F462444

General Info

Members Datasets Scaffolds Average Seq Length
550 223 1100 339

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100029618|Ga0070680_1000296182
Length 344
Sequence MRIAVCLPQVPFERGGAEIFADDLVRELQERGEEATLVTVPFKWYPGARVLTQAFLWRLLDLEEAAGRPVDAVVATKFPSYGVRHPRKIVWLLHQFRQAWDLDRTELGQFSESAEDRALRRRVLAFERTALGEAKAIFATSGNVARRLAASTGLECELMPHPPAPLDYRCEEYGDFILSVNRLDRAKRIDLLLEAAAADPGLRVVVAGDGPDRVRLEELARRHGLDGRARFTGRIDDDELAGLYARCLGVYYAPVDEDFGMVPFEAFLSQKPVLTTTDAGGPLDVVHDHETGLVVAPTAVELARACTWLREHDADAQRYGRAGRELAARVTWDACIDRLLAAAR

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 6.18
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100029618 3300005336 Bacteria 4396
2 Ga0070658_10018885 3300005327 Bacteria 5523
3 Ga0070658_10041529 3300005327 Bacteria 3711
4 Ga0070658_10077844 3300005327 Unclassified 2721
5 Ga0070683_100042730 3300005329 Bacteria 4174
6 Ga0070683_100096446 3300005329 Bacteria 2781
7 Ga0070670_100028110 3300005331 Bacteria 4839
8 Ga0068869_100179680 3300005334 Bacteria 1658
9 Ga0070680_100263960 3300005336 Bacteria 1457
10 Ga0070682_100036967 3300005337 Bacteria 2987
11 Ga0070682_100094612 3300005337 Bacteria 1960
12 Ga0068868_100016808 3300005338 Bacteria 5441
13 Ga0068868_100062924 3300005338 Bacteria 2943
14 Ga0068868_100149299 3300005338 Bacteria 1924
15 Ga0068868_100224944 3300005338 Bacteria 1572
16 Ga0070660_100004750 3300005339 Bacteria 9398
17 Ga0070660_100010611 3300005339 Bacteria 6512
18 Ga0070660_100052024 3300005339 Bacteria 3156
19 Ga0070660_100064622 3300005339 Bacteria 2847
20 Ga0070689_100025658 3300005340 Bacteria 4430
21 Ga0070689_100030302 3300005340 Bacteria 4106
22 Ga0070689_100148620 3300005340 Bacteria 1889
23 Ga0070691_10002398 3300005341 Bacteria 8310
24 Ga0070691_10033100 3300005341 Bacteria 2431
25 Ga0070691_10127240 3300005341 Bacteria 1288
26 Ga0070661_100018320 3300005344 Bacteria 4977
27 Ga0070668_100106253 3300005347 Bacteria 2230
28 Ga0070668_100218218 3300005347 Bacteria 1572
29 Ga0070671_100112018 3300005355 Bacteria 2292
30 Ga0070674_100053309 3300005356 Bacteria 2792
31 Ga0070674_100212720 3300005356 Bacteria 1499
32 Ga0070673_100022960 3300005364 Bacteria 4551
33 Ga0070688_100211245 3300005365 Bacteria 1362
34 Ga0070659_100013999 3300005366 Bacteria 5986
35 Ga0070659_100079672 3300005366 Unclassified 2614
36 Ga0070659_100290047 3300005366 Unclassified 1363
37 Ga0070703_10033447 3300005406 Bacteria 1565
38 Ga0070714_100448850 3300005435 Bacteria 1225
39 Ga0070713_100016665 3300005436 Bacteria 5529
40 Ga0070701_10009000 3300005438 Bacteria 4353
41 Ga0070701_10208459 3300005438 Bacteria 1159
42 Ga0070700_100061388 3300005441 Unclassified 2371
43 Ga0070700_100093306 3300005441 Bacteria 1969
44 Ga0070700_100194597 3300005441 Bacteria 1420
45 Ga0070663_100329688 3300005455 Bacteria 1230
46 Ga0070678_100055003 3300005456 Bacteria 2904
47 Ga0070681_10016017 3300005458 Bacteria 7474
48 Ga0070681_10020953 3300005458 Bacteria 6549
49 Ga0070681_10051012 3300005458 Bacteria 4127
50 Ga0070681_10090816 3300005458 Bacteria 3004
51 Ga0070681_10107097 3300005458 Bacteria 2737
52 Ga0070681_10243316 3300005458 Unclassified 1712
53 Ga0070698_100105564 3300005471 Bacteria 2787
54 Ga0070699_100094820 3300005518 Bacteria 2612
55 Ga0070679_100029914 3300005530 Bacteria 5374
56 Ga0070679_100075710 3300005530 Bacteria 3355
57 Ga0070679_100125063 3300005530 Bacteria 2554
58 Ga0070679_100162835 3300005530 Bacteria 2204
59 Ga0070679_100178451 3300005530 Bacteria 2097
60 Ga0070684_100045538 3300005535 Bacteria 3799
61 Ga0070684_100123402 3300005535 Bacteria 2331
62 Ga0070684_100160358 3300005535 Unclassified 2040
63 Ga0070684_100292010 3300005535 Bacteria 1495
64 Ga0068853_100035845 3300005539 Bacteria 4216
65 Ga0070672_100068835 3300005543 Unclassified 2808
66 Ga0070672_100084880 3300005543 Bacteria 2544
67 Ga0070672_100085002 3300005543 Bacteria 2542
68 Ga0070686_100036420 3300005544 Bacteria 3046
69 Ga0070686_100138793 3300005544 Unclassified 1689
70 Ga0070696_100229725 3300005546 Unclassified 1395
71 Ga0070693_100044785 3300005547 Unclassified 2504
72 Ga0070693_100083361 3300005547 Unclassified 1911
73 Ga0070693_100135295 3300005547 Unclassified 1545
74 Ga0070665_100035583 3300005548 Bacteria 5007
75 Ga0070665_100114867 3300005548 Bacteria 2695
76 Ga0070665_100224044 3300005548 Bacteria 1881
77 Ga0070704_100035662 3300005549 Bacteria 3383
78 Ga0070704_100393988 3300005549 Bacteria 1180
79 Ga0068855_100008481 3300005563 Bacteria 12423
80 Ga0068855_100069082 3300005563 Bacteria 4111
81 Ga0068854_100110440 3300005578 Unclassified 2073
82 Ga0068856_100457576 3300005614 Unclassified 1297
83 Ga0070702_100090066 3300005615 Unclassified 1858
84 Ga0070702_100256465 3300005615 Bacteria 1188
85 Ga0068852_100031443 3300005616 Bacteria 4380
86 Ga0068852_100046076 3300005616 Bacteria 3713
87 Ga0068852_100056219 3300005616 Bacteria 3400
88 Ga0068852_100414857 3300005616 Bacteria 1327
89 Ga0068852_100458606 3300005616 Bacteria 1263
90 Ga0068864_100406586 3300005618 Unclassified 1294
91 Ga0068866_10060740 3300005718 Unclassified 1960
92 Ga0068866_10069958 3300005718 Bacteria 1851
93 Ga0068861_100216090 3300005719 Unclassified 1618
94 Ga0068870_10024670 3300005840 Bacteria 2977
95 Ga0068863_100099581 3300005841 Bacteria 2762
96 Ga0068858_100064630 3300005842 Bacteria 3387
97 Ga0068858_100069977 3300005842 Bacteria 3252
98 Ga0068860_100132668 3300005843 Bacteria 2391
99 Ga0081455_10011507 3300005937 Bacteria 8885
100 Ga0081455_10016423 3300005937 Bacteria 7149
101 Ga0081455_10107785 3300005937 Bacteria 2220
102 Ga0081539_10000952 3300005985 Bacteria 54279
103 Ga0081539_10078690 3300005985 Bacteria 1740
104 Ga0070717_10017285 3300006028 Bacteria 5610
105 Ga0070717_10104062 3300006028 Bacteria 2414
106 Ga0075368_10042172 3300006042 Bacteria 1795
107 Ga0075432_10001318 3300006058 Bacteria 8017
108 Ga0070716_100108642 3300006173 Bacteria 1714
109 Ga0070712_100278369 3300006175 Unclassified 1347
110 Ga0097621_100235105 3300006237 Bacteria 1600
111 Ga0097621_100363581 3300006237 Unclassified 1289
112 Ga0068871_100326676 3300006358 Bacteria 1352
113 Ga0075428_100013646 3300006844 Bacteria 9045
114 Ga0075431_100029662 3300006847 Bacteria 5632
115 Ga0075434_100301234 3300006871 Unclassified 1623
116 Ga0068865_100007974 3300006881 Bacteria 6536
117 Ga0068865_100014481 3300006881 Bacteria 5012
118 Ga0068865_100035853 3300006881 Bacteria 3340
119 Ga0068865_100172252 3300006881 Bacteria 1660
120 Ga0075436_100041237 3300006914 Bacteria 3185
121 Ga0075435_100180150 3300007076 Bacteria 1786
122 Ga0105240_10123048 3300009093 Bacteria 3122
123 Ga0105240_10237790 3300009093 Bacteria 2113
124 Ga0111539_10023048 3300009094 Bacteria 7646
125 Ga0111539_10033421 3300009094 Bacteria 6243
126 Ga0111539_10091780 3300009094 Bacteria 3568
127 Ga0111539_10107368 3300009094 Bacteria 3275
128 Ga0111539_10111125 3300009094 Bacteria 3216
129 Ga0111539_10435664 3300009094 Bacteria 1526
130 Ga0105245_10028527 3300009098 Bacteria 4925
131 Ga0105245_10063939 3300009098 Bacteria 3325
132 Ga0105245_10133562 3300009098 Bacteria 2330
133 Ga0105245_10193368 3300009098 Bacteria 1950
134 Ga0105245_10598427 3300009098 Unclassified 1129
135 Ga0105247_10007141 3300009101 Bacteria 6858
136 Ga0114129_10035008 3300009147 Bacteria 7094
137 Ga0114129_10359026 3300009147 Bacteria 1928
138 Ga0114129_10651280 3300009147 Bacteria 1359
139 Ga0105243_10007007 3300009148 Bacteria 8680
140 Ga0105243_10012297 3300009148 Bacteria 6474
141 Ga0105243_10043111 3300009148 Bacteria 3535
142 Ga0105243_10054811 3300009148 Bacteria 3166
143 Ga0105243_10057448 3300009148 Bacteria 3098
144 Ga0105242_10039367 3300009176 Bacteria 3804
145 Ga0105242_10152905 3300009176 Bacteria 2014
146 Ga0105248_10168159 3300009177 Unclassified 2471
147 Ga0105248_10338947 3300009177 Bacteria 1693
148 Ga0105238_10512610 3300009551 Bacteria 1201
149 Ga0105239_10010247 3300010375 Bacteria 10495
150 Ga0105239_10015224 3300010375 Bacteria 8521
151 Ga0105239_10051696 3300010375 Bacteria 4504
152 Ga0105246_10097453 3300011119 Bacteria 2134
153 Ga0157371_10106211 3300013102 Unclassified 1992
154 Ga0157371_10180683 3300013102 Bacteria 1509
155 Ga0157370_10019245 3300013104 Bacteria 6855
156 Ga0157370_10087597 3300013104 Bacteria 2925
157 Ga0157369_10027427 3300013105 Bacteria 6313
158 Ga0157369_10174132 3300013105 Bacteria 2266
159 Ga0157369_10501124 3300013105 Bacteria 1256
160 Ga0163162_10136216 3300013306 Bacteria 2566
161 Ga0163162_10136236 3300013306 Unclassified 2566
162 Ga0157372_10062803 3300013307 Bacteria 4163
163 Ga0157372_10120512 3300013307 Bacteria 3012
164 Ga0157372_10381967 3300013307 Unclassified 1641
165 Ga0157375_10006635 3300013308 Bacteria 10071
166 Ga0157375_10124473 3300013308 Unclassified 2692
167 Ga0157375_10461022 3300013308 Unclassified 1436
168 Ga0163163_10174701 3300014325 Bacteria 2195
169 Ga0163163_10348828 3300014325 Bacteria 1536
170 Ga0182008_10004598 3300014497 Bacteria 8036
171 Ga0182008_10017370 3300014497 Bacteria 3733
172 Ga0157377_10049007 3300014745 Bacteria 2373
173 Ga0157377_10103224 3300014745 Bacteria 1703
174 Ga0157379_10377286 3300014968 Unclassified 1301
175 Ga0157376_10134365 3300014969 Unclassified 2212
176 Ga0182007_10024033 3300015262 Bacteria 2137
177 Ga0163161_10027116 3300017792 Bacteria 4063
178 Ga0163161_10120300 3300017792 Unclassified 1972
179 Ga0206353_10375749 3300020082 Bacteria 5722
180 Ga0207642_10086441 3300025899 Bacteria 1537
181 Ga0207688_10002673 3300025901 Bacteria 9657
182 Ga0207688_10009788 3300025901 Bacteria 5216
183 Ga0207688_10024122 3300025901 Bacteria 3335
184 Ga0207680_10176362 3300025903 Bacteria 1443
185 Ga0207699_10132216 3300025906 Bacteria 1629
186 Ga0207699_10180365 3300025906 Bacteria 1419
187 Ga0207645_10052807 3300025907 Bacteria 2597
188 Ga0207645_10065389 3300025907 Bacteria 2324
189 Ga0207643_10006836 3300025908 Bacteria 6124
190 Ga0207643_10012490 3300025908 Bacteria 4590
191 Ga0207643_10028681 3300025908 Bacteria 3093
192 Ga0207705_10018384 3300025909 Bacteria 4999
193 Ga0207705_10061774 3300025909 Bacteria 2706
194 Ga0207705_10228341 3300025909 Unclassified 1415
195 Ga0207707_10047185 3300025912 Bacteria 3752
196 Ga0207707_10086935 3300025912 Bacteria 2732
197 Ga0207707_10101606 3300025912 Unclassified 2513
198 Ga0207671_10198022 3300025914 Unclassified 1568
199 Ga0207693_10029614 3300025915 Bacteria 4323
200 Ga0207693_10192114 3300025915 Bacteria 1606
201 Ga0207660_10059479 3300025917 Bacteria 2743
202 Ga0207662_10044287 3300025918 Bacteria 2627
203 Ga0207662_10050300 3300025918 Bacteria 2475
204 Ga0207657_10002818 3300025919 Bacteria 18694
205 Ga0207657_10010770 3300025919 Bacteria 9102
206 Ga0207657_10021900 3300025919 Bacteria 6002
207 Ga0207657_10057026 3300025919 Bacteria 3368
208 Ga0207649_10057936 3300025920 Unclassified 2424
209 Ga0207649_10185618 3300025920 Bacteria 1459
210 Ga0207652_10020062 3300025921 Bacteria 5505
211 Ga0207652_10036010 3300025921 Bacteria 4182
212 Ga0207652_10118732 3300025921 Bacteria 2351
213 Ga0207652_10252820 3300025921 Unclassified 1589
214 Ga0207646_10100844 3300025922 Bacteria 2588
215 Ga0207650_10022699 3300025925 Bacteria 4445
216 Ga0207659_10100341 3300025926 Bacteria 2181
217 Ga0207659_10167297 3300025926 Bacteria 1731
218 Ga0207687_10166560 3300025927 Bacteria 1696
219 Ga0207687_10255779 3300025927 Bacteria 1394
220 Ga0207700_10000001 3300025928 Bacteria 1122509
221 Ga0207664_10007056 3300025929 Bacteria 7784
222 Ga0207664_10010533 3300025929 Bacteria 6530
223 Ga0207664_10024897 3300025929 Bacteria 4501
224 Ga0207664_10141890 3300025929 Bacteria 2033
225 Ga0207664_10157966 3300025929 Bacteria 1932
226 Ga0207644_10174529 3300025931 Bacteria 1680
227 Ga0207644_10198952 3300025931 Unclassified 1580
228 Ga0207690_10085638 3300025932 Unclassified 2213
229 Ga0207690_10135425 3300025932 Bacteria 1808
230 Ga0207690_10202781 3300025932 Bacteria 1507
231 Ga0207706_10118139 3300025933 Bacteria 2332
232 Ga0207706_10135189 3300025933 Bacteria 2169
233 Ga0207709_10017322 3300025935 Bacteria 4020
234 Ga0207709_10024567 3300025935 Bacteria 3442
235 Ga0207709_10175529 3300025935 Bacteria 1508
236 Ga0207670_10023226 3300025936 Bacteria 3857
237 Ga0207704_10085123 3300025938 Unclassified 2057
238 Ga0207704_10162590 3300025938 Bacteria 1590
239 Ga0207665_10020541 3300025939 Bacteria 4341
240 Ga0207691_10014299 3300025940 Bacteria 7570
241 Ga0207691_10082592 3300025940 Bacteria 2886
242 Ga0207691_10106514 3300025940 Bacteria 2497
243 Ga0207691_10195665 3300025940 Unclassified 1762
244 Ga0207689_10020147 3300025942 Bacteria 5618
245 Ga0207689_10043610 3300025942 Bacteria 3708
246 Ga0207661_10098974 3300025944 Unclassified 2445
247 Ga0207661_10121204 3300025944 Bacteria 2227
248 Ga0207661_10135474 3300025944 Bacteria 2114
249 Ga0207661_10150579 3300025944 Bacteria 2011
250 Ga0207679_10137487 3300025945 Bacteria 1969
251 Ga0207667_10021611 3300025949 Bacteria 7129
252 Ga0207651_10009467 3300025960 Bacteria 5338
253 Ga0207651_10088530 3300025960 Bacteria 2257
254 Ga0207668_10074511 3300025972 Bacteria 2437
255 Ga0207640_10011963 3300025981 Bacteria 4929
256 Ga0207640_10049176 3300025981 Bacteria 2728
257 Ga0207640_10239252 3300025981 Bacteria 1402
258 Ga0207677_10160602 3300026023 Bacteria 1746
259 Ga0207677_10240207 3300026023 Unclassified 1465
260 Ga0207639_10077997 3300026041 Unclassified 2613
261 Ga0207678_10081945 3300026067 Bacteria 2761
262 Ga0207678_10095386 3300026067 Bacteria 2542
263 Ga0207678_10103616 3300026067 Bacteria 2429
264 Ga0207708_10026731 3300026075 Bacteria 4369
265 Ga0207708_10089375 3300026075 Bacteria 2374
266 Ga0207708_10096687 3300026075 Bacteria 2282
267 Ga0207702_10177230 3300026078 Unclassified 1960
268 Ga0207702_10437044 3300026078 Unclassified 1268
269 Ga0207641_10056783 3300026088 Bacteria 3328
270 Ga0207648_10063350 3300026089 Bacteria 3223
271 Ga0207674_10024130 3300026116 Bacteria 6503
272 Ga0207674_10031299 3300026116 Bacteria 5590
273 Ga0207674_10075631 3300026116 Bacteria 3377
274 Ga0207683_10119016 3300026121 Bacteria 2370
275 Ga0207698_10063945 3300026142 Bacteria 2882
276 Ga0207698_10080640 3300026142 Bacteria 2622
277 Ga0207698_10215375 3300026142 Unclassified 1731
278 Ga0207428_10000389 3300027907 Bacteria 54953
279 Ga0207428_10016907 3300027907 Bacteria 6269
280 Ga0207428_10023645 3300027907 Bacteria 5164
281 Ga0207428_10082171 3300027907 Bacteria 2514
282 Ga0207428_10168005 3300027907 Bacteria 1662
283 Ga0265319_1007420 3300028563 Bacteria 4934
284 Ga0265334_10018045 3300028573 Bacteria 2909
285 Ga0265338_10032046 3300028800 Bacteria 5138
286 Ga0265338_10037986 3300028800 Bacteria 4571
287 Ga0265338_10042121 3300028800 Bacteria 4258
288 Ga0265340_10023101 3300031247 Bacteria 3173
289 Ga0265339_10052766 3300031249 Bacteria 2213
290 Ga0265316_10072175 3300031344 Bacteria 2659
291 Ga0265313_10055105 3300031595 Bacteria 1884
292 Ga0265314_10044686 3300031711 Bacteria 3137
293 Ga0265342_10020925 3300031712 Bacteria 4184
294 Ga0373941_0018087 3300035115 Unclassified 1942
295 Ga0395899_0023374 3300037312 Bacteria 4682
296 Ga0395899_0040754 3300037312 Bacteria 3473
297 Ga0395899_0108609 3300037312 Unclassified 1996
298 Ga0395900_0083041 3300037418 Bacteria 3291
299 Ga0395900_0128728 3300037418 Bacteria 2595
300 Ga0395900_0262910 3300037418 Unclassified 1722
301 Ga0395898_0086542 3300037466 Bacteria 3020
302 Ga0395898_0099925 3300037466 Bacteria 2786
303 Ga0395898_0109256 3300037466 Bacteria 2651
304 Ga0395898_0295842 3300037466 Unclassified 1544
305 Ga0395905_0026418 3300037471 Bacteria 5474
306 Ga0395905_0054099 3300037471 Bacteria 3756
307 Ga0395905_0097268 3300037471 Bacteria 2764
308 Ga0395905_0341476 3300037471 Unclassified 1389
309 Ga0395901_0101593 3300038443 Bacteria 3017
310 Ga0395901_0105367 3300038443 Bacteria 2959
311 Ga0395901_0172299 3300038443 Bacteria 2270
312 Ga0395901_0240187 3300038443 Bacteria 1890
313 Ga0436360_1310579 3300039438 Bacteria 2716
314 Ga0439466_0009158 3300041411 Bacteria 3709
315 Ga0439431_0012735 3300041997 Bacteria 1936
316 Ga0450907_005995 3300042146 Bacteria 2038
317 Ga0439446_0002752 3300042156 Bacteria 4262
318 Ga0466963_0005913 3300044694 Bacteria 7202
319 Ga0466964_0006440 3300044706 Bacteria 4375
320 Ga0466957_0040924 3300044842 Bacteria 2801
321 Ga0466957_0174335 3300044842 Unclassified 1402
322 Ga0466958_0005781 3300045836 Bacteria 6687
323 Ga0466967_0000335 3300045976 Bacteria 21534
324 Ga0466967_0047488 3300045976 Bacteria 3743
325 Ga0466967_0070637 3300045976 Bacteria 3124
326 Ga0466967_0122995 3300045976 Bacteria 2400
327 Ga0466967_0125980 3300045976 Bacteria 2373
328 Ga0466967_0137179 3300045976 Bacteria 2275
329 Ga0466967_0506503 3300045976 Bacteria 1185
330 Ga0495641_0024932 3300046461 Bacteria 2942
331 Ga0495582_0098388 3300046473 Unclassified 1637
332 Ga0495596_0027482 3300046500 Unclassified 2288
333 Ga0495608_0058420 3300046511 Bacteria 2543
334 Ga0495630_0220988 3300046517 Bacteria 1446
335 Ga0495667_0061931 3300046559 Bacteria 2452
336 Ga0495667_0133006 3300046559 Unclassified 1604
337 Ga0495624_0124411 3300046690 Bacteria 1583
338 Ga0495589_0101174 3300046794 Bacteria 1395
339 Ga0495680_0018501 3300047322 Bacteria 5910
340 Ga0496101_0050129 3300048904 Bacteria 3004
341 Ga0496101_0064026 3300048904 Bacteria 2678
342 Ga0496102_0101110 3300048905 Bacteria 2678
343 Ga0496105_0062739 3300048908 Bacteria 3067
344 Ga0496107_0001701 3300048910 Bacteria 13784
345 Ga0496108_0007456 3300048911 Bacteria 8867
346 Ga0496108_0014941 3300048911 Bacteria 6336
347 Ga0496108_0074852 3300048911 Bacteria 2860
348 Ga0496108_0234951 3300048911 Bacteria 1594
349 Ga0496108_0306462 3300048911 Bacteria 1384
350 Ga0496109_0025828 3300048912 Bacteria 5235
351 Ga0496109_0066268 3300048912 Bacteria 3306
352 Ga0496109_0100407 3300048912 Bacteria 2684
353 Ga0496109_0489708 3300048912 Bacteria 1161
354 Ga0496110_0006017 3300048913 Bacteria 9555
355 Ga0496110_0011289 3300048913 Bacteria 7304
356 Ga0496110_0039782 3300048913 Bacteria 4095
357 Ga0496110_0041161 3300048913 Bacteria 4031
358 Ga0496110_0050719 3300048913 Bacteria 3644
359 Ga0496110_0377134 3300048913 Unclassified 1292
360 Ga0496111_0079936 3300048914 Bacteria 2385
361 Ga0496111_0091616 3300048914 Unclassified 2228
362 Ga0496111_0139121 3300048914 Bacteria 1799
363 Ga0496111_0196495 3300048914 Bacteria 1499
364 Ga0496111_0197672 3300048914 Bacteria 1495
365 Ga0496112_0052543 3300048915 Bacteria 3999
366 Ga0496112_0060431 3300048915 Bacteria 3735
367 Ga0496112_0308228 3300048915 Bacteria 1528
368 Ga0496113_0005152 3300048916 Bacteria 8127
369 Ga0496113_0268367 3300048916 Bacteria 1364
370 Ga0496114_0061288 3300048917 Bacteria 3146
371 Ga0496114_0069107 3300048917 Bacteria 2966
372 Ga0496114_0101679 3300048917 Bacteria 2454
373 Ga0496114_0164349 3300048917 Bacteria 1932
374 Ga0501031_0040911 3300049568 Bacteria 3025
375 Ga0501031_0110792 3300049568 Unclassified 1792
376 Ga0501032_0026795 3300049569 Bacteria 3962
377 Ga0501032_0047745 3300049569 Bacteria 2891
378 Ga0501032_0073448 3300049569 Bacteria 2278
379 Ga0501032_0101911 3300049569 Unclassified 1902
380 Ga0501033_0004535 3300049570 Bacteria 11121
381 Ga0501033_0025547 3300049570 Bacteria 4450
382 Ga0501034_0148069 3300049571 Bacteria 2324
383 Ga0501036_0007219 3300049572 Bacteria 9047
384 Ga0501036_0010163 3300049572 Bacteria 7756
385 Ga0501036_0094012 3300049572 Bacteria 2533
386 Ga0501036_0130839 3300049572 Bacteria 2119
387 Ga0501036_0183925 3300049572 Unclassified 1759
388 Ga0501036_0218479 3300049572 Bacteria 1600
389 Ga0501037_0023857 3300049573 Bacteria 4524
390 Ga0501037_0031840 3300049573 Bacteria 3894
391 Ga0501037_0052318 3300049573 Bacteria 2987
392 Ga0501038_0036213 3300049574 Bacteria 4331
393 Ga0501038_0073401 3300049574 Bacteria 2898
394 Ga0501038_0080299 3300049574 Bacteria 2749
395 Ga0501038_0085305 3300049574 Bacteria 2656
396 Ga0501039_0006236 3300049575 Bacteria 9061
397 Ga0501039_0010252 3300049575 Bacteria 7143
398 Ga0501039_0021111 3300049575 Bacteria 4995
399 Ga0501039_0044761 3300049575 Bacteria 3419
400 Ga0501039_0075903 3300049575 Bacteria 2613
401 Ga0501039_0104534 3300049575 Unclassified 2211
402 Ga0501039_0189718 3300049575 Bacteria 1616
403 Ga0501040_0010161 3300049576 Bacteria 6152
404 Ga0501040_0013046 3300049576 Bacteria 5465
405 Ga0501040_0069555 3300049576 Bacteria 2428
406 Ga0501040_0148060 3300049576 Unclassified 1655
407 Ga0501040_0229810 3300049576 Unclassified 1321
408 Ga0501040_0250272 3300049576 Bacteria 1264
409 Ga0501041_0006957 3300049577 Bacteria 6635
410 Ga0501041_0008198 3300049577 Bacteria 6149
411 Ga0501041_0011626 3300049577 Bacteria 5209
412 Ga0501041_0024063 3300049577 Bacteria 3654
413 Ga0501041_0047350 3300049577 Bacteria 2617
414 Ga0501041_0088301 3300049577 Bacteria 1914
415 Ga0501041_0245000 3300049577 Unclassified 1126
416 Ga0501042_0003050 3300049578 Bacteria 10416
417 Ga0501042_0003221 3300049578 Bacteria 10197
418 Ga0501042_0007700 3300049578 Bacteria 7073
419 Ga0501042_0011389 3300049578 Bacteria 6002
420 Ga0501042_0053337 3300049578 Bacteria 2885
421 Ga0501042_0198079 3300049578 Unclassified 1448
422 Ga0501042_0341380 3300049578 Bacteria 1083
423 Ga0501043_0089817 3300049579 Unclassified 2415
424 Ga0501043_0154778 3300049579 Unclassified 1793
425 Ga0501046_0005826 3300049580 Bacteria 10988
426 Ga0501046_0041965 3300049580 Bacteria 3648
427 Ga0501046_0074516 3300049580 Bacteria 2633
428 Ga0501046_0083051 3300049580 Unclassified 2473
429 Ga0501047_0081099 3300049581 Bacteria 3119
430 Ga0501047_0361369 3300049581 Unclassified 1288
431 Ga0501048_0051637 3300049582 Bacteria 2926
432 Ga0501067_0001164 3300049583 Bacteria 14279
433 Ga0501067_0070000 3300049583 Unclassified 1943
434 Ga0501067_0193976 3300049583 Bacteria 1131
435 Ga0501068_0004292 3300049584 Bacteria 7744
436 Ga0501068_0013719 3300049584 Bacteria 4615
437 Ga0501068_0035783 3300049584 Unclassified 2965
438 Ga0501068_0040594 3300049584 Bacteria 2794
439 Ga0501069_0002705 3300049585 Bacteria 9049
440 Ga0501069_0046884 3300049585 Unclassified 2398
441 Ga0501069_0074583 3300049585 Bacteria 1904
442 Ga0501070_0012883 3300049586 Bacteria 7046
443 Ga0501070_0100457 3300049586 Bacteria 2393
444 Ga0501070_0126531 3300049586 Bacteria 2111
445 Ga0501070_0231886 3300049586 Unclassified 1512
446 Ga0501070_0306286 3300049586 Bacteria 1293
447 Ga0501071_0006448 3300049587 Bacteria 7616
448 Ga0501071_0010398 3300049587 Bacteria 6235
449 Ga0501071_0016857 3300049587 Bacteria 5026
450 Ga0501071_0027753 3300049587 Unclassified 3984
451 Ga0501071_0109347 3300049587 Unclassified 2042
452 Ga0501071_0112555 3300049587 Unclassified 2012
453 Ga0501072_0003619 3300049588 Bacteria 11628
454 Ga0501072_0012616 3300049588 Bacteria 6459
455 Ga0501072_0013280 3300049588 Bacteria 6305
456 Ga0501072_0015201 3300049588 Bacteria 5902
457 Ga0501072_0019600 3300049588 Bacteria 5231
458 Ga0501072_0028310 3300049588 Unclassified 4375
459 Ga0501072_0029158 3300049588 Bacteria 4308
460 Ga0501072_0139430 3300049588 Unclassified 1933
461 Ga0501072_0263229 3300049588 Unclassified 1372
462 Ga0501073_0033321 3300049589 Bacteria 3669
463 Ga0501073_0076994 3300049589 Bacteria 2321
464 Ga0501074_0005547 3300049590 Bacteria 9075
465 Ga0501074_0005590 3300049590 Bacteria 9045
466 Ga0501074_0017404 3300049590 Bacteria 5215
467 Ga0501074_0026758 3300049590 Bacteria 4182
468 Ga0501074_0085486 3300049590 Bacteria 2260
469 Ga0501074_0278232 3300049590 Bacteria 1190
470 Ga0501074_0291194 3300049590 Unclassified 1160
471 Ga0501075_0000777 3300049591 Bacteria 19921
472 Ga0501075_0004722 3300049591 Bacteria 9256
473 Ga0501075_0029244 3300049591 Unclassified 4073
474 Ga0501075_0050852 3300049591 Bacteria 3115
475 Ga0501075_0088896 3300049591 Unclassified 2342
476 Ga0501075_0094186 3300049591 Unclassified 2273
477 Ga0501075_0179913 3300049591 Unclassified 1613
478 Ga0501075_0357002 3300049591 Bacteria 1114
479 Ga0501076_0009022 3300049592 Bacteria 7343
480 Ga0501076_0021873 3300049592 Unclassified 4910
481 Ga0501076_0029972 3300049592 Bacteria 4235
482 Ga0501076_0073327 3300049592 Bacteria 2741
483 Ga0501076_0086843 3300049592 Unclassified 2514
484 Ga0501076_0095184 3300049592 Unclassified 2398
485 Ga0501076_0115908 3300049592 Bacteria 2168
486 Ga0501076_0125408 3300049592 Unclassified 2080
487 Ga0501076_0282284 3300049592 Bacteria 1360
488 Ga0501077_0001254 3300049593 Bacteria 15334
489 Ga0501077_0013898 3300049593 Bacteria 5046
490 Ga0501077_0015104 3300049593 Bacteria 4856
491 Ga0501077_0042279 3300049593 Unclassified 2898
492 Ga0501077_0163313 3300049593 Unclassified 1414
493 Ga0501079_0002654 3300049741 Bacteria 13009
494 Ga0501079_0033717 3300049741 Bacteria 3939
495 Ga0501079_0043728 3300049741 Bacteria 3457
496 Ga0501079_0057864 3300049741 Bacteria 2991
497 Ga0501079_0085185 3300049741 Bacteria 2445
498 Ga0501079_0088445 3300049741 Unclassified 2398
499 Ga0501080_0004694 3300049742 Bacteria 12188
500 Ga0501080_0006466 3300049742 Bacteria 10523
501 Ga0501080_0077907 3300049742 Unclassified 3083
502 Ga0501080_0083060 3300049742 Bacteria 2976
503 Ga0501080_0107632 3300049742 Bacteria 2584
504 Ga0501080_0398979 3300049742 Bacteria 1237
505 Ga0501081_0004058 3300049743 Bacteria 9377
506 Ga0501081_0009474 3300049743 Bacteria 6349
507 Ga0501081_0011048 3300049743 Bacteria 5904
508 Ga0501081_0021952 3300049743 Bacteria 4265
509 Ga0501081_0037172 3300049743 Unclassified 3322
510 Ga0501081_0078691 3300049743 Bacteria 2305
511 Ga0501083_0001091 3300049744 Bacteria 18157
512 Ga0501083_0037549 3300049744 Bacteria 3299
513 Ga0501083_0041835 3300049744 Bacteria 3107
514 Ga0501083_0196802 3300049744 Bacteria 1315
515 Ga0501035_0011724 3300049822 Bacteria 8120
516 Ga0501035_0052924 3300049822 Bacteria 3632
517 Ga0501044_0349367 3300049823 Unclassified 1399
518 Ga0501045_0014426 3300049824 Bacteria 5598
519 Ga0501045_0017248 3300049824 Bacteria 5125
520 Ga0501045_0019466 3300049824 Unclassified 4839
521 Ga0501045_0028759 3300049824 Bacteria 4011
522 Ga0501045_0035379 3300049824 Bacteria 3626
523 Ga0501045_0201802 3300049824 Unclassified 1482
524 nmdc:mga05p37_26918_c1 3300050507 Bacteria 6997
525 nmdc:mga05p37_343876_c1 3300050507 Bacteria 1758
526 nmdc:mga09592_31182_c1 3300050508 Bacteria 4440
527 nmdc:mga09592_54146_c1 3300050508 Bacteria 3390
528 nmdc:mga08y16_139465_c1 3300050511 Bacteria 2521
529 nmdc:mga08y16_176256_c1 3300050511 Bacteria 2220
530 nmdc:mga08y16_19518_c1 3300050511 Bacteria 7148
531 nmdc:mga08y16_28930_c1 3300050511 Bacteria 5841
532 nmdc:mga08y16_70564_c1 3300050511 Bacteria 3642
533 nmdc:mga0n895_558763_c1 3300050512 Unclassified 1150
534 nmdc:mga0rr50_120771_c1 3300050513 Bacteria 2085
535 nmdc:mga0rr50_79852_c1 3300050513 Bacteria 2520
536 nmdc:mga08x19_255550_c1 3300050514 Bacteria 1210
537 Ga0495619_0026917 3300053085 Bacteria 3703
538 Ga0501084_0011374 3300054114 Bacteria 7370
539 Ga0501084_0015585 3300054114 Bacteria 6304
540 Ga0501084_0027518 3300054114 Bacteria 4750
541 Ga0501084_0244362 3300054114 Bacteria 1515
542 Ga0501082_0022341 3300060353 Bacteria 5449
543 Ga0501082_0025965 3300060353 Bacteria 5048
544 Ga0501082_0053288 3300060353 Bacteria 3487
545 Ga0501082_0079393 3300060353 Unclassified 2831
546 Ga0501082_0079636 3300060353 Bacteria 2826
547 Ga0501082_0087307 3300060353 Bacteria 2691
548 Ga0501082_0128122 3300060353 Bacteria 2202
549 Ga0501082_0189350 3300060353 Bacteria 1790
550 Ga0530510_0319637 3300061734 Unclassified 1163
551 Ga0070680_100029618
552 Ga0070658_10018885
553 Ga0070658_10041529
554 Ga0070658_10077844
555 Ga0070683_100042730
556 Ga0070683_100096446
557 Ga0070670_100028110
558 Ga0068869_100179680
559 Ga0070680_100263960
560 Ga0070682_100036967
561 Ga0070682_100094612
562 Ga0068868_100016808
563 Ga0068868_100062924
564 Ga0068868_100149299
565 Ga0068868_100224944
566 Ga0070660_100004750
567 Ga0070660_100010611
568 Ga0070660_100052024
569 Ga0070660_100064622
570 Ga0070689_100025658
571 Ga0070689_100030302
572 Ga0070689_100148620
573 Ga0070691_10002398
574 Ga0070691_10033100
575 Ga0070691_10127240
576 Ga0070661_100018320
577 Ga0070668_100106253
578 Ga0070668_100218218
579 Ga0070671_100112018
580 Ga0070674_100053309
581 Ga0070674_100212720
582 Ga0070673_100022960
583 Ga0070688_100211245
584 Ga0070659_100013999
585 Ga0070659_100079672
586 Ga0070659_100290047
587 Ga0070703_10033447
588 Ga0070714_100448850
589 Ga0070713_100016665
590 Ga0070701_10009000
591 Ga0070701_10208459
592 Ga0070700_100061388
593 Ga0070700_100093306
594 Ga0070700_100194597
595 Ga0070663_100329688
596 Ga0070678_100055003
597 Ga0070681_10016017
598 Ga0070681_10020953
599 Ga0070681_10051012
600 Ga0070681_10090816
601 Ga0070681_10107097
602 Ga0070681_10243316
603 Ga0070698_100105564
604 Ga0070699_100094820
605 Ga0070679_100029914
606 Ga0070679_100075710
607 Ga0070679_100125063
608 Ga0070679_100162835
609 Ga0070679_100178451
610 Ga0070684_100045538
611 Ga0070684_100123402
612 Ga0070684_100160358
613 Ga0070684_100292010
614 Ga0068853_100035845
615 Ga0070672_100068835
616 Ga0070672_100084880
617 Ga0070672_100085002
618 Ga0070686_100036420
619 Ga0070686_100138793
620 Ga0070696_100229725
621 Ga0070693_100044785
622 Ga0070693_100083361
623 Ga0070693_100135295
624 Ga0070665_100035583
625 Ga0070665_100114867
626 Ga0070665_100224044
627 Ga0070704_100035662
628 Ga0070704_100393988
629 Ga0068855_100008481
630 Ga0068855_100069082
631 Ga0068854_100110440
632 Ga0068856_100457576
633 Ga0070702_100090066
634 Ga0070702_100256465
635 Ga0068852_100031443
636 Ga0068852_100046076
637 Ga0068852_100056219
638 Ga0068852_100414857
639 Ga0068852_100458606
640 Ga0068864_100406586
641 Ga0068866_10060740
642 Ga0068866_10069958
643 Ga0068861_100216090
644 Ga0068870_10024670
645 Ga0068863_100099581
646 Ga0068858_100064630
647 Ga0068858_100069977
648 Ga0068860_100132668
649 Ga0081455_10011507
650 Ga0081455_10016423
651 Ga0081455_10107785
652 Ga0081539_10000952
653 Ga0081539_10078690
654 Ga0070717_10017285
655 Ga0070717_10104062
656 Ga0075368_10042172
657 Ga0075432_10001318
658 Ga0070716_100108642
659 Ga0070712_100278369
660 Ga0097621_100235105
661 Ga0097621_100363581
662 Ga0068871_100326676
663 Ga0075428_100013646
664 Ga0075431_100029662
665 Ga0075434_100301234
666 Ga0068865_100007974
667 Ga0068865_100014481
668 Ga0068865_100035853
669 Ga0068865_100172252
670 Ga0075436_100041237
671 Ga0075435_100180150
672 Ga0105240_10123048
673 Ga0105240_10237790
674 Ga0111539_10023048
675 Ga0111539_10033421
676 Ga0111539_10091780
677 Ga0111539_10107368
678 Ga0111539_10111125
679 Ga0111539_10435664
680 Ga0105245_10028527
681 Ga0105245_10063939
682 Ga0105245_10133562
683 Ga0105245_10193368
684 Ga0105245_10598427
685 Ga0105247_10007141
686 Ga0114129_10035008
687 Ga0114129_10359026
688 Ga0114129_10651280
689 Ga0105243_10007007
690 Ga0105243_10012297
691 Ga0105243_10043111
692 Ga0105243_10054811
693 Ga0105243_10057448
694 Ga0105242_10039367
695 Ga0105242_10152905
696 Ga0105248_10168159
697 Ga0105248_10338947
698 Ga0105238_10512610
699 Ga0105239_10010247
700 Ga0105239_10015224
701 Ga0105239_10051696
702 Ga0105246_10097453
703 Ga0157371_10106211
704 Ga0157371_10180683
705 Ga0157370_10019245
706 Ga0157370_10087597
707 Ga0157369_10027427
708 Ga0157369_10174132
709 Ga0157369_10501124
710 Ga0163162_10136216
711 Ga0163162_10136236
712 Ga0157372_10062803
713 Ga0157372_10120512
714 Ga0157372_10381967
715 Ga0157375_10006635
716 Ga0157375_10124473
717 Ga0157375_10461022
718 Ga0163163_10174701
719 Ga0163163_10348828
720 Ga0182008_10004598
721 Ga0182008_10017370
722 Ga0157377_10049007
723 Ga0157377_10103224
724 Ga0157379_10377286
725 Ga0157376_10134365
726 Ga0182007_10024033
727 Ga0163161_10027116
728 Ga0163161_10120300
729 Ga0206353_10375749
730 Ga0207642_10086441
731 Ga0207688_10002673
732 Ga0207688_10009788
733 Ga0207688_10024122
734 Ga0207680_10176362
735 Ga0207699_10132216
736 Ga0207699_10180365
737 Ga0207645_10052807
738 Ga0207645_10065389
739 Ga0207643_10006836
740 Ga0207643_10012490
741 Ga0207643_10028681
742 Ga0207705_10018384
743 Ga0207705_10061774
744 Ga0207705_10228341
745 Ga0207707_10047185
746 Ga0207707_10086935
747 Ga0207707_10101606
748 Ga0207671_10198022
749 Ga0207693_10029614
750 Ga0207693_10192114
751 Ga0207660_10059479
752 Ga0207662_10044287
753 Ga0207662_10050300
754 Ga0207657_10002818
755 Ga0207657_10010770
756 Ga0207657_10021900
757 Ga0207657_10057026
758 Ga0207649_10057936
759 Ga0207649_10185618
760 Ga0207652_10020062
761 Ga0207652_10036010
762 Ga0207652_10118732
763 Ga0207652_10252820
764 Ga0207646_10100844
765 Ga0207650_10022699
766 Ga0207659_10100341
767 Ga0207659_10167297
768 Ga0207687_10166560
769 Ga0207687_10255779
770 Ga0207700_10000001
771 Ga0207664_10007056
772 Ga0207664_10010533
773 Ga0207664_10024897
774 Ga0207664_10141890
775 Ga0207664_10157966
776 Ga0207644_10174529
777 Ga0207644_10198952
778 Ga0207690_10085638
779 Ga0207690_10135425
780 Ga0207690_10202781
781 Ga0207706_10118139
782 Ga0207706_10135189
783 Ga0207709_10017322
784 Ga0207709_10024567
785 Ga0207709_10175529
786 Ga0207670_10023226
787 Ga0207704_10085123
788 Ga0207704_10162590
789 Ga0207665_10020541
790 Ga0207691_10014299
791 Ga0207691_10082592
792 Ga0207691_10106514
793 Ga0207691_10195665
794 Ga0207689_10020147
795 Ga0207689_10043610
796 Ga0207661_10098974
797 Ga0207661_10121204
798 Ga0207661_10135474
799 Ga0207661_10150579
800 Ga0207679_10137487
801 Ga0207667_10021611
802 Ga0207651_10009467
803 Ga0207651_10088530
804 Ga0207668_10074511
805 Ga0207640_10011963
806 Ga0207640_10049176
807 Ga0207640_10239252
808 Ga0207677_10160602
809 Ga0207677_10240207
810 Ga0207639_10077997
811 Ga0207678_10081945
812 Ga0207678_10095386
813 Ga0207678_10103616
814 Ga0207708_10026731
815 Ga0207708_10089375
816 Ga0207708_10096687
817 Ga0207702_10177230
818 Ga0207702_10437044
819 Ga0207641_10056783
820 Ga0207648_10063350
821 Ga0207674_10024130
822 Ga0207674_10031299
823 Ga0207674_10075631
824 Ga0207683_10119016
825 Ga0207698_10063945
826 Ga0207698_10080640
827 Ga0207698_10215375
828 Ga0207428_10000389
829 Ga0207428_10016907
830 Ga0207428_10023645
831 Ga0207428_10082171
832 Ga0207428_10168005
833 Ga0265319_1007420
834 Ga0265334_10018045
835 Ga0265338_10032046
836 Ga0265338_10037986
837 Ga0265338_10042121
838 Ga0265340_10023101
839 Ga0265339_10052766
840 Ga0265316_10072175
841 Ga0265313_10055105
842 Ga0265314_10044686
843 Ga0265342_10020925
844 Ga0373941_0018087
845 Ga0395899_0023374
846 Ga0395899_0040754
847 Ga0395899_0108609
848 Ga0395900_0083041
849 Ga0395900_0128728
850 Ga0395900_0262910
851 Ga0395898_0086542
852 Ga0395898_0099925
853 Ga0395898_0109256
854 Ga0395898_0295842
855 Ga0395905_0026418
856 Ga0395905_0054099
857 Ga0395905_0097268
858 Ga0395905_0341476
859 Ga0395901_0101593
860 Ga0395901_0105367
861 Ga0395901_0172299
862 Ga0395901_0240187
863 Ga0436360_1310579
864 Ga0439466_0009158
865 Ga0439431_0012735
866 Ga0450907_005995
867 Ga0439446_0002752
868 Ga0466963_0005913
869 Ga0466964_0006440
870 Ga0466957_0040924
871 Ga0466957_0174335
872 Ga0466958_0005781
873 Ga0466967_0000335
874 Ga0466967_0047488
875 Ga0466967_0070637
876 Ga0466967_0122995
877 Ga0466967_0125980
878 Ga0466967_0137179
879 Ga0466967_0506503
880 Ga0495641_0024932
881 Ga0495582_0098388
882 Ga0495596_0027482
883 Ga0495608_0058420
884 Ga0495630_0220988
885 Ga0495667_0061931
886 Ga0495667_0133006
887 Ga0495624_0124411
888 Ga0495589_0101174
889 Ga0495680_0018501
890 Ga0496101_0050129
891 Ga0496101_0064026
892 Ga0496102_0101110
893 Ga0496105_0062739
894 Ga0496107_0001701
895 Ga0496108_0007456
896 Ga0496108_0014941
897 Ga0496108_0074852
898 Ga0496108_0234951
899 Ga0496108_0306462
900 Ga0496109_0025828
901 Ga0496109_0066268
902 Ga0496109_0100407
903 Ga0496109_0489708
904 Ga0496110_0006017
905 Ga0496110_0011289
906 Ga0496110_0039782
907 Ga0496110_0041161
908 Ga0496110_0050719
909 Ga0496110_0377134
910 Ga0496111_0079936
911 Ga0496111_0091616
912 Ga0496111_0139121
913 Ga0496111_0196495
914 Ga0496111_0197672
915 Ga0496112_0052543
916 Ga0496112_0060431
917 Ga0496112_0308228
918 Ga0496113_0005152
919 Ga0496113_0268367
920 Ga0496114_0061288
921 Ga0496114_0069107
922 Ga0496114_0101679
923 Ga0496114_0164349
924 Ga0501031_0040911
925 Ga0501031_0110792
926 Ga0501032_0026795
927 Ga0501032_0047745
928 Ga0501032_0073448
929 Ga0501032_0101911
930 Ga0501033_0004535
931 Ga0501033_0025547
932 Ga0501034_0148069
933 Ga0501036_0007219
934 Ga0501036_0010163
935 Ga0501036_0094012
936 Ga0501036_0130839
937 Ga0501036_0183925
938 Ga0501036_0218479
939 Ga0501037_0023857
940 Ga0501037_0031840
941 Ga0501037_0052318
942 Ga0501038_0036213
943 Ga0501038_0073401
944 Ga0501038_0080299
945 Ga0501038_0085305
946 Ga0501039_0006236
947 Ga0501039_0010252
948 Ga0501039_0021111
949 Ga0501039_0044761
950 Ga0501039_0075903
951 Ga0501039_0104534
952 Ga0501039_0189718
953 Ga0501040_0010161
954 Ga0501040_0013046
955 Ga0501040_0069555
956 Ga0501040_0148060
957 Ga0501040_0229810
958 Ga0501040_0250272
959 Ga0501041_0006957
960 Ga0501041_0008198
961 Ga0501041_0011626
962 Ga0501041_0024063
963 Ga0501041_0047350
964 Ga0501041_0088301
965 Ga0501041_0245000
966 Ga0501042_0003050
967 Ga0501042_0003221
968 Ga0501042_0007700
969 Ga0501042_0011389
970 Ga0501042_0053337
971 Ga0501042_0198079
972 Ga0501042_0341380
973 Ga0501043_0089817
974 Ga0501043_0154778
975 Ga0501046_0005826
976 Ga0501046_0041965
977 Ga0501046_0074516
978 Ga0501046_0083051
979 Ga0501047_0081099
980 Ga0501047_0361369
981 Ga0501048_0051637
982 Ga0501067_0001164
983 Ga0501067_0070000
984 Ga0501067_0193976
985 Ga0501068_0004292
986 Ga0501068_0013719
987 Ga0501068_0035783
988 Ga0501068_0040594
989 Ga0501069_0002705
990 Ga0501069_0046884
991 Ga0501069_0074583
992 Ga0501070_0012883
993 Ga0501070_0100457
994 Ga0501070_0126531
995 Ga0501070_0231886
996 Ga0501070_0306286
997 Ga0501071_0006448
998 Ga0501071_0010398
999 Ga0501071_0016857
1000 Ga0501071_0027753
1001 Ga0501071_0109347
1002 Ga0501071_0112555
1003 Ga0501072_0003619
1004 Ga0501072_0012616
1005 Ga0501072_0013280
1006 Ga0501072_0015201
1007 Ga0501072_0019600
1008 Ga0501072_0028310
1009 Ga0501072_0029158
1010 Ga0501072_0139430
1011 Ga0501072_0263229
1012 Ga0501073_0033321
1013 Ga0501073_0076994
1014 Ga0501074_0005547
1015 Ga0501074_0005590
1016 Ga0501074_0017404
1017 Ga0501074_0026758
1018 Ga0501074_0085486
1019 Ga0501074_0278232
1020 Ga0501074_0291194
1021 Ga0501075_0000777
1022 Ga0501075_0004722
1023 Ga0501075_0029244
1024 Ga0501075_0050852
1025 Ga0501075_0088896
1026 Ga0501075_0094186
1027 Ga0501075_0179913
1028 Ga0501075_0357002
1029 Ga0501076_0009022
1030 Ga0501076_0021873
1031 Ga0501076_0029972
1032 Ga0501076_0073327
1033 Ga0501076_0086843
1034 Ga0501076_0095184
1035 Ga0501076_0115908
1036 Ga0501076_0125408
1037 Ga0501076_0282284
1038 Ga0501077_0001254
1039 Ga0501077_0013898
1040 Ga0501077_0015104
1041 Ga0501077_0042279
1042 Ga0501077_0163313
1043 Ga0501079_0002654
1044 Ga0501079_0033717
1045 Ga0501079_0043728
1046 Ga0501079_0057864
1047 Ga0501079_0085185
1048 Ga0501079_0088445
1049 Ga0501080_0004694
1050 Ga0501080_0006466
1051 Ga0501080_0077907
1052 Ga0501080_0083060
1053 Ga0501080_0107632
1054 Ga0501080_0398979
1055 Ga0501081_0004058
1056 Ga0501081_0009474
1057 Ga0501081_0011048
1058 Ga0501081_0021952
1059 Ga0501081_0037172
1060 Ga0501081_0078691
1061 Ga0501083_0001091
1062 Ga0501083_0037549
1063 Ga0501083_0041835
1064 Ga0501083_0196802
1065 Ga0501035_0011724
1066 Ga0501035_0052924
1067 Ga0501044_0349367
1068 Ga0501045_0014426
1069 Ga0501045_0017248
1070 Ga0501045_0019466
1071 Ga0501045_0028759
1072 Ga0501045_0035379
1073 Ga0501045_0201802
1074 nmdc:mga05p37_26918_c1
1075 nmdc:mga05p37_343876_c1
1076 nmdc:mga09592_31182_c1
1077 nmdc:mga09592_54146_c1
1078 nmdc:mga08y16_139465_c1
1079 nmdc:mga08y16_176256_c1
1080 nmdc:mga08y16_19518_c1
1081 nmdc:mga08y16_28930_c1
1082 nmdc:mga08y16_70564_c1
1083 nmdc:mga0n895_558763_c1
1084 nmdc:mga0rr50_120771_c1
1085 nmdc:mga0rr50_79852_c1
1086 nmdc:mga08x19_255550_c1
1087 Ga0495619_0026917
1088 Ga0501084_0011374
1089 Ga0501084_0015585
1090 Ga0501084_0027518
1091 Ga0501084_0244362
1092 Ga0501082_0022341
1093 Ga0501082_0025965
1094 Ga0501082_0053288
1095 Ga0501082_0079393
1096 Ga0501082_0079636
1097 Ga0501082_0087307
1098 Ga0501082_0128122
1099 Ga0501082_0189350
1100 Ga0530510_0319637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

169

326

0.96

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

174

312

0.87

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

185

341

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.8698 150 304
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8496 158 306
2bfw-assembly1.cif.gz_A structure of the c domain of glycogen synthase from pyrococcus abyssi 0.845 157 306
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8317 149 303
6kqi-assembly1.cif.gz_A structure of an allosteric modulator bound to the cb1 cannabinoid receptor 0.8171 157 316
ID Description Score Start End Superfamily
af_Q84QB1_230_385_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.924 157 304 3.40.50.2000
af_P9WMY5_198_350_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9067 157 300 3.40.50.2000
af_F4IBV4_205_380_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9005 154 306 3.40.50.2000
af_Q58469_205_369_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8991 157 300 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8777 158 303 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A257ZMH7-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9623 175 315 GO:0016757
AF-A0A7W0SQT9-F1-model_v4 Glycosyltransferase family 4 protein 0.959 133 315 GO:0016758
AF-A0A108UCH9-F1-model_v4 Glycosyltransferase 0.9585 115 317 GO:0016757
AF-A0A7V1P3A6-F1-model_v4 deleted 0.9573 150 318
AF-X0ZWR7-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9463 128 314 GO:0016757

Map