F462429

General Info

Members Datasets Scaffolds Average Seq Length
549 295 1098 135

Family's Representative Sequence

Representative Sequence 3300060344|Ga0587071_019819|Ga0587071_019819_477_968
Length 154
Sequence VSSGAVSFIASPGERTMAMQLGGKGGVKSDINVTPLVDVMLAPMLQKGVDVKLPTATNTQDKPETQDQTVVAVTADGRMHLNSIPVPDTDMPQRIQDTLENKKEKIVYLKADQDAPYGRVMAAFDALRKAQVENIGLIAERKPVAGQQTTGGGK

Samples

Sample ID Description Type Environment
1 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
191 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
192 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
193 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
194 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.34
Metatranscriptomes 11.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 6.38
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587071_019819 3300060344 Bacteria 1221
2 ARCol0yngRDRAFT_1016573 3300000652 Bacteria 559
3 JGI24749J21850_1027849 3300002076 Bacteria 807
4 Ga0006770J48903_1068030 3300003305 Bacteria 1598
5 Ga0007417J51691_1091820 3300003544 Bacteria 1250
6 Ga0007409J51694_1031870 3300003575 Bacteria 2080
7 Ga0007409J51694_1032969 3300003575 Bacteria 1126
8 Ga0007409J51694_1052161 3300003575 Bacteria 995
9 Ga0007409J51694_1053772 3300003575 Bacteria 1099
10 Ga0007429J51699_1040602 3300003579 Bacteria 1023
11 Ga0032354_1063500 3300003693 Bacteria 1219
12 Ga0032354_1069067 3300003693 Bacteria 722
13 Ga0058858_1354240 3300004785 Bacteria 605
14 Ga0058859_10078217 3300004798 Bacteria 1081
15 Ga0058859_11612251 3300004798 Bacteria 1379
16 Ga0058859_11648246 3300004798 Bacteria 769
17 Ga0058859_11821524 3300004798 Bacteria 1792
18 Ga0058860_12076241 3300004801 Bacteria 1849
19 Ga0058860_12151635 3300004801 Bacteria 1248
20 Ga0058862_12761160 3300004803 Bacteria 1389
21 Ga0065714_10140032 3300005288 Bacteria 1179
22 Ga0065714_10164056 3300005288 Bacteria 1037
23 Ga0065704_10521653 3300005289 Bacteria 653
24 Ga0065712_10100549 3300005290 Bacteria 2059
25 Ga0065712_10194933 3300005290 Bacteria 1132
26 Ga0065712_10440214 3300005290 Bacteria 689
27 Ga0065712_10568237 3300005290 Bacteria 608
28 Ga0065712_10609869 3300005290 Bacteria 586
29 Ga0065715_10039004 3300005293 Bacteria 1420
30 Ga0065715_10125465 3300005293 Bacteria 2129
31 Ga0065715_10132939 3300005293 Bacteria 1981
32 Ga0065715_10296171 3300005293 Bacteria 1052
33 Ga0065715_10304410 3300005293 Bacteria 1034
34 Ga0065715_10542473 3300005293 Bacteria 747
35 Ga0065715_10654588 3300005293 Bacteria 667
36 Ga0065707_10010029 3300005295 Bacteria 1957
37 Ga0065707_10170476 3300005295 Bacteria 1481
38 Ga0065707_10176849 3300005295 Bacteria 1445
39 Ga0065707_10210811 3300005295 Bacteria 1266
40 Ga0070676_10047950 3300005328 Bacteria 2496
41 Ga0070683_101249213 3300005329 Bacteria 714
42 Ga0070690_100095042 3300005330 Bacteria 1967
43 Ga0070690_100650622 3300005330 Bacteria 805
44 Ga0070690_101010229 3300005330 Bacteria 656
45 Ga0070670_100008026 3300005331 Bacteria 8980
46 Ga0070670_100264235 3300005331 Bacteria 1501
47 Ga0070677_10153583 3300005333 Bacteria 1074
48 Ga0068869_100112063 3300005334 Bacteria 2076
49 Ga0068869_100495068 3300005334 Bacteria 1020
50 Ga0070666_10077464 3300005335 Bacteria 2269
51 Ga0070666_10213140 3300005335 Bacteria 1361
52 Ga0070682_100229651 3300005337 Bacteria 1326
53 Ga0070682_100489123 3300005337 Bacteria 951
54 Ga0068868_100135170 3300005338 Bacteria 2021
55 Ga0068868_100817924 3300005338 Bacteria 842
56 Ga0068868_100979230 3300005338 Bacteria 773
57 Ga0070660_101265254 3300005339 Bacteria 626
58 Ga0070689_100073089 3300005340 Bacteria 2681
59 Ga0070689_100706373 3300005340 Bacteria 881
60 Ga0070689_101620995 3300005340 Bacteria 588
61 Ga0070691_10090805 3300005341 Bacteria 1505
62 Ga0070691_10838513 3300005341 Bacteria 563
63 Ga0070687_100003410 3300005343 Bacteria 6172
64 Ga0070687_100098015 3300005343 Bacteria 1636
65 Ga0070661_100568602 3300005344 Bacteria 914
66 Ga0070668_100112941 3300005347 Bacteria 2164
67 Ga0070668_100381895 3300005347 Bacteria 1199
68 Ga0070668_101628845 3300005347 Bacteria 592
69 Ga0070669_100153767 3300005353 Bacteria 1782
70 Ga0070675_100021926 3300005354 Bacteria 5104
71 Ga0070675_100220767 3300005354 Bacteria 1651
72 Ga0070675_100782382 3300005354 Bacteria 872
73 Ga0070671_100017108 3300005355 Bacteria 5867
74 Ga0070671_100912318 3300005355 Bacteria 768
75 Ga0070674_100025425 3300005356 Bacteria 3855
76 Ga0070674_100067277 3300005356 Bacteria 2519
77 Ga0070674_100859177 3300005356 Bacteria 788
78 Ga0070674_100920269 3300005356 Bacteria 763
79 Ga0070674_101241594 3300005356 Bacteria 663
80 Ga0070673_100003144 3300005364 Bacteria 10228
81 Ga0070673_100696084 3300005364 Bacteria 933
82 Ga0070688_100037306 3300005365 Bacteria 2961
83 Ga0070688_100095976 3300005365 Bacteria 1947
84 Ga0070688_100413762 3300005365 Bacteria 1001
85 Ga0070688_101041006 3300005365 Bacteria 652
86 Ga0070659_100137455 3300005366 Bacteria 1988
87 Ga0070667_100084834 3300005367 Bacteria 2716
88 Ga0070667_100379738 3300005367 Bacteria 1283
89 Ga0070703_10248177 3300005406 Bacteria 721
90 Ga0070701_10082515 3300005438 Bacteria 1743
91 Ga0070701_10105263 3300005438 Bacteria 1569
92 Ga0070705_100064058 3300005440 Bacteria 2195
93 Ga0070705_100081464 3300005440 Bacteria 1989
94 Ga0070700_100003037 3300005441 Bacteria 8602
95 Ga0070694_100425679 3300005444 Bacteria 1044
96 Ga0070663_100222689 3300005455 Bacteria 1482
97 Ga0070663_100634825 3300005455 Bacteria 902
98 Ga0070663_101007442 3300005455 Bacteria 724
99 Ga0070663_101346822 3300005455 Bacteria 631
100 Ga0070663_101869550 3300005455 Bacteria 539
101 Ga0070678_100069414 3300005456 Bacteria 2631
102 Ga0070678_100081002 3300005456 Bacteria 2460
103 Ga0070678_100362920 3300005456 Bacteria 1249
104 Ga0070678_100770322 3300005456 Bacteria 872
105 Ga0070678_100810546 3300005456 Bacteria 851
106 Ga0070678_101238764 3300005456 Bacteria 693
107 Ga0070662_100058509 3300005457 Bacteria 2805
108 Ga0070662_100257171 3300005457 Bacteria 1406
109 Ga0070662_101426746 3300005457 Bacteria 597
110 Ga0068867_100019430 3300005459 Bacteria 4841
111 Ga0068867_100517330 3300005459 Bacteria 1028
112 Ga0070685_10007990 3300005466 Bacteria 5424
113 Ga0070685_10030298 3300005466 Bacteria 3013
114 Ga0070685_11019891 3300005466 Bacteria 622
115 Ga0070706_100149330 3300005467 Bacteria 2182
116 Ga0070707_100112086 3300005468 Bacteria 2646
117 Ga0070707_100534268 3300005468 Bacteria 1135
118 Ga0070698_100016291 3300005471 Bacteria 7847
119 Ga0070699_100943583 3300005518 Bacteria 791
120 Ga0070679_100439315 3300005530 Bacteria 1250
121 Ga0068853_100324177 3300005539 Bacteria 1428
122 Ga0068853_101272984 3300005539 Bacteria 710
123 Ga0070672_100004106 3300005543 Bacteria 9506
124 Ga0070672_100026845 3300005543 Bacteria 4291
125 Ga0070672_100221295 3300005543 Bacteria 1588
126 Ga0070686_100063325 3300005544 Bacteria 2395
127 Ga0070686_100100796 3300005544 Bacteria 1951
128 Ga0070686_100330771 3300005544 Bacteria 1139
129 Ga0070695_100123658 3300005545 Bacteria 1774
130 Ga0070695_100829769 3300005545 Bacteria 742
131 Ga0070696_100188350 3300005546 Bacteria 1534
132 Ga0070693_100032395 3300005547 Bacteria 2874
133 Ga0070665_100011544 3300005548 Bacteria 8928
134 Ga0070665_100423588 3300005548 Bacteria 1340
135 Ga0070704_100238254 3300005549 Bacteria 1488
136 Ga0070704_100246583 3300005549 Bacteria 1465
137 Ga0070664_101426776 3300005564 Bacteria 655
138 Ga0068857_100325672 3300005577 Bacteria 1420
139 Ga0068854_100340657 3300005578 Bacteria 1224
140 Ga0068854_100593305 3300005578 Bacteria 945
141 Ga0070702_100752464 3300005615 Bacteria 748
142 Ga0068852_100070283 3300005616 Bacteria 3071
143 Ga0068852_100612584 3300005616 Bacteria 1094
144 Ga0068859_100017183 3300005617 Bacteria 7264
145 Ga0068859_100118220 3300005617 Bacteria 2716
146 Ga0068859_102146071 3300005617 Bacteria 617
147 Ga0068864_100008780 3300005618 Bacteria 8331
148 Ga0068864_100585496 3300005618 Bacteria 1081
149 Ga0068866_10027692 3300005718 Bacteria 2692
150 Ga0068866_10150305 3300005718 Bacteria 1348
151 Ga0068861_100036988 3300005719 Bacteria 3627
152 Ga0068861_100088854 3300005719 Bacteria 2434
153 Ga0068861_100150935 3300005719 Bacteria 1906
154 Ga0068861_100252026 3300005719 Bacteria 1507
155 Ga0068861_100607630 3300005719 Bacteria 1005
156 Ga0068861_100924608 3300005719 Bacteria 828
157 Ga0068851_10184140 3300005834 Bacteria 1158
158 Ga0068863_100150333 3300005841 Bacteria 2228
159 Ga0068858_100037320 3300005842 Bacteria 4506
160 Ga0068858_100228695 3300005842 Bacteria 1763
161 Ga0068858_101373804 3300005842 Bacteria 696
162 Ga0068860_100047180 3300005843 Bacteria 4106
163 Ga0068862_100114813 3300005844 Bacteria 2367
164 Ga0068862_100182982 3300005844 Bacteria 1882
165 Ga0068862_100215519 3300005844 Bacteria 1736
166 Ga0068862_100902535 3300005844 Bacteria 869
167 Ga0068862_101359882 3300005844 Bacteria 713
168 Ga0075365_10197697 3300006038 Bacteria 1408
169 Ga0075365_10417789 3300006038 Bacteria 947
170 Ga0075368_10052652 3300006042 Bacteria 1620
171 Ga0075363_100389717 3300006048 Bacteria 817
172 Ga0075364_10613132 3300006051 Bacteria 743
173 Ga0075362_10104095 3300006177 Bacteria 1330
174 Ga0075367_10025260 3300006178 Bacteria 3358
175 Ga0075366_10053868 3300006195 Bacteria 2390
176 Ga0075366_10200591 3300006195 Bacteria 1213
177 Ga0097621_100272511 3300006237 Bacteria 1487
178 Ga0097621_101075035 3300006237 Bacteria 754
179 Ga0075370_10144497 3300006353 Bacteria 1392
180 Ga0068871_100032027 3300006358 Bacteria 4149
181 Ga0068871_100234173 3300006358 Bacteria 1595
182 Ga0068871_100502939 3300006358 Bacteria 1092
183 Ga0075428_100099252 3300006844 Bacteria 3175
184 Ga0075430_100364739 3300006846 Bacteria 1193
185 Ga0075431_100801621 3300006847 Bacteria 915
186 Ga0075434_100250966 3300006871 Bacteria 1789
187 Ga0068865_100096453 3300006881 Bacteria 2156
188 Ga0068865_100104137 3300006881 Bacteria 2082
189 Ga0068865_100330562 3300006881 Bacteria 1229
190 Ga0068865_100393950 3300006881 Bacteria 1133
191 Ga0097620_100017183 3300006931 Bacteria 7264
192 Ga0097620_100118230 3300006931 Bacteria 2716
193 Ga0097620_102146207 3300006931 Bacteria 617
194 Ga0075435_100003805 3300007076 Bacteria 10290
195 Ga0075435_100261696 3300007076 Bacteria 1474
196 Ga0105245_10021003 3300009098 Bacteria 5727
197 Ga0105245_10076422 3300009098 Bacteria 3051
198 Ga0105245_10324747 3300009098 Bacteria 1517
199 Ga0114129_10000139 3300009147 Bacteria 75670
200 Ga0114129_10416419 3300009147 Bacteria 1768
201 Ga0114129_11320237 3300009147 Bacteria 893
202 Ga0105243_10014048 3300009148 Bacteria 6060
203 Ga0105243_10063864 3300009148 Bacteria 2952
204 Ga0105243_10276212 3300009148 Bacteria 1511
205 Ga0105241_10135652 3300009174 Bacteria 1998
206 Ga0105241_10330913 3300009174 Bacteria 1316
207 Ga0105242_10273731 3300009176 Bacteria 1530
208 Ga0105242_10360523 3300009176 Bacteria 1345
209 Ga0105242_12838746 3300009176 Bacteria 535
210 Ga0105248_10004840 3300009177 Bacteria 14908
211 Ga0105248_10052035 3300009177 Bacteria 4596
212 Ga0105238_10176571 3300009551 Bacteria 2113
213 Ga0105249_10010250 3300009553 Bacteria 8231
214 Ga0105249_10091765 3300009553 Bacteria 2842
215 Ga0105249_10320435 3300009553 Bacteria 1561
216 Ga0105249_10597217 3300009553 Bacteria 1158
217 Ga0105249_13341219 3300009553 Bacteria 516
218 Ga0105239_10239665 3300010375 Bacteria 2036
219 Ga0105239_11492430 3300010375 Bacteria 781
220 Ga0105246_10123731 3300011119 Bacteria 1921
221 Ga0105246_11534220 3300011119 Bacteria 627
222 Ga0157339_1019807 3300012505 Bacteria 705
223 Ga0157370_10831225 3300013104 Bacteria 840
224 Ga0157374_10040885 3300013296 Bacteria 4271
225 Ga0157374_11836235 3300013296 Bacteria 632
226 Ga0157378_10022956 3300013297 Bacteria 5492
227 Ga0157378_11000694 3300013297 Bacteria 870
228 Ga0163162_10063876 3300013306 Bacteria 3726
229 Ga0163162_10086680 3300013306 Bacteria 3209
230 Ga0163162_10826627 3300013306 Bacteria 1042
231 Ga0157375_10223516 3300013308 Bacteria 2042
232 Ga0163163_10047524 3300014325 Bacteria 4219
233 Ga0157380_10051890 3300014326 Bacteria 3246
234 Ga0157380_10395594 3300014326 Bacteria 1309
235 Ga0157380_11765907 3300014326 Bacteria 677
236 Ga0157379_10118648 3300014968 Bacteria 2380
237 Ga0157379_10333078 3300014968 Bacteria 1387
238 Ga0157376_10145834 3300014969 Bacteria 2129
239 Ga0157376_10187711 3300014969 Bacteria 1893
240 Ga0163161_10003469 3300017792 Bacteria 11049
241 Ga0163161_10384995 3300017792 Bacteria 1122
242 Ga0206352_11326187 3300020078 Bacteria 862
243 Ga0206354_11669749 3300020081 Bacteria 973
244 Ga0207697_10151887 3300025315 Bacteria 1008
245 Ga0207697_10163489 3300025315 Bacteria 971
246 Ga0207697_10176140 3300025315 Bacteria 937
247 Ga0207656_10141679 3300025321 Bacteria 1133
248 Ga0207653_10309484 3300025885 Bacteria 613
249 Ga0207682_10095190 3300025893 Bacteria 1296
250 Ga0207682_10251259 3300025893 Bacteria 823
251 Ga0207642_10156343 3300025899 Bacteria 1219
252 Ga0207642_10528891 3300025899 Bacteria 725
253 Ga0207688_10007795 3300025901 Bacteria 5825
254 Ga0207688_10046184 3300025901 Bacteria 2431
255 Ga0207688_10184399 3300025901 Bacteria 1246
256 Ga0207688_10232135 3300025901 Bacteria 1114
257 Ga0207680_10058631 3300025903 Bacteria 2334
258 Ga0207647_10081165 3300025904 Bacteria 1944
259 Ga0207647_10422816 3300025904 Bacteria 749
260 Ga0207647_10795657 3300025904 Bacteria 509
261 Ga0207645_10045062 3300025907 Bacteria 2820
262 Ga0207645_10048717 3300025907 Bacteria 2706
263 Ga0207645_10091685 3300025907 Bacteria 1954
264 Ga0207645_10246412 3300025907 Bacteria 1181
265 Ga0207684_10186049 3300025910 Bacteria 1791
266 Ga0207654_10061006 3300025911 Bacteria 2205
267 Ga0207662_10001847 3300025918 Bacteria 10407
268 Ga0207662_10348018 3300025918 Bacteria 995
269 Ga0207657_10909286 3300025919 Bacteria 678
270 Ga0207649_10482615 3300025920 Bacteria 940
271 Ga0207646_11302999 3300025922 Bacteria 634
272 Ga0207681_10284317 3300025923 Bacteria 1303
273 Ga0207694_10098122 3300025924 Bacteria 2319
274 Ga0207694_11636159 3300025924 Bacteria 542
275 Ga0207650_10070638 3300025925 Bacteria 2625
276 Ga0207650_10320073 3300025925 Bacteria 1270
277 Ga0207659_10099870 3300025926 Bacteria 2186
278 Ga0207659_10597186 3300025926 Bacteria 941
279 Ga0207687_10045529 3300025927 Bacteria 3033
280 Ga0207687_10222662 3300025927 Bacteria 1486
281 Ga0207687_10502889 3300025927 Bacteria 1012
282 Ga0207644_10110304 3300025931 Bacteria 2079
283 Ga0207644_10401051 3300025931 Bacteria 1121
284 Ga0207690_10037604 3300025932 Bacteria 3144
285 Ga0207690_11727599 3300025932 Bacteria 523
286 Ga0207706_10038419 3300025933 Bacteria 4246
287 Ga0207706_10102842 3300025933 Bacteria 2513
288 Ga0207706_10212458 3300025933 Bacteria 1695
289 Ga0207706_10820265 3300025933 Bacteria 789
290 Ga0207706_11283821 3300025933 Bacteria 605
291 Ga0207709_10151201 3300025935 Bacteria 1608
292 Ga0207709_10265996 3300025935 Bacteria 1260
293 Ga0207709_10304330 3300025935 Bacteria 1187
294 Ga0207709_10575914 3300025935 Bacteria 888
295 Ga0207670_10091036 3300025936 Bacteria 2156
296 Ga0207670_10100901 3300025936 Bacteria 2061
297 Ga0207670_10452716 3300025936 Bacteria 1035
298 Ga0207669_10406055 3300025937 Bacteria 1068
299 Ga0207669_10732266 3300025937 Bacteria 815
300 Ga0207669_11235529 3300025937 Bacteria 633
301 Ga0207669_11913922 3300025937 Bacteria 507
302 Ga0207704_10043080 3300025938 Bacteria 2662
303 Ga0207704_10079700 3300025938 Bacteria 2111
304 Ga0207704_10459929 3300025938 Bacteria 1017
305 Ga0207691_10007479 3300025940 Bacteria 10518
306 Ga0207691_10017538 3300025940 Bacteria 6786
307 Ga0207691_10224340 3300025940 Bacteria 1629
308 Ga0207711_10023170 3300025941 Bacteria 5196
309 Ga0207711_10195113 3300025941 Bacteria 1846
310 Ga0207689_10047275 3300025942 Bacteria 3554
311 Ga0207689_10223201 3300025942 Bacteria 1557
312 Ga0207651_10015626 3300025960 Bacteria 4418
313 Ga0207651_10480263 3300025960 Bacteria 1071
314 Ga0207651_11667763 3300025960 Bacteria 574
315 Ga0207712_10012256 3300025961 Bacteria 5478
316 Ga0207668_10028670 3300025972 Bacteria 3643
317 Ga0207668_10555720 3300025972 Bacteria 995
318 Ga0207668_10741255 3300025972 Bacteria 866
319 Ga0207640_10418101 3300025981 Bacteria 1096
320 Ga0207658_10103748 3300025986 Bacteria 2233
321 Ga0207658_10129223 3300025986 Bacteria 2027
322 Ga0207658_10610861 3300025986 Bacteria 980
323 Ga0207677_10106815 3300026023 Bacteria 2075
324 Ga0207677_10361464 3300026023 Bacteria 1220
325 Ga0207677_11301232 3300026023 Bacteria 668
326 Ga0207703_10095880 3300026035 Bacteria 2503
327 Ga0207703_11412824 3300026035 Bacteria 669
328 Ga0207639_10145679 3300026041 Bacteria 1978
329 Ga0207639_11335464 3300026041 Bacteria 673
330 Ga0207678_10292285 3300026067 Bacteria 1400
331 Ga0207678_10639445 3300026067 Bacteria 934
332 Ga0207678_10977858 3300026067 Bacteria 749
333 Ga0207708_10003613 3300026075 Bacteria 11398
334 Ga0207708_10234582 3300026075 Bacteria 1474
335 Ga0207708_10614068 3300026075 Bacteria 922
336 Ga0207708_10999095 3300026075 Bacteria 727
337 Ga0207702_11302832 3300026078 Bacteria 720
338 Ga0207641_10503529 3300026088 Bacteria 1176
339 Ga0207648_10014592 3300026089 Bacteria 7256
340 Ga0207648_10246406 3300026089 Bacteria 1592
341 Ga0207648_10420549 3300026089 Bacteria 1213
342 Ga0207676_10004985 3300026095 Bacteria 9405
343 Ga0207676_10350507 3300026095 Bacteria 1365
344 Ga0207675_100009516 3300026118 Bacteria 9091
345 Ga0207675_100023315 3300026118 Bacteria 5756
346 Ga0207675_100065480 3300026118 Bacteria 3397
347 Ga0207675_100070596 3300026118 Bacteria 3265
348 Ga0207675_101248303 3300026118 Bacteria 763
349 Ga0207675_102107341 3300026118 Bacteria 580
350 Ga0207683_10034873 3300026121 Bacteria 4376
351 Ga0207683_10048981 3300026121 Bacteria 3698
352 Ga0207683_10077036 3300026121 Bacteria 2953
353 Ga0207683_10242365 3300026121 Bacteria 1645
354 Ga0207683_10272691 3300026121 Bacteria 1546
355 Ga0207683_11004188 3300026121 Bacteria 774
356 Ga0207698_10044868 3300026142 Bacteria 3325
357 Ga0207698_11737222 3300026142 Bacteria 639
358 Ga0207698_11864108 3300026142 Bacteria 616
359 Ga0209970_1019250 3300027614 Bacteria 1150
360 Ga0209971_1014397 3300027682 Bacteria 1875
361 Ga0209813_10059864 3300027866 Bacteria 1213
362 Ga0268266_10104038 3300028379 Bacteria 2506
363 Ga0268266_10444249 3300028379 Bacteria 1232
364 Ga0268265_10122047 3300028380 Bacteria 2148
365 Ga0268265_10125468 3300028380 Bacteria 2123
366 Ga0268265_10356082 3300028380 Bacteria 1338
367 Ga0268264_10124335 3300028381 Bacteria 2277
368 Ga0307408_100013719 3300031548 Bacteria 5379
369 Ga0307408_100363548 3300031548 Bacteria 1232
370 Ga0307408_102402390 3300031548 Bacteria 512
371 Ga0307405_10413761 3300031731 Bacteria 1059
372 Ga0307410_10432460 3300031852 Bacteria 1070
373 Ga0307407_10399324 3300031903 Bacteria 986
374 Ga0307409_100058280 3300031995 Bacteria 2999
375 Ga0307409_101974127 3300031995 Bacteria 613
376 Ga0307416_100047240 3300032002 Bacteria 3406
377 Ga0307416_102242694 3300032002 Bacteria 647
378 Ga0307416_102979478 3300032002 Bacteria 566
379 Ga0307415_100628062 3300032126 Bacteria 960
380 Ga0373930_0039032 3300034816 Bacteria 1005
381 Ga0373948_0182313 3300034817 Bacteria 540
382 Ga0373951_0026085 3300035091 Bacteria 1360
383 Ga0373924_0485561 3300035410 Bacteria 555
384 Ga0373931_0178237 3300035691 Bacteria 1257
385 Ga0395900_1113128 3300037418 Bacteria 707
386 Ga0439431_0056917 3300041997 Bacteria 1023
387 Ga0439433_0095329 3300041999 Bacteria 735
388 Ga0439445_0186649 3300042004 Bacteria 610
389 Ga0439449_0080382 3300042007 Bacteria 1202
390 Ga0439450_087062 3300042008 Bacteria 782
391 Ga0439455_0135255 3300042012 Bacteria 697
392 Ga0439457_083060 3300042014 Bacteria 737
393 Ga0450894_023898 3300042131 Bacteria 832
394 Ga0450896_002274 3300042133 Bacteria 2468
395 Ga0450906_007504 3300042145 Bacteria 2152
396 Ga0450907_047257 3300042146 Bacteria 739
397 Ga0439446_0093659 3300042156 Bacteria 943
398 Ga0439446_0177558 3300042156 Bacteria 711
399 Ga0439435_0112044 3300042436 Bacteria 848
400 Ga0439464_0034536 3300042439 Bacteria 1426
401 Ga0439464_0119046 3300042439 Bacteria 812
402 Ga0439460_0036291 3300042461 Bacteria 1429
403 Ga0439460_0056292 3300042461 Bacteria 1191
404 Ga0439440_0006399 3300042993 Bacteria 2368
405 Ga0495629_0510298 3300046459 Bacteria 810
406 Ga0495641_0425896 3300046461 Bacteria 603
407 Ga0495582_0128305 3300046473 Bacteria 1432
408 Ga0495662_0314872 3300046476 Bacteria 770
409 Ga0495608_0602796 3300046511 Bacteria 659
410 Ga0495586_0127367 3300046535 Bacteria 1425
411 Ga0495586_0797427 3300046535 Bacteria 545
412 Ga0495635_0111350 3300046663 Bacteria 1870
413 Ga0495659_0366561 3300046664 Bacteria 618
414 Ga0495600_0241007 3300046809 Bacteria 1152
415 Ga0495672_0059242 3300047320 Bacteria 2216
416 Ga0496100_0050067 3300048903 Bacteria 2705
417 Ga0496100_0214068 3300048903 Bacteria 1411
418 Ga0496100_0336004 3300048903 Bacteria 1138
419 Ga0496101_0141489 3300048904 Bacteria 1834
420 Ga0496101_0460652 3300048904 Bacteria 1003
421 Ga0496102_0043469 3300048905 Bacteria 4075
422 Ga0496102_0140473 3300048905 Bacteria 2264
423 Ga0496102_0435468 3300048905 Bacteria 1231
424 Ga0496103_0142014 3300048906 Bacteria 1536
425 Ga0496103_0232598 3300048906 Bacteria 1186
426 Ga0496104_0002907 3300048907 Bacteria 14760
427 Ga0496104_0014036 3300048907 Bacteria 7229
428 Ga0496105_0067860 3300048908 Bacteria 2945
429 Ga0496105_0805017 3300048908 Bacteria 714
430 Ga0496106_0036463 3300048909 Bacteria 3679
431 Ga0496106_0168426 3300048909 Bacteria 1735
432 Ga0496106_0294020 3300048909 Bacteria 1302
433 Ga0496107_0210676 3300048910 Bacteria 1445
434 Ga0496107_0212177 3300048910 Bacteria 1440
435 Ga0496107_0634117 3300048910 Bacteria 788
436 Ga0496108_0039843 3300048911 Bacteria 3916
437 Ga0496108_0063231 3300048911 Bacteria 3117
438 Ga0496109_0006497 3300048912 Bacteria 9844
439 Ga0496109_0555391 3300048912 Bacteria 1083
440 Ga0496110_0040148 3300048913 Bacteria 4078
441 Ga0496110_0059214 3300048913 Bacteria 3375
442 Ga0496110_0793080 3300048913 Bacteria 851
443 Ga0496111_0050495 3300048914 Bacteria 3001
444 Ga0496112_0001156 3300048915 Bacteria 19704
445 Ga0496112_0340418 3300048915 Bacteria 1443
446 Ga0496113_0022274 3300048916 Bacteria 4479
447 Ga0496114_0018713 3300048917 Bacteria 5604
448 Ga0496114_0173758 3300048917 Bacteria 1879
449 Ga0496114_0236437 3300048917 Bacteria 1606
450 Ga0496115_0035145 3300048918 Bacteria 3964
451 Ga0501321_011285 3300049537 Bacteria 994
452 Ga0501036_0091379 3300049572 Bacteria 2572
453 Ga0501038_0092374 3300049574 Bacteria 2534
454 Ga0501039_0115546 3300049575 Bacteria 2100
455 Ga0501040_0051383 3300049576 Bacteria 2819
456 Ga0501040_0872824 3300049576 Bacteria 651
457 Ga0501041_0000494 3300049577 Bacteria 20217
458 Ga0501046_0015710 3300049580 Bacteria 6354
459 Ga0501048_0102639 3300049582 Bacteria 2018
460 Ga0501068_0159791 3300049584 Bacteria 1420
461 Ga0501071_0098198 3300049587 Bacteria 2157
462 Ga0501072_0021782 3300049588 Bacteria 4969
463 Ga0501072_1092177 3300049588 Bacteria 621
464 Ga0501074_0030569 3300049590 Bacteria 3903
465 Ga0501075_0076210 3300049591 Bacteria 2536
466 Ga0501075_0163695 3300049591 Bacteria 1697
467 Ga0501076_0003714 3300049592 Bacteria 10735
468 Ga0501076_0481715 3300049592 Bacteria 1022
469 Ga0501077_0084406 3300049593 Bacteria 2013
470 Ga0501217_083366 3300049661 Bacteria 888
471 Ga0501230_041024 3300049667 Bacteria 897
472 Ga0501079_0008501 3300049741 Bacteria 7785
473 Ga0501080_0015423 3300049742 Bacteria 7044
474 Ga0501081_0000754 3300049743 Bacteria 18935
475 Ga0501083_0346380 3300049744 Bacteria 966
476 Ga0501267_025732 3300049764 Bacteria 671
477 Ga0501035_1061488 3300049822 Bacteria 634
478 Ga0501045_0001931 3300049824 Bacteria 14004
479 Ga0501045_1289191 3300049824 Bacteria 532
480 nmdc:mga00v17_222198_c1 3300050491 Bacteria 1223
481 nmdc:mga0yw44_375582_c1 3300050492 Bacteria 959
482 nmdc:mga0k408_25059_c1 3300050493 Bacteria 3376
483 nmdc:mga06z11_320290_c1 3300050494 Bacteria 925
484 nmdc:mga06z11_33562_c1 3300050494 Bacteria 2512
485 nmdc:mga04h51_71477_c1 3300050495 Bacteria 1212
486 nmdc:mga05p37_2107_c3 3300050507 Bacteria 21373
487 nmdc:mga0qj67_373688_c1 3300050509 Bacteria 1151
488 nmdc:mga08y16_769419_c1 3300050511 Bacteria 958
489 nmdc:mga08y16_991805_c1 3300050511 Bacteria 820
490 nmdc:mga0n895_437623_c1 3300050512 Bacteria 1321
491 nmdc:mga0rr50_5937_c1 3300050513 Bacteria 7353
492 Ga0495601_0391467 3300053077 Bacteria 901
493 Ga0500555_003243 3300053103 Bacteria 4633
494 Ga0500616_0008152 3300053153 Bacteria 6542
495 Ga0500645_001705 3300053730 Bacteria 10695
496 Ga0501084_0018849 3300054114 Bacteria 5745
497 Ga0501084_0442239 3300054114 Bacteria 1099
498 Ga0501084_0454487 3300054114 Bacteria 1083
499 Ga0590074_050626 3300059423 Bacteria 760
500 Ga0590075_069168 3300059424 Bacteria 912
501 Ga0587084_008020 3300059477 Bacteria 1326
502 Ga0587084_052799 3300059477 Bacteria 724
503 Ga0587084_068358 3300059477 Bacteria 666
504 Ga0587066_003046 3300059490 Bacteria 1928
505 Ga0587066_010478 3300059490 Bacteria 1338
506 Ga0587070_008120 3300059491 Bacteria 1477
507 Ga0587073_0007520 3300059492 Bacteria 1726
508 Ga0587073_0024633 3300059492 Bacteria 1190
509 Ga0587077_007544 3300059493 Bacteria 1589
510 Ga0587077_008798 3300059493 Bacteria 1514
511 Ga0587080_033841 3300059503 Bacteria 903
512 Ga0587083_0031494 3300059505 Bacteria 1058
513 Ga0587085_013918 3300059506 Bacteria 1127
514 Ga0587085_020031 3300059506 Bacteria 1008
515 Ga0587085_023024 3300059506 Bacteria 965
516 Ga0587086_014264 3300059507 Bacteria 1012
517 Ga0587088_092850 3300059508 Bacteria 663
518 Ga0587090_020740 3300059510 Bacteria 1025
519 Ga0587091_023955 3300059511 Bacteria 1091
520 Ga0587091_044851 3300059511 Bacteria 887
521 Ga0587106_013789 3300059605 Bacteria 1104
522 Ga0587106_020905 3300059605 Bacteria 970
523 Ga0587125_004683 3300059607 Bacteria 1228
524 Ga0587125_028354 3300059607 Bacteria 702
525 Ga0587101_005032 3300059623 Bacteria 1446
526 Ga0587115_006682 3300059626 Bacteria 1339
527 Ga0587127_002553 3300059629 Bacteria 1111
528 Ga0587128_044862 3300059630 Bacteria 787
529 Ga0587128_079754 3300059630 Bacteria 653
530 Ga0587067_032376 3300059640 Bacteria 972
531 Ga0587068_030003 3300059641 Bacteria 938
532 Ga0587068_036498 3300059641 Bacteria 874
533 Ga0587069_072408 3300059642 Bacteria 657
534 Ga0587072_019479 3300059643 Bacteria 1188
535 Ga0587079_009134 3300059647 Bacteria 1535
536 Ga0587079_016766 3300059647 Bacteria 1262
537 Ga0587079_149105 3300059647 Bacteria 603
538 Ga0587107_036624 3300059652 Bacteria 773
539 Ga0587114_051946 3300059655 Bacteria 697
540 Ga0587119_003666 3300059658 Bacteria 1477
541 Ga0587111_0006946 3300060346 Bacteria 1818
542 Ga0587111_0012062 3300060346 Bacteria 1520
543 Ga0587111_0061780 3300060346 Bacteria 854
544 Ga0501082_0001822 3300060353 Bacteria 18778
545 Ga0501082_0352934 3300060353 Bacteria 1282
546 Ga0501082_0439105 3300060353 Bacteria 1140
547 Ga0501082_1319919 3300060353 Bacteria 630
548 Ga0530510_0002248 3300061734 Bacteria 13240
549 Ga0530510_0443945 3300061734 Bacteria 980
550 Ga0587071_019819
551 ARCol0yngRDRAFT_1016573
552 JGI24749J21850_1027849
553 Ga0006770J48903_1068030
554 Ga0007417J51691_1091820
555 Ga0007409J51694_1031870
556 Ga0007409J51694_1032969
557 Ga0007409J51694_1052161
558 Ga0007409J51694_1053772
559 Ga0007429J51699_1040602
560 Ga0032354_1063500
561 Ga0032354_1069067
562 Ga0058858_1354240
563 Ga0058859_10078217
564 Ga0058859_11612251
565 Ga0058859_11648246
566 Ga0058859_11821524
567 Ga0058860_12076241
568 Ga0058860_12151635
569 Ga0058862_12761160
570 Ga0065714_10140032
571 Ga0065714_10164056
572 Ga0065704_10521653
573 Ga0065712_10100549
574 Ga0065712_10194933
575 Ga0065712_10440214
576 Ga0065712_10568237
577 Ga0065712_10609869
578 Ga0065715_10039004
579 Ga0065715_10125465
580 Ga0065715_10132939
581 Ga0065715_10296171
582 Ga0065715_10304410
583 Ga0065715_10542473
584 Ga0065715_10654588
585 Ga0065707_10010029
586 Ga0065707_10170476
587 Ga0065707_10176849
588 Ga0065707_10210811
589 Ga0070676_10047950
590 Ga0070683_101249213
591 Ga0070690_100095042
592 Ga0070690_100650622
593 Ga0070690_101010229
594 Ga0070670_100008026
595 Ga0070670_100264235
596 Ga0070677_10153583
597 Ga0068869_100112063
598 Ga0068869_100495068
599 Ga0070666_10077464
600 Ga0070666_10213140
601 Ga0070682_100229651
602 Ga0070682_100489123
603 Ga0068868_100135170
604 Ga0068868_100817924
605 Ga0068868_100979230
606 Ga0070660_101265254
607 Ga0070689_100073089
608 Ga0070689_100706373
609 Ga0070689_101620995
610 Ga0070691_10090805
611 Ga0070691_10838513
612 Ga0070687_100003410
613 Ga0070687_100098015
614 Ga0070661_100568602
615 Ga0070668_100112941
616 Ga0070668_100381895
617 Ga0070668_101628845
618 Ga0070669_100153767
619 Ga0070675_100021926
620 Ga0070675_100220767
621 Ga0070675_100782382
622 Ga0070671_100017108
623 Ga0070671_100912318
624 Ga0070674_100025425
625 Ga0070674_100067277
626 Ga0070674_100859177
627 Ga0070674_100920269
628 Ga0070674_101241594
629 Ga0070673_100003144
630 Ga0070673_100696084
631 Ga0070688_100037306
632 Ga0070688_100095976
633 Ga0070688_100413762
634 Ga0070688_101041006
635 Ga0070659_100137455
636 Ga0070667_100084834
637 Ga0070667_100379738
638 Ga0070703_10248177
639 Ga0070701_10082515
640 Ga0070701_10105263
641 Ga0070705_100064058
642 Ga0070705_100081464
643 Ga0070700_100003037
644 Ga0070694_100425679
645 Ga0070663_100222689
646 Ga0070663_100634825
647 Ga0070663_101007442
648 Ga0070663_101346822
649 Ga0070663_101869550
650 Ga0070678_100069414
651 Ga0070678_100081002
652 Ga0070678_100362920
653 Ga0070678_100770322
654 Ga0070678_100810546
655 Ga0070678_101238764
656 Ga0070662_100058509
657 Ga0070662_100257171
658 Ga0070662_101426746
659 Ga0068867_100019430
660 Ga0068867_100517330
661 Ga0070685_10007990
662 Ga0070685_10030298
663 Ga0070685_11019891
664 Ga0070706_100149330
665 Ga0070707_100112086
666 Ga0070707_100534268
667 Ga0070698_100016291
668 Ga0070699_100943583
669 Ga0070679_100439315
670 Ga0068853_100324177
671 Ga0068853_101272984
672 Ga0070672_100004106
673 Ga0070672_100026845
674 Ga0070672_100221295
675 Ga0070686_100063325
676 Ga0070686_100100796
677 Ga0070686_100330771
678 Ga0070695_100123658
679 Ga0070695_100829769
680 Ga0070696_100188350
681 Ga0070693_100032395
682 Ga0070665_100011544
683 Ga0070665_100423588
684 Ga0070704_100238254
685 Ga0070704_100246583
686 Ga0070664_101426776
687 Ga0068857_100325672
688 Ga0068854_100340657
689 Ga0068854_100593305
690 Ga0070702_100752464
691 Ga0068852_100070283
692 Ga0068852_100612584
693 Ga0068859_100017183
694 Ga0068859_100118220
695 Ga0068859_102146071
696 Ga0068864_100008780
697 Ga0068864_100585496
698 Ga0068866_10027692
699 Ga0068866_10150305
700 Ga0068861_100036988
701 Ga0068861_100088854
702 Ga0068861_100150935
703 Ga0068861_100252026
704 Ga0068861_100607630
705 Ga0068861_100924608
706 Ga0068851_10184140
707 Ga0068863_100150333
708 Ga0068858_100037320
709 Ga0068858_100228695
710 Ga0068858_101373804
711 Ga0068860_100047180
712 Ga0068862_100114813
713 Ga0068862_100182982
714 Ga0068862_100215519
715 Ga0068862_100902535
716 Ga0068862_101359882
717 Ga0075365_10197697
718 Ga0075365_10417789
719 Ga0075368_10052652
720 Ga0075363_100389717
721 Ga0075364_10613132
722 Ga0075362_10104095
723 Ga0075367_10025260
724 Ga0075366_10053868
725 Ga0075366_10200591
726 Ga0097621_100272511
727 Ga0097621_101075035
728 Ga0075370_10144497
729 Ga0068871_100032027
730 Ga0068871_100234173
731 Ga0068871_100502939
732 Ga0075428_100099252
733 Ga0075430_100364739
734 Ga0075431_100801621
735 Ga0075434_100250966
736 Ga0068865_100096453
737 Ga0068865_100104137
738 Ga0068865_100330562
739 Ga0068865_100393950
740 Ga0097620_100017183
741 Ga0097620_100118230
742 Ga0097620_102146207
743 Ga0075435_100003805
744 Ga0075435_100261696
745 Ga0105245_10021003
746 Ga0105245_10076422
747 Ga0105245_10324747
748 Ga0114129_10000139
749 Ga0114129_10416419
750 Ga0114129_11320237
751 Ga0105243_10014048
752 Ga0105243_10063864
753 Ga0105243_10276212
754 Ga0105241_10135652
755 Ga0105241_10330913
756 Ga0105242_10273731
757 Ga0105242_10360523
758 Ga0105242_12838746
759 Ga0105248_10004840
760 Ga0105248_10052035
761 Ga0105238_10176571
762 Ga0105249_10010250
763 Ga0105249_10091765
764 Ga0105249_10320435
765 Ga0105249_10597217
766 Ga0105249_13341219
767 Ga0105239_10239665
768 Ga0105239_11492430
769 Ga0105246_10123731
770 Ga0105246_11534220
771 Ga0157339_1019807
772 Ga0157370_10831225
773 Ga0157374_10040885
774 Ga0157374_11836235
775 Ga0157378_10022956
776 Ga0157378_11000694
777 Ga0163162_10063876
778 Ga0163162_10086680
779 Ga0163162_10826627
780 Ga0157375_10223516
781 Ga0163163_10047524
782 Ga0157380_10051890
783 Ga0157380_10395594
784 Ga0157380_11765907
785 Ga0157379_10118648
786 Ga0157379_10333078
787 Ga0157376_10145834
788 Ga0157376_10187711
789 Ga0163161_10003469
790 Ga0163161_10384995
791 Ga0206352_11326187
792 Ga0206354_11669749
793 Ga0207697_10151887
794 Ga0207697_10163489
795 Ga0207697_10176140
796 Ga0207656_10141679
797 Ga0207653_10309484
798 Ga0207682_10095190
799 Ga0207682_10251259
800 Ga0207642_10156343
801 Ga0207642_10528891
802 Ga0207688_10007795
803 Ga0207688_10046184
804 Ga0207688_10184399
805 Ga0207688_10232135
806 Ga0207680_10058631
807 Ga0207647_10081165
808 Ga0207647_10422816
809 Ga0207647_10795657
810 Ga0207645_10045062
811 Ga0207645_10048717
812 Ga0207645_10091685
813 Ga0207645_10246412
814 Ga0207684_10186049
815 Ga0207654_10061006
816 Ga0207662_10001847
817 Ga0207662_10348018
818 Ga0207657_10909286
819 Ga0207649_10482615
820 Ga0207646_11302999
821 Ga0207681_10284317
822 Ga0207694_10098122
823 Ga0207694_11636159
824 Ga0207650_10070638
825 Ga0207650_10320073
826 Ga0207659_10099870
827 Ga0207659_10597186
828 Ga0207687_10045529
829 Ga0207687_10222662
830 Ga0207687_10502889
831 Ga0207644_10110304
832 Ga0207644_10401051
833 Ga0207690_10037604
834 Ga0207690_11727599
835 Ga0207706_10038419
836 Ga0207706_10102842
837 Ga0207706_10212458
838 Ga0207706_10820265
839 Ga0207706_11283821
840 Ga0207709_10151201
841 Ga0207709_10265996
842 Ga0207709_10304330
843 Ga0207709_10575914
844 Ga0207670_10091036
845 Ga0207670_10100901
846 Ga0207670_10452716
847 Ga0207669_10406055
848 Ga0207669_10732266
849 Ga0207669_11235529
850 Ga0207669_11913922
851 Ga0207704_10043080
852 Ga0207704_10079700
853 Ga0207704_10459929
854 Ga0207691_10007479
855 Ga0207691_10017538
856 Ga0207691_10224340
857 Ga0207711_10023170
858 Ga0207711_10195113
859 Ga0207689_10047275
860 Ga0207689_10223201
861 Ga0207651_10015626
862 Ga0207651_10480263
863 Ga0207651_11667763
864 Ga0207712_10012256
865 Ga0207668_10028670
866 Ga0207668_10555720
867 Ga0207668_10741255
868 Ga0207640_10418101
869 Ga0207658_10103748
870 Ga0207658_10129223
871 Ga0207658_10610861
872 Ga0207677_10106815
873 Ga0207677_10361464
874 Ga0207677_11301232
875 Ga0207703_10095880
876 Ga0207703_11412824
877 Ga0207639_10145679
878 Ga0207639_11335464
879 Ga0207678_10292285
880 Ga0207678_10639445
881 Ga0207678_10977858
882 Ga0207708_10003613
883 Ga0207708_10234582
884 Ga0207708_10614068
885 Ga0207708_10999095
886 Ga0207702_11302832
887 Ga0207641_10503529
888 Ga0207648_10014592
889 Ga0207648_10246406
890 Ga0207648_10420549
891 Ga0207676_10004985
892 Ga0207676_10350507
893 Ga0207675_100009516
894 Ga0207675_100023315
895 Ga0207675_100065480
896 Ga0207675_100070596
897 Ga0207675_101248303
898 Ga0207675_102107341
899 Ga0207683_10034873
900 Ga0207683_10048981
901 Ga0207683_10077036
902 Ga0207683_10242365
903 Ga0207683_10272691
904 Ga0207683_11004188
905 Ga0207698_10044868
906 Ga0207698_11737222
907 Ga0207698_11864108
908 Ga0209970_1019250
909 Ga0209971_1014397
910 Ga0209813_10059864
911 Ga0268266_10104038
912 Ga0268266_10444249
913 Ga0268265_10122047
914 Ga0268265_10125468
915 Ga0268265_10356082
916 Ga0268264_10124335
917 Ga0307408_100013719
918 Ga0307408_100363548
919 Ga0307408_102402390
920 Ga0307405_10413761
921 Ga0307410_10432460
922 Ga0307407_10399324
923 Ga0307409_100058280
924 Ga0307409_101974127
925 Ga0307416_100047240
926 Ga0307416_102242694
927 Ga0307416_102979478
928 Ga0307415_100628062
929 Ga0373930_0039032
930 Ga0373948_0182313
931 Ga0373951_0026085
932 Ga0373924_0485561
933 Ga0373931_0178237
934 Ga0395900_1113128
935 Ga0439431_0056917
936 Ga0439433_0095329
937 Ga0439445_0186649
938 Ga0439449_0080382
939 Ga0439450_087062
940 Ga0439455_0135255
941 Ga0439457_083060
942 Ga0450894_023898
943 Ga0450896_002274
944 Ga0450906_007504
945 Ga0450907_047257
946 Ga0439446_0093659
947 Ga0439446_0177558
948 Ga0439435_0112044
949 Ga0439464_0034536
950 Ga0439464_0119046
951 Ga0439460_0036291
952 Ga0439460_0056292
953 Ga0439440_0006399
954 Ga0495629_0510298
955 Ga0495641_0425896
956 Ga0495582_0128305
957 Ga0495662_0314872
958 Ga0495608_0602796
959 Ga0495586_0127367
960 Ga0495586_0797427
961 Ga0495635_0111350
962 Ga0495659_0366561
963 Ga0495600_0241007
964 Ga0495672_0059242
965 Ga0496100_0050067
966 Ga0496100_0214068
967 Ga0496100_0336004
968 Ga0496101_0141489
969 Ga0496101_0460652
970 Ga0496102_0043469
971 Ga0496102_0140473
972 Ga0496102_0435468
973 Ga0496103_0142014
974 Ga0496103_0232598
975 Ga0496104_0002907
976 Ga0496104_0014036
977 Ga0496105_0067860
978 Ga0496105_0805017
979 Ga0496106_0036463
980 Ga0496106_0168426
981 Ga0496106_0294020
982 Ga0496107_0210676
983 Ga0496107_0212177
984 Ga0496107_0634117
985 Ga0496108_0039843
986 Ga0496108_0063231
987 Ga0496109_0006497
988 Ga0496109_0555391
989 Ga0496110_0040148
990 Ga0496110_0059214
991 Ga0496110_0793080
992 Ga0496111_0050495
993 Ga0496112_0001156
994 Ga0496112_0340418
995 Ga0496113_0022274
996 Ga0496114_0018713
997 Ga0496114_0173758
998 Ga0496114_0236437
999 Ga0496115_0035145
1000 Ga0501321_011285
1001 Ga0501036_0091379
1002 Ga0501038_0092374
1003 Ga0501039_0115546
1004 Ga0501040_0051383
1005 Ga0501040_0872824
1006 Ga0501041_0000494
1007 Ga0501046_0015710
1008 Ga0501048_0102639
1009 Ga0501068_0159791
1010 Ga0501071_0098198
1011 Ga0501072_0021782
1012 Ga0501072_1092177
1013 Ga0501074_0030569
1014 Ga0501075_0076210
1015 Ga0501075_0163695
1016 Ga0501076_0003714
1017 Ga0501076_0481715
1018 Ga0501077_0084406
1019 Ga0501217_083366
1020 Ga0501230_041024
1021 Ga0501079_0008501
1022 Ga0501080_0015423
1023 Ga0501081_0000754
1024 Ga0501083_0346380
1025 Ga0501267_025732
1026 Ga0501035_1061488
1027 Ga0501045_0001931
1028 Ga0501045_1289191
1029 nmdc:mga00v17_222198_c1
1030 nmdc:mga0yw44_375582_c1
1031 nmdc:mga0k408_25059_c1
1032 nmdc:mga06z11_320290_c1
1033 nmdc:mga06z11_33562_c1
1034 nmdc:mga04h51_71477_c1
1035 nmdc:mga05p37_2107_c3
1036 nmdc:mga0qj67_373688_c1
1037 nmdc:mga08y16_769419_c1
1038 nmdc:mga08y16_991805_c1
1039 nmdc:mga0n895_437623_c1
1040 nmdc:mga0rr50_5937_c1
1041 Ga0495601_0391467
1042 Ga0500555_003243
1043 Ga0500616_0008152
1044 Ga0500645_001705
1045 Ga0501084_0018849
1046 Ga0501084_0442239
1047 Ga0501084_0454487
1048 Ga0590074_050626
1049 Ga0590075_069168
1050 Ga0587084_008020
1051 Ga0587084_052799
1052 Ga0587084_068358
1053 Ga0587066_003046
1054 Ga0587066_010478
1055 Ga0587070_008120
1056 Ga0587073_0007520
1057 Ga0587073_0024633
1058 Ga0587077_007544
1059 Ga0587077_008798
1060 Ga0587080_033841
1061 Ga0587083_0031494
1062 Ga0587085_013918
1063 Ga0587085_020031
1064 Ga0587085_023024
1065 Ga0587086_014264
1066 Ga0587088_092850
1067 Ga0587090_020740
1068 Ga0587091_023955
1069 Ga0587091_044851
1070 Ga0587106_013789
1071 Ga0587106_020905
1072 Ga0587125_004683
1073 Ga0587125_028354
1074 Ga0587101_005032
1075 Ga0587115_006682
1076 Ga0587127_002553
1077 Ga0587128_044862
1078 Ga0587128_079754
1079 Ga0587067_032376
1080 Ga0587068_030003
1081 Ga0587068_036498
1082 Ga0587069_072408
1083 Ga0587072_019479
1084 Ga0587079_009134
1085 Ga0587079_016766
1086 Ga0587079_149105
1087 Ga0587107_036624
1088 Ga0587114_051946
1089 Ga0587119_003666
1090 Ga0587111_0006946
1091 Ga0587111_0012062
1092 Ga0587111_0061780
1093 Ga0501082_0001822
1094 Ga0501082_0352934
1095 Ga0501082_0439105
1096 Ga0501082_1319919
1097 Ga0530510_0002248
1098 Ga0530510_0443945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

27

142

0.94

Map