F462490

General Info

Members Datasets Scaffolds Average Seq Length
550 281 1098 250

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10283193|Ga0105242_102831932
Length 305
Sequence MTKRHHDKFATMVFYQCHFNQVTSPVRWLHIGTANGPDPQQTHRTKENVMTARLANKIALVTGATSGIGLATAKRFALEGAQVIITGRRQAELDAAVKAIGHDAADRRPIGLRVDSSDLAALDGLYDEIRARYGRLDVLYANAGGGSMLPLGDITEEQFDDTFGRNVKGTLFTVQKALPLLSQGASVILTGSTAGSSGTPAFSVYAASKAAVRAFARNWILDLKDRGIRVNTISPGATRTPGLVELAGTDAAAQQGLVDYLAAQIPLGRVGEPDEIAKAAVFLASDDASFVNGTELFVDGGQAQI

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
107 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
108 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
109 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
110 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
111 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
243 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
244 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
247 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
248 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
249 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
250 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
251 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
252 2643221556 Massilia sp. Root1485 Isolate Unclassified
253 2643221684 Massilia sp. Root133 Isolate Unclassified
254 2738541297 Duganella sp. GV083 Isolate Unclassified
255 2738541357 Duganella sp. GV053 Isolate Unclassified
256 2738543003 Duganella sp. GV066 Isolate Unclassified
257 2738543026 Duganella sp. GV089 Isolate Unclassified
258 2738543029 Duganella sp. GV039 Isolate Unclassified
259 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
260 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
261 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
262 2818991452 Burkholderia cepacia 561 Isolate Unclassified
263 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
264 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
265 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
266 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
267 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
268 2928170801 Burkholderia sp. 572 Isolate Unclassified
269 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
270 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
271 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
272 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
273 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
274 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
275 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
276 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
277 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
278 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
279 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
280 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
281 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.82
Metatranscriptomes 0
Isolates 6.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.55
Nodule 0.91
Rhizoplane 2.91
Rhizosphere 76
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10283193 3300009176 Bacteria 1506
2 rootL2_10100131 3300003322 Bacteria 5265
3 JGI25160J50197_1032864 3300003354 Bacteria 1313
4 Ga0055532_1000003 3300003758 Bacteria 494004
5 Ga0055527_1000006 3300003760 Bacteria 494004
6 Ga0055535_1000003 3300003761 Bacteria 494004
7 Ga0055542_1000007 3300003762 Bacteria 494004
8 Ga0055529_1000003 3300003763 Bacteria 494004
9 Ga0055537_1000004 3300003773 Bacteria 167383
10 Ga0055524_1013372 3300003775 Bacteria 3095
11 Ga0055534_1000216 3300003784 Bacteria 42623
12 Ga0055528_1000378 3300003790 Bacteria 36269
13 Ga0055528_1004273 3300003790 Bacteria 6911
14 Ga0055531_10006780 3300003794 Bacteria 6398
15 Ga0058692_1034594 3300003856 Bacteria 927
16 Ga0065165_1000260 3300005262 Bacteria 90953
17 Ga0065704_10089971 3300005289 Bacteria 2820
18 Ga0065707_10128517 3300005295 Bacteria 1964
19 Ga0070658_10434178 3300005327 Bacteria 1130
20 Ga0070676_10143734 3300005328 Bacteria 1521
21 Ga0070660_100065799 3300005339 Bacteria 2821
22 Ga0070660_100071517 3300005339 Bacteria 2708
23 Ga0070660_100391269 3300005339 Bacteria 1148
24 Ga0070713_100179905 3300005436 Bacteria 1899
25 Ga0070705_100222375 3300005440 Bacteria 1308
26 Ga0070681_10027389 3300005458 Bacteria 5731
27 Ga0070681_10088882 3300005458 Bacteria 3041
28 Ga0070698_100278433 3300005471 Bacteria 1604
29 Ga0070699_100267148 3300005518 Bacteria 1530
30 Ga0068853_100113767 3300005539 Bacteria 2406
31 Ga0068853_100189979 3300005539 Bacteria 1866
32 Ga0068855_100197737 3300005563 Bacteria 2264
33 Ga0068855_100733870 3300005563 Bacteria 1054
34 Ga0070664_100392363 3300005564 Bacteria 1268
35 Ga0068857_100921340 3300005577 Bacteria 839
36 Ga0068856_100000165 3300005614 Bacteria 68768
37 Ga0081455_10027146 3300005937 Bacteria 5250
38 Ga0070717_10408421 3300006028 Unclassified 1221
39 Ga0075368_10000465 3300006042 Bacteria 12005
40 Ga0075363_100220300 3300006048 Bacteria 1087
41 Ga0075363_100278533 3300006048 Bacteria 967
42 Ga0070716_100145301 3300006173 Bacteria 1518
43 Ga0075362_10009005 3300006177 Bacteria 3841
44 Ga0075367_10000528 3300006178 Bacteria 14436
45 Ga0075367_10012887 3300006178 Bacteria 4478
46 Ga0075369_10002326 3300006186 Bacteria 6761
47 Ga0075370_10004054 3300006353 Bacteria 7043
48 Ga0075370_10016866 3300006353 Bacteria 3938
49 Ga0075370_10035118 3300006353 Bacteria 2813
50 Ga0079104_1006374 3300006946 Bacteria 4481
51 Ga0105251_10000046 3300009011 Bacteria 112588
52 Ga0105251_10000210 3300009011 Bacteria 59171
53 Ga0105240_10720647 3300009093 Bacteria 1087
54 Ga0105245_10711825 3300009098 Bacteria 1038
55 Ga0105237_10141689 3300009545 Bacteria 2398
56 Ga0105238_10148619 3300009551 Bacteria 2319
57 Ga0105238_10226531 3300009551 Bacteria 1846
58 Ga0105238_10240796 3300009551 Bacteria 1786
59 Ga0105238_10421601 3300009551 Bacteria 1329
60 Ga0105249_10044204 3300009553 Bacteria 4051
61 Ga0105249_10046897 3300009553 Bacteria 3935
62 Ga0105239_10031793 3300010375 Bacteria 5799
63 Ga0105239_10573083 3300010375 Bacteria 1286
64 Ga0157373_10055520 3300013100 Bacteria 2814
65 Ga0157371_10004119 3300013102 Bacteria 12827
66 Ga0157370_10130599 3300013104 Bacteria 2343
67 Ga0157370_10264569 3300013104 Bacteria 1589
68 Ga0157369_10010561 3300013105 Bacteria 10507
69 Ga0163162_10264915 3300013306 Unclassified 1850
70 Ga0157372_10031040 3300013307 Bacteria 5848
71 Ga0157372_10145448 3300013307 Bacteria 2733
72 Ga0157372_10536206 3300013307 Bacteria 1364
73 Ga0157372_10601939 3300013307 Bacteria 1281
74 Ga0182008_10161918 3300014497 Bacteria 1126
75 Ga0182008_10352027 3300014497 Bacteria 781
76 Ga0182006_1000056 3300015261 Bacteria 169631
77 Ga0182006_1000181 3300015261 Bacteria 66126
78 Ga0182007_10003811 3300015262 Bacteria 7024
79 Ga0182007_10074825 3300015262 Bacteria 1110
80 Ga0182005_1000013 3300015265 Bacteria 396391
81 Ga0213876_10071937 3300021384 Bacteria 1826
82 Ga0209672_103307 3300025228 Bacteria 3394
83 Ga0209437_109111 3300025233 Bacteria 1561
84 Ga0209565_1000018 3300025263 Bacteria 460940
85 Ga0209565_1021147 3300025263 Bacteria 1363
86 Ga0209673_1000030 3300025273 Bacteria 351933
87 Ga0209673_1000090 3300025273 Bacteria 202223
88 Ga0209675_1000005 3300025291 Bacteria 849192
89 Ga0209676_1000020 3300025292 Bacteria 617256
90 Ga0209676_1006466 3300025292 Bacteria 5774
91 Ga0209564_1000078 3300025295 Bacteria 275766
92 Ga0209564_1005257 3300025295 Bacteria 7472
93 Ga0209256_1000601 3300025299 Bacteria 49925
94 Ga0207426_1013420 3300025302 Bacteria 3036
95 Ga0209257_1013694 3300025304 Bacteria 3573
96 Ga0207696_1000006 3300025711 Bacteria 616498
97 Ga0207713_1000115 3300025735 Bacteria 132114
98 Ga0207713_1000602 3300025735 Bacteria 35452
99 Ga0207710_10065622 3300025900 Bacteria 1655
100 Ga0207705_10008813 3300025909 Bacteria 7355
101 Ga0207671_10167968 3300025914 Bacteria 1702
102 Ga0207657_10404651 3300025919 Bacteria 1073
103 Ga0207646_10265400 3300025922 Bacteria 1552
104 Ga0207694_10231558 3300025924 Bacteria 1509
105 Ga0207687_10163595 3300025927 Bacteria 1710
106 Ga0207690_10054044 3300025932 Bacteria 2698
107 Ga0207706_10009841 3300025933 Bacteria 8768
108 Ga0207709_10029452 3300025935 Bacteria 3185
109 Ga0207665_10075012 3300025939 Bacteria 2316
110 Ga0207667_10043599 3300025949 Bacteria 4760
111 Ga0207712_10048088 3300025961 Bacteria 2965
112 Ga0207678_10427692 3300026067 Bacteria 1149
113 Ga0207702_10001024 3300026078 Bacteria 28681
114 Ga0207674_10075372 3300026116 Bacteria 3384
115 Ga0207674_10093425 3300026116 Bacteria 2996
116 Ga0209371_1000498 3300027312 Bacteria 38201
117 Ga0209813_10000642 3300027866 Bacteria 8057
118 Ga0268256_1000422 3300030500 Bacteria 38201
119 Ga0307512_10019336 3300030522 Bacteria 6202
120 Ga0265340_10042027 3300031247 Bacteria 2245
121 Ga0307508_10274400 3300031616 Bacteria 1280
122 Ga0307514_10094560 3300031649 Bacteria 2166
123 Ga0307514_10194772 3300031649 Bacteria 1284
124 Ga0307518_10065802 3300031838 Bacteria 2629
125 Ga0307414_10104047 3300032004 Bacteria 2143
126 Ga0307411_10717033 3300032005 Bacteria 873
127 Ga0395899_0007944 3300037312 Bacteria 8171
128 Ga0395899_0021735 3300037312 Bacteria 4866
129 Ga0395899_0088182 3300037312 Bacteria 2251
130 Ga0395899_0185016 3300037312 Bacteria 1460
131 Ga0395900_0022675 3300037418 Bacteria 6425
132 Ga0395900_0077380 3300037418 Bacteria 3417
133 Ga0395900_0138338 3300037418 Bacteria 2494
134 Ga0395900_0588690 3300037418 Bacteria 1054
135 Ga0395900_0644414 3300037418 Bacteria 996
136 Ga0395898_0004040 3300037466 Bacteria 16140
137 Ga0395898_0132611 3300037466 Bacteria 2385
138 Ga0395898_0154782 3300037466 Bacteria 2193
139 Ga0395898_0176269 3300037466 Bacteria 2043
140 Ga0395898_0177087 3300037466 Bacteria 2038
141 Ga0395898_0539356 3300037466 Bacteria 1108
142 Ga0395905_0000498 3300037471 Bacteria 53933
143 Ga0395905_0050033 3300037471 Bacteria 3916
144 Ga0395905_0311180 3300037471 Bacteria 1463
145 Ga0395905_0358672 3300037471 Bacteria 1350
146 Ga0395905_0370071 3300037471 Bacteria 1326
147 Ga0395901_0002631 3300038443 Bacteria 18155
148 Ga0395901_0058044 3300038443 Bacteria 4025
149 Ga0395901_0099767 3300038443 Bacteria 3045
150 Ga0395901_0114357 3300038443 Bacteria 2834
151 Ga0395901_0993808 3300038443 Bacteria 815
152 Ga0436365_0687743 3300039437 Bacteria 9749
153 Ga0436363_1706936 3300039450 Bacteria 2594
154 Ga0451793_0848980 3300041452 Bacteria 2641
155 Ga0439445_0091157 3300042004 Bacteria 858
156 Ga0439450_020077 3300042008 Bacteria 1422
157 Ga0439454_022710 3300042011 Bacteria 937
158 Ga0439455_0039313 3300042012 Bacteria 1206
159 Ga0450911_009806 3300042115 Bacteria 1335
160 Ga0450904_001221 3300042139 Bacteria 3859
161 Ga0450904_001838 3300042139 Bacteria 2756
162 Ga0450909_003489 3300042185 Bacteria 2241
163 Ga0466969_0052475 3300044656 Bacteria 2003
164 Ga0466972_0142449 3300044658 Bacteria 1128
165 Ga0466982_0000045 3300044672 Bacteria 38024
166 Ga0466965_0066748 3300044683 Bacteria 1804
167 Ga0466966_0008581 3300044684 Bacteria 6763
168 Ga0466966_0041784 3300044684 Bacteria 2945
169 Ga0466961_0073195 3300044693 Bacteria 2173
170 Ga0466961_0340766 3300044693 Bacteria 913
171 Ga0466963_0208156 3300044694 Bacteria 1368
172 Ga0466964_0238054 3300044706 Bacteria 892
173 Ga0466957_0334483 3300044842 Bacteria 1024
174 Ga0466959_0007788 3300045049 Bacteria 7536
175 Ga0466958_0067345 3300045836 Bacteria 2187
176 Ga0495617_104466 3300046452 Bacteria 919
177 Ga0495627_005863 3300046453 Bacteria 4885
178 Ga0495627_014128 3300046453 Bacteria 2795
179 Ga0495627_026674 3300046453 Bacteria 1860
180 Ga0495627_038241 3300046453 Bacteria 1484
181 Ga0495603_0009255 3300046455 Bacteria 5955
182 Ga0495603_0013870 3300046455 Bacteria 4876
183 Ga0495590_0000086 3300046457 Bacteria 61437
184 Ga0495590_0014911 3300046457 Bacteria 2831
185 Ga0495590_0034534 3300046457 Bacteria 1766
186 Ga0495591_017358 3300046458 Bacteria 2473
187 Ga0495591_024472 3300046458 Bacteria 1913
188 Ga0495638_0000286 3300046460 Bacteria 67421
189 Ga0495638_0049131 3300046460 Bacteria 2638
190 Ga0495638_0206896 3300046460 Bacteria 1104
191 Ga0495653_0033314 3300046463 Bacteria 4083
192 Ga0495653_0130831 3300046463 Bacteria 1777
193 Ga0495650_0000462 3300046471 Bacteria 63149
194 Ga0495650_0003330 3300046471 Bacteria 11841
195 Ga0495580_0030673 3300046472 Bacteria 3890
196 Ga0495605_0000235 3300046474 Bacteria 67625
197 Ga0495605_0001234 3300046474 Bacteria 17041
198 Ga0495605_0002228 3300046474 Bacteria 12109
199 Ga0495605_0013926 3300046474 Bacteria 4417
200 Ga0495605_0018181 3300046474 Bacteria 3773
201 Ga0495605_0022440 3300046474 Bacteria 3334
202 Ga0495605_0029790 3300046474 Bacteria 2804
203 Ga0495605_0040854 3300046474 Bacteria 2313
204 Ga0495605_0174679 3300046474 Bacteria 947
205 Ga0495584_0000074 3300046491 Bacteria 71485
206 Ga0495584_0005204 3300046491 Bacteria 6903
207 Ga0495584_0021640 3300046491 Bacteria 3266
208 Ga0495584_0032074 3300046491 Bacteria 2660
209 Ga0495585_0000424 3300046492 Bacteria 40738
210 Ga0495585_0046863 3300046492 Bacteria 2409
211 Ga0495585_0160808 3300046492 Bacteria 1165
212 Ga0495594_0011422 3300046499 Bacteria 4615
213 Ga0495594_0027549 3300046499 Bacteria 3062
214 Ga0495594_0033193 3300046499 Bacteria 2805
215 Ga0495596_0001023 3300046500 Bacteria 16607
216 Ga0495596_0001134 3300046500 Bacteria 15688
217 Ga0495596_0009771 3300046500 Bacteria 4209
218 Ga0495596_0031930 3300046500 Bacteria 2101
219 Ga0495607_0002206 3300046501 Bacteria 16133
220 Ga0495607_0005697 3300046501 Bacteria 8875
221 Ga0495607_0009107 3300046501 Bacteria 6748
222 Ga0495607_0009420 3300046501 Bacteria 6611
223 Ga0495607_0011983 3300046501 Bacteria 5739
224 Ga0495607_0023207 3300046501 Bacteria 3884
225 Ga0495607_0043187 3300046501 Bacteria 2668
226 Ga0495607_0176099 3300046501 Bacteria 1076
227 Ga0495583_0000298 3300046506 Bacteria 78909
228 Ga0495583_0000389 3300046506 Bacteria 67583
229 Ga0495583_0007819 3300046506 Bacteria 6641
230 Ga0495583_0010232 3300046506 Bacteria 5498
231 Ga0495583_0024529 3300046506 Bacteria 3029
232 Ga0495583_0096119 3300046506 Bacteria 1269
233 Ga0495606_0000129 3300046507 Bacteria 127929
234 Ga0495606_0020816 3300046507 Bacteria 4823
235 Ga0495606_0021364 3300046507 Bacteria 4742
236 Ga0495606_0028007 3300046507 Bacteria 3982
237 Ga0495606_0072082 3300046507 Bacteria 2172
238 Ga0495606_0097540 3300046507 Bacteria 1795
239 Ga0495606_0231934 3300046507 Bacteria 1034
240 Ga0495610_0000014 3300046512 Bacteria 444708
241 Ga0495610_0005860 3300046512 Bacteria 8627
242 Ga0495610_0044700 3300046512 Bacteria 2196
243 Ga0495610_0071162 3300046512 Bacteria 1622
244 Ga0495616_0000150 3300046513 Bacteria 60876
245 Ga0495616_0001785 3300046513 Bacteria 14626
246 Ga0495616_0020261 3300046513 Bacteria 3620
247 Ga0495616_0034013 3300046513 Bacteria 2650
248 Ga0495616_0049632 3300046513 Bacteria 2103
249 Ga0495620_0000614 3300046515 Bacteria 22291
250 Ga0495620_0005094 3300046515 Bacteria 7357
251 Ga0495630_0026599 3300046517 Bacteria 4285
252 Ga0495631_0001581 3300046518 Bacteria 13676
253 Ga0495631_0044096 3300046518 Bacteria 1967
254 Ga0495631_0131021 3300046518 Bacteria 1077
255 Ga0495632_0000212 3300046519 Bacteria 59013
256 Ga0495632_0000485 3300046519 Bacteria 37693
257 Ga0495632_0008774 3300046519 Bacteria 6161
258 Ga0495632_0022309 3300046519 Bacteria 3395
259 Ga0495643_0001034 3300046522 Bacteria 28296
260 Ga0495643_0001271 3300046522 Bacteria 24179
261 Ga0495643_0004963 3300046522 Bacteria 9135
262 Ga0495643_0016995 3300046522 Bacteria 4263
263 Ga0495643_0023797 3300046522 Bacteria 3477
264 Ga0495643_0026801 3300046522 Bacteria 3246
265 Ga0495644_0000891 3300046523 Bacteria 12369
266 Ga0495644_0037114 3300046523 Bacteria 1838
267 Ga0495648_0002637 3300046524 Bacteria 16290
268 Ga0495648_0005785 3300046524 Bacteria 10198
269 Ga0495648_0006165 3300046524 Bacteria 9831
270 Ga0495648_0032694 3300046524 Bacteria 3409
271 Ga0495648_0048781 3300046524 Bacteria 2603
272 Ga0495648_0049308 3300046524 Bacteria 2582
273 Ga0495666_0007654 3300046526 Bacteria 5405
274 Ga0495666_0022254 3300046526 Bacteria 3138
275 Ga0495642_0000191 3300046528 Bacteria 36297
276 Ga0495642_0235930 3300046528 Bacteria 799
277 Ga0495652_0016557 3300046529 Bacteria 6593
278 Ga0495654_0002221 3300046530 Bacteria 12587
279 Ga0495654_0006635 3300046530 Bacteria 6550
280 Ga0495665_0111406 3300046531 Bacteria 1435
281 Ga0495640_0073807 3300046533 Bacteria 2283
282 Ga0495586_0014100 3300046535 Bacteria 4246
283 Ga0495587_0089082 3300046536 Bacteria 1784
284 Ga0495609_0000086 3300046538 Bacteria 110840
285 Ga0495609_0000296 3300046538 Bacteria 46065
286 Ga0495609_0000541 3300046538 Bacteria 29926
287 Ga0495609_0004023 3300046538 Bacteria 8206
288 Ga0495609_0017748 3300046538 Bacteria 3302
289 Ga0495645_0033163 3300046543 Bacteria 3767
290 Ga0495645_0111729 3300046543 Bacteria 1933
291 Ga0495622_0007729 3300046557 Bacteria 4993
292 Ga0495622_0076337 3300046557 Bacteria 1544
293 Ga0495633_0003006 3300046558 Bacteria 11505
294 Ga0495633_0008113 3300046558 Bacteria 5955
295 Ga0495656_0047708 3300046615 Bacteria 1817
296 Ga0495668_0000579 3300046616 Bacteria 44604
297 Ga0495668_0009411 3300046616 Bacteria 6005
298 Ga0495668_0027333 3300046616 Bacteria 3232
299 Ga0495668_0056389 3300046616 Bacteria 2169
300 Ga0495668_0103759 3300046616 Bacteria 1555
301 Ga0495625_0000655 3300046660 Bacteria 49468
302 Ga0495625_0008368 3300046660 Bacteria 8832
303 Ga0495625_0077358 3300046660 Bacteria 2325
304 Ga0495635_0083487 3300046663 Bacteria 2186
305 Ga0495661_0000224 3300046665 Bacteria 65089
306 Ga0495661_0000497 3300046665 Bacteria 40919
307 Ga0495661_0000729 3300046665 Bacteria 32235
308 Ga0495661_0003501 3300046665 Bacteria 11563
309 Ga0495661_0003573 3300046665 Bacteria 11443
310 Ga0495661_0010072 3300046665 Bacteria 6465
311 Ga0495661_0029816 3300046665 Bacteria 3478
312 Ga0495661_0035756 3300046665 Bacteria 3114
313 Ga0495661_0067008 3300046665 Bacteria 2110
314 Ga0495661_0070433 3300046665 Bacteria 2046
315 Ga0495661_0122494 3300046665 Bacteria 1434
316 Ga0495661_0131038 3300046665 Bacteria 1374
317 Ga0495588_0000083 3300046674 Bacteria 197018
318 Ga0495588_0000343 3300046674 Bacteria 30101
319 Ga0495588_0006785 3300046674 Bacteria 5180
320 Ga0495599_0147328 3300046678 Bacteria 1459
321 Ga0495623_0025162 3300046679 Bacteria 3834
322 Ga0495623_0319800 3300046679 Bacteria 852
323 Ga0495669_0001543 3300046684 Bacteria 9475
324 Ga0495669_0023246 3300046684 Bacteria 2697
325 Ga0495670_0014011 3300046691 Bacteria 3944
326 Ga0495670_0036377 3300046691 Bacteria 2453
327 Ga0495670_0090782 3300046691 Bacteria 1563
328 Ga0495671_0000005 3300046692 Bacteria 509397
329 Ga0495671_0000024 3300046692 Bacteria 246812
330 Ga0495671_0023641 3300046692 Bacteria 3210
331 Ga0495671_0064108 3300046692 Bacteria 1809
332 Ga0495649_0002145 3300046694 Bacteria 14122
333 Ga0495649_0011859 3300046694 Bacteria 5095
334 Ga0495649_0013515 3300046694 Bacteria 4708
335 Ga0495649_0017405 3300046694 Bacteria 4054
336 Ga0495649_0043248 3300046694 Bacteria 2459
337 Ga0495589_0000055 3300046794 Bacteria 110887
338 Ga0495589_0000069 3300046794 Bacteria 97385
339 Ga0495589_0004668 3300046794 Bacteria 7280
340 Ga0495589_0011678 3300046794 Bacteria 4558
341 Ga0495589_0014192 3300046794 Bacteria 4105
342 Ga0495589_0019116 3300046794 Bacteria 3514
343 Ga0495589_0045538 3300046794 Bacteria 2179
344 Ga0495589_0135238 3300046794 Bacteria 1182
345 Ga0495600_0045712 3300046809 Bacteria 2857
346 Ga0495660_0000138 3300046810 Bacteria 79645
347 Ga0495660_0000779 3300046810 Bacteria 23870
348 Ga0495660_0000802 3300046810 Bacteria 23604
349 Ga0495660_0000950 3300046810 Bacteria 21173
350 Ga0495660_0001574 3300046810 Bacteria 15327
351 Ga0495660_0001585 3300046810 Bacteria 15278
352 Ga0495660_0002695 3300046810 Bacteria 11218
353 Ga0495660_0019801 3300046810 Bacteria 3862
354 Ga0495660_0199245 3300046810 Bacteria 957
355 Ga0495604_0074654 3300047317 Bacteria 2555
356 Ga0495604_0088950 3300047317 Bacteria 2296
357 Ga0495636_0004616 3300047318 Bacteria 5403
358 Ga0495636_0026479 3300047318 Bacteria 2359
359 Ga0495674_0002616 3300047319 Bacteria 17508
360 Ga0495672_0000108 3300047320 Bacteria 132251
361 Ga0495672_0000201 3300047320 Bacteria 85476
362 Ga0495672_0000346 3300047320 Bacteria 59410
363 Ga0495672_0004302 3300047320 Bacteria 11735
364 Ga0495672_0011912 3300047320 Bacteria 6101
365 Ga0495683_0000469 3300047323 Bacteria 31519
366 Ga0495683_0001975 3300047323 Bacteria 12798
367 Ga0495683_0003021 3300047323 Bacteria 9894
368 Ga0495683_0018088 3300047323 Bacteria 3647
369 Ga0495687_000017 3300047443 Bacteria 350429
370 Ga0495687_000139 3300047443 Bacteria 110721
371 Ga0495687_001344 3300047443 Bacteria 22911
372 Ga0495687_001495 3300047443 Bacteria 21359
373 Ga0495687_003747 3300047443 Bacteria 10751
374 Ga0495687_022684 3300047443 Bacteria 3009
375 Ga0495687_126308 3300047443 Bacteria 913
376 Ga0495675_0021902 3300047444 Bacteria 4071
377 Ga0495677_0000038 3300047445 Bacteria 78104
378 Ga0495677_0001935 3300047445 Bacteria 8274
379 Ga0495677_0002375 3300047445 Bacteria 7398
380 Ga0495677_0002599 3300047445 Bacteria 7064
381 Ga0495677_0036737 3300047445 Bacteria 1789
382 Ga0495679_002014 3300047446 Bacteria 10755
383 Ga0495679_004304 3300047446 Bacteria 6601
384 Ga0495679_029306 3300047446 Bacteria 1796
385 Ga0495685_003400 3300047447 Bacteria 5080
386 Ga0495673_0000009 3300047469 Bacteria 731993
387 Ga0495673_0000012 3300047469 Bacteria 656908
388 Ga0495673_0000043 3300047469 Bacteria 284984
389 Ga0495673_0000711 3300047469 Bacteria 32279
390 Ga0495673_0001461 3300047469 Bacteria 18737
391 Ga0495673_0033543 3300047469 Bacteria 2381
392 Ga0495681_0000846 3300047470 Bacteria 23593
393 Ga0495681_0007038 3300047470 Bacteria 7264
394 Ga0495684_0042409 3300047471 Bacteria 3485
395 Ga0495686_0000130 3300047472 Bacteria 152244
396 Ga0495686_0040628 3300047472 Bacteria 2966
397 Ga0495686_0048415 3300047472 Bacteria 2680
398 Ga0495686_0079194 3300047472 Bacteria 2010
399 Ga0495686_0118173 3300047472 Bacteria 1583
400 Ga0495593_0142117 3300047673 Bacteria 1216
401 Ga0495602_0031643 3300048088 Bacteria 4998
402 Ga0495626_0000082 3300048091 Bacteria 128002
403 Ga0495626_0000146 3300048091 Bacteria 88653
404 Ga0495626_0003261 3300048091 Bacteria 10495
405 Ga0495626_0003902 3300048091 Bacteria 9346
406 Ga0495626_0008861 3300048091 Bacteria 5468
407 Ga0495626_0012245 3300048091 Bacteria 4503
408 Ga0495626_0012455 3300048091 Bacteria 4458
409 Ga0495626_0021370 3300048091 Bacteria 3211
410 Ga0495626_0041551 3300048091 Bacteria 2164
411 Ga0496100_0063432 3300048903 Bacteria 2442
412 Ga0496101_0124054 3300048904 Bacteria 1955
413 Ga0496102_0031112 3300048905 Bacteria 4784
414 Ga0496102_0098913 3300048905 Bacteria 2707
415 Ga0496102_0397343 3300048905 Bacteria 1296
416 Ga0496106_0000998 3300048909 Bacteria 20662
417 Ga0496106_0004615 3300048909 Bacteria 10219
418 Ga0496106_0228948 3300048909 Bacteria 1484
419 Ga0496108_0421959 3300048911 Bacteria 1165
420 Ga0496109_0007449 3300048912 Bacteria 9267
421 Ga0496109_0396315 3300048912 Bacteria 1304
422 Ga0496110_0128627 3300048913 Bacteria 2286
423 Ga0496111_0335722 3300048914 Bacteria 1119
424 Ga0496113_0233695 3300048916 Bacteria 1466
425 Ga0496113_0341486 3300048916 Bacteria 1201
426 Ga0496116_0044134 3300048919 Bacteria 3031
427 Ga0496118_0003025 3300048921 Bacteria 21711
428 Ga0496121_0002184 3300048924 Bacteria 30622
429 Ga0496121_0026970 3300048924 Bacteria 5391
430 Ga0496121_0124053 3300048924 Bacteria 1945
431 Ga0496122_0001184 3300048925 Bacteria 44630
432 Ga0496122_0004400 3300048925 Bacteria 17539
433 Ga0496122_0004792 3300048925 Bacteria 16545
434 Ga0496122_0021245 3300048925 Bacteria 5819
435 Ga0496122_0089175 3300048925 Bacteria 2110
436 Ga0496123_0004100 3300048926 Bacteria 15636
437 Ga0496123_0010410 3300048926 Bacteria 8222
438 Ga0496123_0022854 3300048926 Bacteria 4804
439 Ga0496123_0030839 3300048926 Bacteria 3916
440 Ga0496124_0017007 3300048927 Bacteria 6881
441 Ga0496124_0017185 3300048927 Bacteria 6831
442 Ga0496124_0052088 3300048927 Bacteria 3479
443 Ga0496124_0074761 3300048927 Bacteria 2800
444 Ga0496124_0149521 3300048927 Bacteria 1834
445 Ga0496124_0157915 3300048927 Bacteria 1771
446 Ga0496124_0231547 3300048927 Bacteria 1381
447 Ga0496125_0000991 3300048928 Bacteria 44272
448 Ga0496125_0016043 3300048928 Bacteria 7211
449 Ga0496125_0022498 3300048928 Bacteria 5851
450 Ga0496126_0008988 3300048929 Bacteria 10690
451 Ga0496126_0047092 3300048929 Bacteria 3949
452 Ga0495678_000060 3300049459 Bacteria 142851
453 Ga0495678_019984 3300049459 Bacteria 2975
454 Ga0495678_033133 3300049459 Bacteria 2135
455 Ga0495678_034990 3300049459 Bacteria 2063
456 Ga0495682_0000035 3300049460 Bacteria 126349
457 Ga0501031_0026329 3300049568 Bacteria 3792
458 Ga0501031_0089390 3300049568 Bacteria 2008
459 Ga0501032_0012217 3300049569 Bacteria 6147
460 Ga0501032_0119885 3300049569 Bacteria 1739
461 Ga0501033_0001472 3300049570 Bacteria 20866
462 Ga0501033_0020755 3300049570 Bacteria 4963
463 Ga0501033_0139157 3300049570 Bacteria 1756
464 Ga0501033_0369250 3300049570 Bacteria 1003
465 Ga0501034_0000757 3300049571 Bacteria 48585
466 Ga0501034_0001574 3300049571 Bacteria 29832
467 Ga0501034_0023906 3300049571 Bacteria 6219
468 Ga0501036_0045649 3300049572 Bacteria 3711
469 Ga0501036_0084386 3300049572 Bacteria 2685
470 Ga0501036_0326141 3300049572 Bacteria 1283
471 Ga0501037_0001043 3300049573 Bacteria 20494
472 Ga0501038_0001114 3300049574 Bacteria 24377
473 Ga0501038_0007125 3300049574 Bacteria 10332
474 Ga0501039_0038464 3300049575 Bacteria 3695
475 Ga0501039_0091839 3300049575 Bacteria 2366
476 Ga0501042_0048337 3300049578 Bacteria 3033
477 Ga0501043_0008721 3300049579 Bacteria 7979
478 Ga0501043_0013597 3300049579 Bacteria 6368
479 Ga0501043_0069940 3300049579 Bacteria 2757
480 Ga0501046_0186338 3300049580 Bacteria 1549
481 Ga0501047_0308100 3300049581 Bacteria 1424
482 Ga0501047_0367119 3300049581 Bacteria 1275
483 Ga0501048_0010975 3300049582 Bacteria 6757
484 Ga0501067_0048527 3300049583 Bacteria 2354
485 Ga0501070_0151548 3300049586 Bacteria 1913
486 Ga0501269_000816 3300049766 Bacteria 4795
487 Ga0501035_0002482 3300049822 Bacteria 18019
488 Ga0501035_0028025 3300049822 Bacteria 5144
489 Ga0501035_0028664 3300049822 Bacteria 5081
490 Ga0501035_0131475 3300049822 Bacteria 2181
491 Ga0501044_0001762 3300049823 Bacteria 25289
492 Ga0501044_0038355 3300049823 Bacteria 5003
493 Ga0501044_0121817 3300049823 Bacteria 2608
494 Ga0501044_0205789 3300049823 Bacteria 1924
495 Ga0501045_0296048 3300049824 Bacteria 1204
496 nmdc:mga03683_2280_c2 3300050489 Bacteria 5152
497 nmdc:mga03n38_232993_c1 3300050490 Bacteria 966
498 nmdc:mga0yw44_472342_c1 3300050492 Bacteria 850
499 nmdc:mga06z11_513_c1 3300050494 Bacteria 14293
500 nmdc:mga06z11_7501_c1 3300050494 Bacteria 4491
501 nmdc:mga04h51_241_c1 3300050495 Bacteria 14370
502 nmdc:mga07m45_3228_c2 3300050496 Bacteria 6755
503 nmdc:mga07m45_70943_c1 3300050496 Bacteria 1982
504 nmdc:mga0sz30_323_c1 3300050516 Bacteria 18322
505 Ga0500644_0047958 3300053088 Bacteria 1451
506 Ga0500556_0000729 3300053104 Bacteria 19824
507 Ga0500593_000043 3300053117 Bacteria 45165
508 Ga0500559_0000516 3300053136 Bacteria 27125
509 Ga0500573_0035539 3300053140 Bacteria 2875
510 Ga0500577_0083826 3300053142 Bacteria 1276
511 Ga0500586_000884 3300053145 Bacteria 6188
512 Ga0500616_0001941 3300053153 Bacteria 18457
513 Ga0500622_0000315 3300053156 Bacteria 49087
514 Ga0500622_0000713 3300053156 Bacteria 29064
515 Ga0500599_011497 3300053736 Bacteria 1180
516 2509126439 2508501125 Bacteria 7208311
517 2512642968 2512564014 Bacteria 4639632
518 2550696401 2548876994 Bacteria 4904866
519 2599101865 2597490356 Bacteria 7030811
520 2643800928 2643221556 Bacteria 7251154
521 2644471294 2643221684 Bacteria 7145183
522 2738826339 2738541297 Bacteria 6549566
523 2739150136 2738541357 Bacteria 6549408
524 2739192055 2738543003 Bacteria 6549560
525 2739318532 2738543026 Bacteria 6549408
526 2739336773 2738543029 Bacteria 6549249
527 2786666640 2786546132 Bacteria 10419719
528 2804848727 2802429296 Bacteria 7227771
529 2809215265 2808606445 Bacteria 6057339
530 2819637263 2818991452 Bacteria 8442785
531 2846958009 2846952575 Bacteria 6587527
532 2848864950 2848858292 Bacteria 7391279
533 2862296146 2862290372 Bacteria 7471434
534 2868093756 2868088558 Bacteria 7609351
535 2897805775 2897803580 Bacteria 7000062
536 2928177930 2928170801 Bacteria 8785406
537 2945949700 2945945610 Bacteria 5951079
538 2954681734 2954673503 Bacteria 9685905
539 2954691191 2954682443 Bacteria 9862841
540 2974291376 2974289157 Bacteria 6080362
541 8018846189 8018845410 Bacteria 8933938
542 8020940379 8020938398 Bacteria 7472757
543 8020952841 8020945358 Bacteria 8467355
544 8020955242 8020953355 Bacteria 7439080
545 8021127155 8021120328 Bacteria 8782274
546 8047674640 8047673197 Bacteria 7395230
547 8054007598 8054002106 Bacteria 7987183
548 8054917216 8054913762 Bacteria 7713009
549 8054924485 8054920844 Bacteria 7068637
550 Ga0105242_10283193
551 rootL2_10100131
552 JGI25160J50197_1032864
553 Ga0055532_1000003
554 Ga0055527_1000006
555 Ga0055535_1000003
556 Ga0055542_1000007
557 Ga0055529_1000003
558 Ga0055537_1000004
559 Ga0055524_1013372
560 Ga0055534_1000216
561 Ga0055528_1000378
562 Ga0055528_1004273
563 Ga0055531_10006780
564 Ga0058692_1034594
565 Ga0065165_1000260
566 Ga0065704_10089971
567 Ga0065707_10128517
568 Ga0070658_10434178
569 Ga0070676_10143734
570 Ga0070660_100065799
571 Ga0070660_100071517
572 Ga0070660_100391269
573 Ga0070713_100179905
574 Ga0070705_100222375
575 Ga0070681_10027389
576 Ga0070681_10088882
577 Ga0070698_100278433
578 Ga0070699_100267148
579 Ga0068853_100113767
580 Ga0068853_100189979
581 Ga0068855_100197737
582 Ga0068855_100733870
583 Ga0070664_100392363
584 Ga0068857_100921340
585 Ga0068856_100000165
586 Ga0081455_10027146
587 Ga0070717_10408421
588 Ga0075368_10000465
589 Ga0075363_100220300
590 Ga0075363_100278533
591 Ga0070716_100145301
592 Ga0075362_10009005
593 Ga0075367_10000528
594 Ga0075367_10012887
595 Ga0075369_10002326
596 Ga0075370_10004054
597 Ga0075370_10016866
598 Ga0075370_10035118
599 Ga0079104_1006374
600 Ga0105251_10000046
601 Ga0105251_10000210
602 Ga0105240_10720647
603 Ga0105245_10711825
604 Ga0105237_10141689
605 Ga0105238_10148619
606 Ga0105238_10226531
607 Ga0105238_10240796
608 Ga0105238_10421601
609 Ga0105249_10044204
610 Ga0105249_10046897
611 Ga0105239_10031793
612 Ga0105239_10573083
613 Ga0157373_10055520
614 Ga0157371_10004119
615 Ga0157370_10130599
616 Ga0157370_10264569
617 Ga0157369_10010561
618 Ga0163162_10264915
619 Ga0157372_10031040
620 Ga0157372_10145448
621 Ga0157372_10536206
622 Ga0157372_10601939
623 Ga0182008_10161918
624 Ga0182008_10352027
625 Ga0182006_1000056
626 Ga0182006_1000181
627 Ga0182007_10003811
628 Ga0182007_10074825
629 Ga0182005_1000013
630 Ga0213876_10071937
631 Ga0209672_103307
632 Ga0209437_109111
633 Ga0209565_1000018
634 Ga0209565_1021147
635 Ga0209673_1000030
636 Ga0209673_1000090
637 Ga0209675_1000005
638 Ga0209676_1000020
639 Ga0209676_1006466
640 Ga0209564_1000078
641 Ga0209564_1005257
642 Ga0209256_1000601
643 Ga0207426_1013420
644 Ga0209257_1013694
645 Ga0207696_1000006
646 Ga0207713_1000115
647 Ga0207713_1000602
648 Ga0207710_10065622
649 Ga0207705_10008813
650 Ga0207671_10167968
651 Ga0207657_10404651
652 Ga0207646_10265400
653 Ga0207694_10231558
654 Ga0207687_10163595
655 Ga0207690_10054044
656 Ga0207706_10009841
657 Ga0207709_10029452
658 Ga0207665_10075012
659 Ga0207667_10043599
660 Ga0207712_10048088
661 Ga0207678_10427692
662 Ga0207702_10001024
663 Ga0207674_10075372
664 Ga0207674_10093425
665 Ga0209371_1000498
666 Ga0209813_10000642
667 Ga0268256_1000422
668 Ga0307512_10019336
669 Ga0265340_10042027
670 Ga0307508_10274400
671 Ga0307514_10094560
672 Ga0307514_10194772
673 Ga0307518_10065802
674 Ga0307414_10104047
675 Ga0307411_10717033
676 Ga0395899_0007944
677 Ga0395899_0021735
678 Ga0395899_0088182
679 Ga0395899_0185016
680 Ga0395900_0022675
681 Ga0395900_0077380
682 Ga0395900_0138338
683 Ga0395900_0588690
684 Ga0395900_0644414
685 Ga0395898_0004040
686 Ga0395898_0132611
687 Ga0395898_0154782
688 Ga0395898_0176269
689 Ga0395898_0177087
690 Ga0395898_0539356
691 Ga0395905_0000498
692 Ga0395905_0050033
693 Ga0395905_0311180
694 Ga0395905_0358672
695 Ga0395905_0370071
696 Ga0395901_0002631
697 Ga0395901_0058044
698 Ga0395901_0099767
699 Ga0395901_0114357
700 Ga0395901_0993808
701 Ga0436365_0687743
702 Ga0436363_1706936
703 Ga0451793_0848980
704 Ga0439445_0091157
705 Ga0439450_020077
706 Ga0439454_022710
707 Ga0439455_0039313
708 Ga0450911_009806
709 Ga0450904_001221
710 Ga0450904_001838
711 Ga0450909_003489
712 Ga0466969_0052475
713 Ga0466972_0142449
714 Ga0466982_0000045
715 Ga0466965_0066748
716 Ga0466966_0008581
717 Ga0466966_0041784
718 Ga0466961_0073195
719 Ga0466961_0340766
720 Ga0466963_0208156
721 Ga0466964_0238054
722 Ga0466957_0334483
723 Ga0466959_0007788
724 Ga0466958_0067345
725 Ga0495617_104466
726 Ga0495627_005863
727 Ga0495627_014128
728 Ga0495627_026674
729 Ga0495627_038241
730 Ga0495603_0009255
731 Ga0495603_0013870
732 Ga0495590_0000086
733 Ga0495590_0014911
734 Ga0495590_0034534
735 Ga0495591_017358
736 Ga0495591_024472
737 Ga0495638_0000286
738 Ga0495638_0049131
739 Ga0495638_0206896
740 Ga0495653_0033314
741 Ga0495653_0130831
742 Ga0495650_0000462
743 Ga0495650_0003330
744 Ga0495580_0030673
745 Ga0495605_0000235
746 Ga0495605_0001234
747 Ga0495605_0002228
748 Ga0495605_0013926
749 Ga0495605_0018181
750 Ga0495605_0022440
751 Ga0495605_0029790
752 Ga0495605_0040854
753 Ga0495605_0174679
754 Ga0495584_0000074
755 Ga0495584_0005204
756 Ga0495584_0021640
757 Ga0495584_0032074
758 Ga0495585_0000424
759 Ga0495585_0046863
760 Ga0495585_0160808
761 Ga0495594_0011422
762 Ga0495594_0027549
763 Ga0495594_0033193
764 Ga0495596_0001023
765 Ga0495596_0001134
766 Ga0495596_0009771
767 Ga0495596_0031930
768 Ga0495607_0002206
769 Ga0495607_0005697
770 Ga0495607_0009107
771 Ga0495607_0009420
772 Ga0495607_0011983
773 Ga0495607_0023207
774 Ga0495607_0043187
775 Ga0495607_0176099
776 Ga0495583_0000298
777 Ga0495583_0000389
778 Ga0495583_0007819
779 Ga0495583_0010232
780 Ga0495583_0024529
781 Ga0495583_0096119
782 Ga0495606_0000129
783 Ga0495606_0020816
784 Ga0495606_0021364
785 Ga0495606_0028007
786 Ga0495606_0072082
787 Ga0495606_0097540
788 Ga0495606_0231934
789 Ga0495610_0000014
790 Ga0495610_0005860
791 Ga0495610_0044700
792 Ga0495610_0071162
793 Ga0495616_0000150
794 Ga0495616_0001785
795 Ga0495616_0020261
796 Ga0495616_0034013
797 Ga0495616_0049632
798 Ga0495620_0000614
799 Ga0495620_0005094
800 Ga0495630_0026599
801 Ga0495631_0001581
802 Ga0495631_0044096
803 Ga0495631_0131021
804 Ga0495632_0000212
805 Ga0495632_0000485
806 Ga0495632_0008774
807 Ga0495632_0022309
808 Ga0495643_0001034
809 Ga0495643_0001271
810 Ga0495643_0004963
811 Ga0495643_0016995
812 Ga0495643_0023797
813 Ga0495643_0026801
814 Ga0495644_0000891
815 Ga0495644_0037114
816 Ga0495648_0002637
817 Ga0495648_0005785
818 Ga0495648_0006165
819 Ga0495648_0032694
820 Ga0495648_0048781
821 Ga0495648_0049308
822 Ga0495666_0007654
823 Ga0495666_0022254
824 Ga0495642_0000191
825 Ga0495642_0235930
826 Ga0495652_0016557
827 Ga0495654_0002221
828 Ga0495654_0006635
829 Ga0495665_0111406
830 Ga0495640_0073807
831 Ga0495586_0014100
832 Ga0495587_0089082
833 Ga0495609_0000086
834 Ga0495609_0000296
835 Ga0495609_0000541
836 Ga0495609_0004023
837 Ga0495609_0017748
838 Ga0495645_0033163
839 Ga0495645_0111729
840 Ga0495622_0007729
841 Ga0495622_0076337
842 Ga0495633_0003006
843 Ga0495633_0008113
844 Ga0495656_0047708
845 Ga0495668_0000579
846 Ga0495668_0009411
847 Ga0495668_0027333
848 Ga0495668_0056389
849 Ga0495668_0103759
850 Ga0495625_0000655
851 Ga0495625_0008368
852 Ga0495625_0077358
853 Ga0495635_0083487
854 Ga0495661_0000224
855 Ga0495661_0000497
856 Ga0495661_0000729
857 Ga0495661_0003501
858 Ga0495661_0003573
859 Ga0495661_0010072
860 Ga0495661_0029816
861 Ga0495661_0035756
862 Ga0495661_0067008
863 Ga0495661_0070433
864 Ga0495661_0122494
865 Ga0495661_0131038
866 Ga0495588_0000083
867 Ga0495588_0000343
868 Ga0495588_0006785
869 Ga0495599_0147328
870 Ga0495623_0025162
871 Ga0495623_0319800
872 Ga0495669_0001543
873 Ga0495669_0023246
874 Ga0495670_0014011
875 Ga0495670_0036377
876 Ga0495670_0090782
877 Ga0495671_0000005
878 Ga0495671_0000024
879 Ga0495671_0023641
880 Ga0495671_0064108
881 Ga0495649_0002145
882 Ga0495649_0011859
883 Ga0495649_0013515
884 Ga0495649_0017405
885 Ga0495649_0043248
886 Ga0495589_0000055
887 Ga0495589_0000069
888 Ga0495589_0004668
889 Ga0495589_0011678
890 Ga0495589_0014192
891 Ga0495589_0019116
892 Ga0495589_0045538
893 Ga0495589_0135238
894 Ga0495600_0045712
895 Ga0495660_0000138
896 Ga0495660_0000779
897 Ga0495660_0000802
898 Ga0495660_0000950
899 Ga0495660_0001574
900 Ga0495660_0001585
901 Ga0495660_0002695
902 Ga0495660_0019801
903 Ga0495660_0199245
904 Ga0495604_0074654
905 Ga0495604_0088950
906 Ga0495636_0004616
907 Ga0495636_0026479
908 Ga0495674_0002616
909 Ga0495672_0000108
910 Ga0495672_0000201
911 Ga0495672_0000346
912 Ga0495672_0004302
913 Ga0495672_0011912
914 Ga0495683_0000469
915 Ga0495683_0001975
916 Ga0495683_0003021
917 Ga0495683_0018088
918 Ga0495687_000017
919 Ga0495687_000139
920 Ga0495687_001344
921 Ga0495687_001495
922 Ga0495687_003747
923 Ga0495687_022684
924 Ga0495687_126308
925 Ga0495675_0021902
926 Ga0495677_0000038
927 Ga0495677_0001935
928 Ga0495677_0002375
929 Ga0495677_0002599
930 Ga0495677_0036737
931 Ga0495679_002014
932 Ga0495679_004304
933 Ga0495679_029306
934 Ga0495685_003400
935 Ga0495673_0000009
936 Ga0495673_0000012
937 Ga0495673_0000043
938 Ga0495673_0000711
939 Ga0495673_0001461
940 Ga0495673_0033543
941 Ga0495681_0000846
942 Ga0495681_0007038
943 Ga0495684_0042409
944 Ga0495686_0000130
945 Ga0495686_0040628
946 Ga0495686_0048415
947 Ga0495686_0079194
948 Ga0495686_0118173
949 Ga0495593_0142117
950 Ga0495602_0031643
951 Ga0495626_0000082
952 Ga0495626_0000146
953 Ga0495626_0003261
954 Ga0495626_0003902
955 Ga0495626_0008861
956 Ga0495626_0012245
957 Ga0495626_0012455
958 Ga0495626_0021370
959 Ga0495626_0041551
960 Ga0496100_0063432
961 Ga0496101_0124054
962 Ga0496102_0031112
963 Ga0496102_0098913
964 Ga0496102_0397343
965 Ga0496106_0000998
966 Ga0496106_0004615
967 Ga0496106_0228948
968 Ga0496108_0421959
969 Ga0496109_0007449
970 Ga0496109_0396315
971 Ga0496110_0128627
972 Ga0496111_0335722
973 Ga0496113_0233695
974 Ga0496113_0341486
975 Ga0496116_0044134
976 Ga0496118_0003025
977 Ga0496121_0002184
978 Ga0496121_0026970
979 Ga0496121_0124053
980 Ga0496122_0001184
981 Ga0496122_0004400
982 Ga0496122_0004792
983 Ga0496122_0021245
984 Ga0496122_0089175
985 Ga0496123_0004100
986 Ga0496123_0010410
987 Ga0496123_0022854
988 Ga0496123_0030839
989 Ga0496124_0017007
990 Ga0496124_0017185
991 Ga0496124_0052088
992 Ga0496124_0074761
993 Ga0496124_0149521
994 Ga0496124_0157915
995 Ga0496124_0231547
996 Ga0496125_0000991
997 Ga0496125_0016043
998 Ga0496125_0022498
999 Ga0496126_0008988
1000 Ga0496126_0047092
1001 Ga0495678_000060
1002 Ga0495678_019984
1003 Ga0495678_033133
1004 Ga0495678_034990
1005 Ga0495682_0000035
1006 Ga0501031_0026329
1007 Ga0501031_0089390
1008 Ga0501032_0012217
1009 Ga0501032_0119885
1010 Ga0501033_0001472
1011 Ga0501033_0020755
1012 Ga0501033_0139157
1013 Ga0501033_0369250
1014 Ga0501034_0000757
1015 Ga0501034_0001574
1016 Ga0501034_0023906
1017 Ga0501036_0045649
1018 Ga0501036_0084386
1019 Ga0501036_0326141
1020 Ga0501037_0001043
1021 Ga0501038_0001114
1022 Ga0501038_0007125
1023 Ga0501039_0038464
1024 Ga0501039_0091839
1025 Ga0501042_0048337
1026 Ga0501043_0008721
1027 Ga0501043_0013597
1028 Ga0501043_0069940
1029 Ga0501046_0186338
1030 Ga0501047_0308100
1031 Ga0501047_0367119
1032 Ga0501048_0010975
1033 Ga0501067_0048527
1034 Ga0501070_0151548
1035 Ga0501269_000816
1036 Ga0501035_0002482
1037 Ga0501035_0028025
1038 Ga0501035_0028664
1039 Ga0501035_0131475
1040 Ga0501044_0001762
1041 Ga0501044_0038355
1042 Ga0501044_0121817
1043 Ga0501044_0205789
1044 Ga0501045_0296048
1045 nmdc:mga03683_2280_c2
1046 nmdc:mga03n38_232993_c1
1047 nmdc:mga0yw44_472342_c1
1048 nmdc:mga06z11_513_c1
1049 nmdc:mga06z11_7501_c1
1050 nmdc:mga04h51_241_c1
1051 nmdc:mga07m45_3228_c2
1052 nmdc:mga07m45_70943_c1
1053 nmdc:mga0sz30_323_c1
1054 Ga0500644_0047958
1055 Ga0500556_0000729
1056 Ga0500593_000043
1057 Ga0500559_0000516
1058 Ga0500573_0035539
1059 Ga0500577_0083826
1060 Ga0500586_000884
1061 Ga0500616_0001941
1062 Ga0500622_0000315
1063 Ga0500622_0000713
1064 Ga0500599_011497
1065 2509126439
1066 2512642968
1067 2550696401
1068 2599101865
1069 2643800928
1070 2644471294
1071 2738826339
1072 2739150136
1073 2739192055
1074 2739318532
1075 2739336773
1076 2786666640
1077 2804848727
1078 2809215265
1079 2819637263
1080 2846958009
1081 2848864950
1082 2862296146
1083 2868093756
1084 2897805775
1085 2928177930
1086 2945949700
1087 2954681734
1088 2954691191
1089 2974291376
1090 8018846189
1091 8020940379
1092 8020952841
1093 8020955242
1094 8021127155
1095 8047674640
1096 8054007598
1097 8054917216
1098 8054924485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

57

250

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

63

303

0.94

PF08659

KR

KR domain

58

237

0.86

PF23441

50

304

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.993 4 251
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9924 2 251
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9897 4 251
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9881 2 251
4fgs-assembly1.cif.gz_C crystal structure of a probable dehydrogenase protein 0.9869 2 251
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9673 2 180 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 1 251 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9573 8 85 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9552 5 157 3.40.50.720
af_Q2FVE2_1_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 60 251 3.40.50.720
ID Description Score Start End GO Terms
AF-G1Y2C3-F1-model_v4 deleted 0.9924 35 251
AF-A2WD61-F1-model_v4 deleted 0.9912 1 251
AF-J8V7H0-F1-model_v4 deleted 0.9873 117 251
AF-A2WD61-F1-model_v4 deleted 0.9873 1 251
AF-A0A508ZXZ4-F1-model_v4 3-oxoacyl-ACP reductase (EC 1.1.1.14) 0.9851 1 188 GO:0003939

Map