726_1487 246
395 3300037466 Ga0395898_0349605 Ga0395898_0349605_38_781 246
396 3300037471 Ga0395905_0075851 Ga0395905_0075851_2292_3053 246
397 3300038443 Ga0395901_0158839 Ga0395901_0158839_231_974 246
398 3300044694 Ga0466963_0024156 Ga0466963_0024156_2176_2928 246
399 3300044842 Ga0466957_0224152 Ga0466957_0224152_158_910 246
400 3300046684 Ga0495669_0005424 Ga0495669_0005424_1208_2014 246
401 3300048909 Ga0496106_0240869 Ga0496106_0240869_37_789 246
402 3300048911 Ga0496108_0046784 Ga0496108_0046784_1085_1837 246
403 3300048912 Ga0496109_0034955 Ga0496109_0034955_898_1650 246
404 3300048915 Ga0496112_0012266 Ga0496112_0012266_3988_4740 246
405 3300048915 Ga0496112_0257461 Ga0496112_0257461_136_888 246
406 3300048916 Ga0496113_0052991 Ga0496113_0052991_2221_2973 246
407 3300001904 JGI24736J21556_1011558 JGI24736J21556_10115582 247
408 3300001990 JGI24737J22298_10033480 JGI24737J22298_100334802 247
409 3300005338 Ga0068868_100160591 Ga0068868_1001605911 247
410 3300005339 Ga0070660_100088381 Ga0070660_1000883813 247
411 3300005345 Ga0070692_10054069 Ga0070692_100540694 247
412 3300005347 Ga0070668_100011961 Ga0070668_1000119616 247
413 3300005347 Ga0070668_100359183 Ga0070668_1003591831 247
414 3300005347 Ga0070668_100388131 Ga0070668_1003881312 247
415 3300005353 Ga0070669_100028526 Ga0070669_1000285262 247
416 3300005353 Ga0070669_100033087 Ga0070669_1000330874 247
417 3300005353 Ga0070669_100140003 Ga0070669_1001400032 247
418 3300005354 Ga0070675_100253791 Ga0070675_1002537911 247
419 3300005355 Ga0070671_100020496 Ga0070671_1000204962 247
420 3300005355 Ga0070671_100188333 Ga0070671_1001883332 247
421 3300005364 Ga0070673_100025102 Ga0070673_1000251022 247
422 3300005366 Ga0070659_100044301 Ga0070659_1000443013 247
423 3300005366 Ga0070659_100126229 Ga0070659_1001262293 247
424 3300005367 Ga0070667_100000368 Ga0070667_10000036811 247
425 3300005367 Ga0070667_100063709 Ga0070667_1000637093 247
426 3300005367 Ga0070667_100375180 Ga0070667_1003751802 247
427 3300005367 Ga0070667_100531090 Ga0070667_1005310901 247
428 3300005435 Ga0070714_100027398 Ga0070714_1000273982 247
429 3300005435 Ga0070714_100711467 Ga0070714_1007114671 247
430 3300005436 Ga0070713_100307198 Ga0070713_1003071982 247
431 3300005444 Ga0070694_100017546 Ga0070694_1000175464 247
432 3300005457 Ga0070662_100038179 Ga0070662_1000381794 247
433 3300005459 Ga0068867_100019965 Ga0068867_1000199651 247
434 3300005543 Ga0070672_100012486 Ga0070672_1000124862 247
435 3300005543 Ga0070672_100060288 Ga0070672_1000602881 247
436 3300005543 Ga0070672_100242128 Ga0070672_1002421282 247
437 3300005564 Ga0070664_100139634 Ga0070664_1001396343 247
438 3300005564 Ga0070664_100182388 Ga0070664_1001823882 247
439 3300005614 Ga0068856_100376588 Ga0068856_1003765882 247
440 3300005617 Ga0068859_100007305 Ga0068859_1000073054 247
441 3300005617 Ga0068859_100105148 Ga0068859_1001051482 247
442 3300005617 Ga0068859_100374944 Ga0068859_1003749442 247
443 3300005618 Ga0068864_100000721 Ga0068864_10000072114 247
444 3300005618 Ga0068864_100058391 Ga0068864_1000583912 247
445 3300005618 Ga0068864_100179894 Ga0068864_1001798942 247
446 3300005841 Ga0068863_100072482 Ga0068863_1000724823 247
447 3300005841 Ga0068863_100203616 Ga0068863_1002036162 247
448 3300005841 Ga0068863_100401173 Ga0068863_1004011732 247
449 3300005842 Ga0068858_100000919 Ga0068858_10000091918 247
450 3300005842 Ga0068858_100008371 Ga0068858_1000083715 247
451 3300005842 Ga0068858_100431929 Ga0068858_1004319292 247
452 3300005843 Ga0068860_100004735 Ga0068860_10000473510 247
453 3300005843 Ga0068860_100007585 Ga0068860_1000075858 247
454 3300005843 Ga0068860_100293410 Ga0068860_1002934101 247
455 3300005843 Ga0068860_100536909 Ga0068860_1005369092 247
456 3300005843 Ga0068860_100576102 Ga0068860_1005761022 247
457 3300005844 Ga0068862_100115531 Ga0068862_1001155312 247
458 3300005844 Ga0068862_100355299 Ga0068862_1003552992 247
459 3300006847 Ga0075431_100385950 Ga0075431_1003859502 247
460 3300006852 Ga0075433_10011356 Ga0075433_100113567 247
461 3300006931 Ga0097620_100007305 Ga0097620_1000073058 247
462 3300006931 Ga0097620_100105146 Ga0097620_1001051462 247
463 3300006931 Ga0097620_100374950 Ga0097620_1003749502 247
464 3300007076 Ga0075435_100277658 Ga0075435_1002776582 247
465 3300009011 Ga0105251_10046744 Ga0105251_100467442 247
466 3300009092 Ga0105250_10025746 Ga0105250_100257462 247
467 3300009093 Ga0105240_11157728 Ga0105240_111577281 247
468 3300009098 Ga0105245_10113305 Ga0105245_101133054 247
469 3300009176 Ga0105242_10078575 Ga0105242_100785754 247
470 3300009177 Ga0105248_10000502 Ga0105248_1000050229 247
471 3300009177 Ga0105248_10118392 Ga0105248_101183922 247
472 3300009553 Ga0105249_10044928 Ga0105249_100449282 247
473 3300009553 Ga0105249_10081986 Ga0105249_100819864 247
474 3300009553 Ga0105249_10626279 Ga0105249_106262792 247
475 3300010375 Ga0105239_10029465 Ga0105239_100294654 247
476 3300011119 Ga0105246_10041178 Ga0105246_100411784 247
477 3300011119 Ga0105246_10553927 Ga0105246_105539271 247
478 3300013296 Ga0157374_10588273 Ga0157374_105882732 247
479 3300013296 Ga0157374_10590291 Ga0157374_105902912 247
480 3300013297 Ga0157378_10359996 Ga0157378_103599962 247
481 3300013306 Ga0163162_10164220 Ga0163162_101642201 247
482 3300013308 Ga0157375_10019402 Ga0157375_100194025 247
483 3300013308 Ga0157375_10180136 Ga0157375_101801362 247
484 3300013308 Ga0157375_10420301 Ga0157375_104203012 247
485 3300014325 Ga0163163_10000164 Ga0163163_1000016430 247
486 3300014968 Ga0157379_10050940 Ga0157379_100509402 247
487 3300025290 Ga0207673_1000631 Ga0207673_10006311 247
488 3300025711 Ga0207696_1025276 Ga0207696_10252762 247
489 3300025904 Ga0207647_10006533 Ga0207647_100065338 247
490 3300025909 Ga0207705_10543259 Ga0207705_105432591 247
491 3300025923 Ga0207681_10010628 Ga0207681_100106282 247
492 3300025923 Ga0207681_10034532 Ga0207681_100345322 247
493 3300025926 Ga0207659_10618235 Ga0207659_106182351 247
494 3300025927 Ga0207687_10051772 Ga0207687_100517724 247
495 3300025929 Ga0207664_10141920 Ga0207664_101419202 247
496 3300025931 Ga0207644_10054024 Ga0207644_100540241 247
497 3300025932 Ga0207690_10027068 Ga0207690_100270682 247
498 3300025933 Ga0207706_10008086 Ga0207706_100080867 247
499 3300025933 Ga0207706_10217881 Ga0207706_102178812 247
500 3300025940 Ga0207691_10015125 Ga0207691_100151254 247
501 3300025940 Ga0207691_10067499 Ga0207691_100674992 247
502 3300025941 Ga0207711_10000042 Ga0207711_10000042150 247
503 3300025941 Ga0207711_10070576 Ga0207711_100705762 247
504 3300025942 Ga0207689_10015415 Ga0207689_100154153 247
505 3300025942 Ga0207689_10031212 Ga0207689_100312124 247
506 3300025945 Ga0207679_10414087 Ga0207679_104140872 247
507 3300025945 Ga0207679_10550650 Ga0207679_105506501 247
508 3300025949 Ga0207667_10021080 Ga0207667_100210806 247
509 3300025960 Ga0207651_10010629 Ga0207651_100106293 247
510 3300025961 Ga0207712_10022903 Ga0207712_100229033 247
511 3300025961 Ga0207712_10042877 Ga0207712_100428772 247
512 3300025961 Ga0207712_10173591 Ga0207712_101735912 247
513 3300025961 Ga0207712_10242446 Ga0207712_102424461 247
514 3300025972 Ga0207668_10232461 Ga0207668_102324612 247
515 3300025981 Ga0207640_10471114 Ga0207640_104711141 247
516 3300025986 Ga0207658_10011011 Ga0207658_100110112 247
517 3300025986 Ga0207658_10011801 Ga0207658_100118012 247
518 3300025986 Ga0207658_10409026 Ga0207658_104090262 247
519 3300025986 Ga0207658_10432661 Ga0207658_104326612 247
520 3300026035 Ga0207703_10005559 Ga0207703_100055599 247
521 3300026041 Ga0207639_10284089 Ga0207639_102840892 247
522 3300026067 Ga0207678_10273353 Ga0207678_102733532 247
523 3300026088 Ga0207641_10000415 Ga0207641_1000041542 247
524 3300026088 Ga0207641_10144727 Ga0207641_101447272 247
525 3300026088 Ga0207641_10475697 Ga0207641_104756972 247
526 3300026089 Ga0207648_10010578 Ga0207648_100105783 247
527 3300026095 Ga0207676_10000456 Ga0207676_100004567 247
528 3300026095 Ga0207676_10061310 Ga0207676_100613102 247
529 3300026095 Ga0207676_10158935 Ga0207676_101589352 247
530 3300026116 Ga0207674_10000632 Ga0207674_1000063227 247
531 3300026116 Ga0207674_10053445 Ga0207674_100534454 247
532 3300026116 Ga0207674_10381785 Ga0207674_103817852 247
533 3300026142 Ga0207698_10584222 Ga0207698_105842222 247
534 3300028380 Ga0268265_10041273 Ga0268265_100412734 247
535 3300028380 Ga0268265_10060565 Ga0268265_100605652 247
536 3300028381 Ga0268264_10000710 Ga0268264_1000071035 247
537 3300028381 Ga0268264_10000750 Ga0268264_1000075031 247
538 3300028381 Ga0268264_10074606 Ga0268264_100746062 247
539 3300028381 Ga0268264_10365975 Ga0268264_103659752 247
540 3300037312 Ga0395899_0030363 Ga0395899_0030363_2134_2883 247
541 3300037418 Ga0395900_0173728 Ga0395900_0173728_354_1103 247
542 3300037471 Ga0395905_0073573 Ga0395905_0073573_1217_1966 247
543 3300037471 Ga0395905_0076530 Ga0395905_0076530_1530_2279 247
544 3300045976 Ga0466967_0059800 Ga0466967_0059800_798_1550 247
545 3300047472 Ga0495686_0001393 Ga0495686_0001393_22462_23427 247
546 3300048910 Ga0496107_0380075 Ga0496107_0380075_183_935 247
547 3300049590 Ga0501074_0035046 Ga0501074_0035046_489_1241 247
548 3300049742 Ga0501080_0173418 Ga0501080_0173418_1064_1816 247
549 3300050510 nmdc:mga06r32_379167_c1 nmdc:mga06r32_379167_c1_529_1272 247
550 3300050515 nmdc:mga0a205_6815_c1 nmdc:mga0a205_6815_c1_4909_5652 247

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dl5-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase 0.8171 50 172
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.7851 50 174
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.7699 50 172
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.756 50 245
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.7551 20 244
ID Description Score Start End Superfamily
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8165 46 182 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8049 46 182 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7985 61 117 3.40.50.150
af_Q6EQW4_99_328_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7863 53 117 3.40.50.150
af_P9WKL5_23_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7796 48 204 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A534AFE3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9682 23 245 GO:0008168
GO:0032259
AF-A0A539DBP2-F1-model_v4 Methyltransferase 0.9602 138 245
AF-A0A430SBS6-F1-model_v4 Methyltransferase 0.9589 131 245 GO:0008168
GO:0032259
AF-A0A7K3FB15-F1-model_v4 deleted 0.9581 152 245
AF-A0A2N6CJL4-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9568 23 245 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.88 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map