F462427

General Info

Members Datasets Scaffolds Average Seq Length
549 321 1098 264

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0010089|Ga0500622_0010089_4269_5132
Length 287
Sequence MQTSGGNDPSLLRLDGRIIVVSGAAGGGIGTTVTSIIARAGATVIAVSRSQKNLDQHIGPLVAEGLSIVPVAADASTDEGVALAMDHALRAKGHLYGLVNVAGGAAPSTWMRATRVSRKDWRDLFSQNLETMFFMSQAVAAELKSQQRPGSIVSISSISGMNTAPFHIAYGAAKSAVVAVTRTMAVELAQDNIRVNCIAPGVTKTPASATYIDEDPERDRKAIAMGRRGRPEEQAGAILFLLSDLSSYVTGQTLLVDGGLNLKWTHLGADHTSLFLKDESFRNAILR

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
301 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
302 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
303 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
304 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
309 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
310 2643221692 Nocardia sp. Root136 Isolate Unclassified
311 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
312 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
313 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
314 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
315 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
316 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
317 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
318 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
319 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
320 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
321 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0
Isolates 2.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.84
Nodule 0.18
Rhizoplane 8.2
Rhizosphere 74.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0010089 3300053156 Bacteria 5202
2 JGI24750J21931_1004301 3300002070 Bacteria 1722
3 JGI24744J21845_10003260 3300002077 Bacteria 3332
4 rootH2_10020869 3300003320 Bacteria 10048
5 rootH2_10240050 3300003320 Bacteria 3503
6 Ga0055540_1000003 3300003792 Bacteria 428375
7 Ga0070676_10011380 3300005328 Bacteria 4838
8 Ga0070690_100152703 3300005330 Bacteria 1577
9 Ga0068869_100027651 3300005334 Bacteria 3957
10 Ga0068869_100054776 3300005334 Bacteria 2905
11 Ga0070666_10129643 3300005335 Bacteria 1752
12 Ga0070680_100303129 3300005336 Bacteria 1355
13 Ga0070682_100007137 3300005337 Bacteria 6293
14 Ga0068868_100332781 3300005338 Bacteria 1296
15 Ga0070689_100000990 3300005340 Bacteria 17780
16 Ga0070689_100301076 3300005340 Bacteria 1335
17 Ga0070691_10052347 3300005341 Bacteria 1952
18 Ga0070661_100285534 3300005344 Bacteria 1281
19 Ga0070692_10155281 3300005345 Bacteria 1307
20 Ga0070668_100001103 3300005347 Bacteria 19039
21 Ga0070668_100004737 3300005347 Bacteria 10089
22 Ga0070668_100102201 3300005347 Bacteria 2272
23 Ga0070669_100149911 3300005353 Bacteria 1805
24 Ga0070675_100089014 3300005354 Bacteria 2584
25 Ga0070671_100201817 3300005355 Bacteria 1686
26 Ga0070674_100000673 3300005356 Bacteria 17282
27 Ga0070688_100009576 3300005365 Bacteria 5306
28 Ga0070667_100005689 3300005367 Bacteria 10407
29 Ga0070667_100036471 3300005367 Bacteria 4122
30 Ga0070667_100240920 3300005367 Bacteria 1615
31 Ga0070709_10013105 3300005434 Bacteria 4655
32 Ga0070709_10066516 3300005434 Bacteria 2312
33 Ga0070714_100021929 3300005435 Bacteria 5230
34 Ga0070713_100093850 3300005436 Bacteria 2586
35 Ga0070713_100175143 3300005436 Bacteria 1924
36 Ga0070710_10000303 3300005437 Bacteria 23421
37 Ga0070710_10013562 3300005437 Bacteria 4085
38 Ga0070701_10000604 3300005438 Bacteria 12533
39 Ga0070701_10019687 3300005438 Bacteria 3191
40 Ga0070711_100000758 3300005439 Bacteria 16795
41 Ga0070711_100001858 3300005439 Bacteria 11794
42 Ga0070705_100001345 3300005440 Bacteria 13120
43 Ga0070700_100011274 3300005441 Bacteria 4947
44 Ga0070694_100010661 3300005444 Bacteria 5679
45 Ga0070694_100093293 3300005444 Bacteria 2116
46 Ga0070663_100067249 3300005455 Bacteria 2599
47 Ga0070678_100006667 3300005456 Bacteria 6792
48 Ga0070678_100084253 3300005456 Bacteria 2419
49 Ga0070662_100009886 3300005457 Bacteria 6249
50 Ga0068867_100017975 3300005459 Bacteria 5024
51 Ga0068853_100058405 3300005539 Bacteria 3330
52 Ga0068853_100261735 3300005539 Bacteria 1590
53 Ga0070672_100280322 3300005543 Bacteria 1409
54 Ga0070695_100043008 3300005545 Bacteria 2871
55 Ga0070696_100024245 3300005546 Bacteria 4122
56 Ga0070696_100137216 3300005546 Bacteria 1784
57 Ga0070693_100051027 3300005547 Bacteria 2367
58 Ga0070665_100008504 3300005548 Bacteria 10380
59 Ga0070665_100008641 3300005548 Bacteria 10307
60 Ga0070665_100119610 3300005548 Bacteria 2636
61 Ga0070704_100001663 3300005549 Bacteria 12052
62 Ga0070704_100008698 3300005549 Bacteria 6105
63 Ga0068855_100323266 3300005563 Bacteria 1705
64 Ga0068854_100000552 3300005578 Bacteria 22587
65 Ga0068854_100268132 3300005578 Bacteria 1370
66 Ga0070702_100004440 3300005615 Bacteria 6406
67 Ga0070702_100137818 3300005615 Bacteria 1550
68 Ga0068859_100002195 3300005617 Bacteria 19815
69 Ga0068859_100051147 3300005617 Bacteria 4152
70 Ga0068864_100416557 3300005618 Bacteria 1279
71 Ga0068864_100631142 3300005618 Bacteria 1042
72 Ga0068866_10003327 3300005718 Bacteria 6604
73 Ga0068861_100001676 3300005719 Bacteria 14192
74 Ga0068863_100152284 3300005841 Bacteria 2213
75 Ga0068863_100451641 3300005841 Bacteria 1261
76 Ga0068858_100002942 3300005842 Bacteria 17128
77 Ga0068858_100091216 3300005842 Bacteria 2836
78 Ga0068860_100000144 3300005843 Bacteria 116029
79 Ga0068860_100000694 3300005843 Bacteria 38692
80 Ga0068862_100000140 3300005844 Bacteria 81819
81 Ga0081455_10012394 3300005937 Bacteria 8508
82 Ga0081455_10123365 3300005937 Bacteria 2038
83 Ga0081539_10014020 3300005985 Bacteria 5970
84 Ga0075365_10014255 3300006038 Bacteria 4779
85 Ga0075365_10015398 3300006038 Bacteria 4626
86 Ga0075365_10144802 3300006038 Bacteria 1651
87 Ga0075363_100002591 3300006048 Bacteria 7446
88 Ga0075363_100005200 3300006048 Bacteria 5763
89 Ga0075363_100005542 3300006048 Bacteria 5628
90 Ga0075363_100009833 3300006048 Bacteria 4511
91 Ga0075364_10006695 3300006051 Bacteria 6793
92 Ga0075364_10041629 3300006051 Bacteria 2983
93 Ga0075364_10125332 3300006051 Bacteria 1721
94 Ga0075364_10149165 3300006051 Bacteria 1575
95 Ga0070716_100024502 3300006173 Bacteria 3212
96 Ga0070712_100000640 3300006175 Bacteria 20589
97 Ga0070712_100000757 3300006175 Bacteria 19007
98 Ga0075362_10085729 3300006177 Bacteria 1456
99 Ga0075362_10086214 3300006177 Bacteria 1453
100 Ga0075367_10018230 3300006178 Bacteria 3869
101 Ga0075369_10002687 3300006186 Bacteria 6375
102 Ga0075369_10044096 3300006186 Bacteria 1915
103 Ga0075369_10051082 3300006186 Bacteria 1789
104 Ga0075369_10080351 3300006186 Bacteria 1445
105 Ga0075369_10124459 3300006186 Bacteria 1169
106 Ga0097621_100020162 3300006237 Bacteria 5135
107 Ga0097621_100246281 3300006237 Bacteria 1564
108 Ga0075370_10011090 3300006353 Bacteria 4725
109 Ga0075370_10018411 3300006353 Bacteria 3790
110 Ga0068871_100365539 3300006358 Bacteria 1279
111 Ga0075430_100148097 3300006846 Bacteria 1955
112 Ga0075431_100127562 3300006847 Bacteria 2625
113 Ga0075431_100182451 3300006847 Bacteria 2154
114 Ga0068865_100000497 3300006881 Bacteria 22023
115 Ga0097620_100002195 3300006931 Bacteria 19815
116 Ga0097620_100051148 3300006931 Bacteria 4152
117 Ga0105250_10011105 3300009092 Bacteria 3742
118 Ga0111539_10015593 3300009094 Bacteria 9449
119 Ga0105245_10020509 3300009098 Bacteria 5797
120 Ga0105247_10000028 3300009101 Bacteria 201372
121 Ga0105247_10000541 3300009101 Bacteria 30700
122 Ga0105247_10014961 3300009101 Bacteria 4651
123 Ga0105247_10053485 3300009101 Bacteria 2491
124 Ga0114129_10017983 3300009147 Bacteria 10065
125 Ga0105243_10001274 3300009148 Bacteria 22612
126 Ga0105243_10156736 3300009148 Bacteria 1959
127 Ga0105241_10686771 3300009174 Bacteria 933
128 Ga0105242_10000572 3300009176 Bacteria 29126
129 Ga0105248_10000966 3300009177 Bacteria 32038
130 Ga0105248_10003057 3300009177 Bacteria 18555
131 Ga0105248_10413083 3300009177 Bacteria 1520
132 Ga0105237_10133408 3300009545 Bacteria 2478
133 Ga0105237_10212659 3300009545 Bacteria 1933
134 Ga0105249_10000013 3300009553 Bacteria 283609
135 Ga0105249_10007752 3300009553 Bacteria 9357
136 Ga0105239_10008959 3300010375 Bacteria 11324
137 Ga0157374_10004812 3300013296 Bacteria 11331
138 Ga0157378_10004026 3300013297 Bacteria 12978
139 Ga0157378_10031657 3300013297 Bacteria 4673
140 Ga0163162_10003207 3300013306 Bacteria 15651
141 Ga0163162_10023431 3300013306 Bacteria 6093
142 Ga0163162_10160535 3300013306 Bacteria 2369
143 Ga0163162_10262028 3300013306 Bacteria 1860
144 Ga0157372_10097429 3300013307 Bacteria 3354
145 Ga0157375_10003918 3300013308 Bacteria 12910
146 Ga0157375_10316088 3300013308 Bacteria 1726
147 Ga0157380_10011797 3300014326 Bacteria 6320
148 Ga0157377_10083736 3300014745 Bacteria 1869
149 Ga0157377_10122722 3300014745 Bacteria 1577
150 Ga0163161_10002789 3300017792 Bacteria 12383
151 Ga0163161_10061407 3300017792 Bacteria 2736
152 Ga0163161_10380848 3300017792 Bacteria 1127
153 Ga0213876_10009776 3300021384 Bacteria 5162
154 Ga0213875_10104566 3300021388 Bacteria 1322
155 Ga0209051_1000011 3300025303 Bacteria 610828
156 Ga0209051_1026639 3300025303 Bacteria 2325
157 Ga0207692_10006866 3300025898 Bacteria 4636
158 Ga0207692_10071636 3300025898 Bacteria 1828
159 Ga0207642_10003454 3300025899 Bacteria 4990
160 Ga0207710_10000034 3300025900 Bacteria 256915
161 Ga0207710_10008174 3300025900 Bacteria 4417
162 Ga0207688_10010113 3300025901 Bacteria 5132
163 Ga0207647_10012563 3300025904 Bacteria 5889
164 Ga0207699_10076658 3300025906 Bacteria 2060
165 Ga0207699_10314902 3300025906 Bacteria 1096
166 Ga0207645_10012231 3300025907 Bacteria 5829
167 Ga0207671_10006301 3300025914 Bacteria 10598
168 Ga0207671_10043203 3300025914 Bacteria 3333
169 Ga0207671_10153892 3300025914 Bacteria 1778
170 Ga0207671_10225794 3300025914 Bacteria 1468
171 Ga0207693_10000174 3300025915 Bacteria 58853
172 Ga0207693_10000907 3300025915 Bacteria 26588
173 Ga0207663_10001086 3300025916 Bacteria 12487
174 Ga0207663_10192826 3300025916 Bacteria 1464
175 Ga0207663_10290466 3300025916 Bacteria 1218
176 Ga0207681_10003783 3300025923 Bacteria 9392
177 Ga0207659_10068010 3300025926 Bacteria 2590
178 Ga0207687_10003542 3300025927 Bacteria 10506
179 Ga0207700_10240608 3300025928 Bacteria 1542
180 Ga0207664_10033002 3300025929 Bacteria 3973
181 Ga0207664_10053163 3300025929 Bacteria 3205
182 Ga0207644_10068936 3300025931 Bacteria 2582
183 Ga0207706_10010552 3300025933 Bacteria 8440
184 Ga0207706_10165638 3300025933 Bacteria 1943
185 Ga0207686_10020485 3300025934 Bacteria 3779
186 Ga0207709_10010630 3300025935 Bacteria 5072
187 Ga0207670_10014101 3300025936 Bacteria 4733
188 Ga0207669_10000561 3300025937 Bacteria 16244
189 Ga0207669_10204823 3300025937 Bacteria 1435
190 Ga0207704_10000200 3300025938 Bacteria 30767
191 Ga0207665_10009023 3300025939 Bacteria 6545
192 Ga0207665_10197610 3300025939 Bacteria 1464
193 Ga0207691_10245123 3300025940 Bacteria 1548
194 Ga0207711_10000232 3300025941 Bacteria 59593
195 Ga0207711_10019325 3300025941 Bacteria 5673
196 Ga0207689_10007640 3300025942 Bacteria 9467
197 Ga0207689_10036694 3300025942 Bacteria 4069
198 Ga0207712_10000018 3300025961 Bacteria 317921
199 Ga0207712_10006277 3300025961 Bacteria 7498
200 Ga0207668_10003874 3300025972 Bacteria 8817
201 Ga0207668_10017361 3300025972 Bacteria 4508
202 Ga0207668_10093791 3300025972 Bacteria 2212
203 Ga0207640_10002035 3300025981 Bacteria 10930
204 Ga0207640_10228199 3300025981 Bacteria 1430
205 Ga0207658_10000544 3300025986 Bacteria 34133
206 Ga0207658_10025734 3300025986 Bacteria 4121
207 Ga0207658_10376526 3300025986 Bacteria 1242
208 Ga0207677_10003505 3300026023 Bacteria 8319
209 Ga0207677_10062759 3300026023 Bacteria 2579
210 Ga0207703_10009678 3300026035 Bacteria 7565
211 Ga0207703_10060868 3300026035 Bacteria 3089
212 Ga0207639_10033676 3300026041 Bacteria 3781
213 Ga0207678_10051731 3300026067 Bacteria 3545
214 Ga0207678_10080823 3300026067 Bacteria 2782
215 Ga0207708_10011538 3300026075 Bacteria 6583
216 Ga0207708_10027905 3300026075 Bacteria 4274
217 Ga0207702_10124389 3300026078 Bacteria 2313
218 Ga0207641_10000803 3300026088 Bacteria 33579
219 Ga0207641_10205403 3300026088 Bacteria 1819
220 Ga0207648_10014029 3300026089 Bacteria 7422
221 Ga0207648_10017277 3300026089 Bacteria 6572
222 Ga0207676_10102914 3300026095 Bacteria 2372
223 Ga0207676_10358303 3300026095 Bacteria 1351
224 Ga0207675_100000185 3300026118 Bacteria 56425
225 Ga0207683_10000357 3300026121 Bacteria 41951
226 Ga0207683_10002324 3300026121 Bacteria 16678
227 Ga0207683_10278369 3300026121 Bacteria 1529
228 Ga0207698_10054729 3300026142 Bacteria 3071
229 Ga0207428_10016671 3300027907 Bacteria 6318
230 Ga0268266_10003124 3300028379 Bacteria 16848
231 Ga0268266_10010623 3300028379 Bacteria 8021
232 Ga0268266_10040374 3300028379 Bacteria 3977
233 Ga0268265_10000037 3300028380 Bacteria 202579
234 Ga0268265_10027438 3300028380 Bacteria 4064
235 Ga0268264_10000005 3300028381 Bacteria 934972
236 Ga0268264_10001293 3300028381 Bacteria 23636
237 Ga0268264_10351310 3300028381 Bacteria 1403
238 Ga0265334_10000193 3300028573 Bacteria 35275
239 Ga0307517_10010188 3300028786 Bacteria 13184
240 Ga0307511_10056272 3300030521 Bacteria 3078
241 Ga0265327_10000807 3300031251 Bacteria 47731
242 Ga0265327_10058215 3300031251 Bacteria 1984
243 Ga0307508_10106402 3300031616 Bacteria 2403
244 Ga0307516_10080181 3300031730 Bacteria 3108
245 Ga0307410_10112784 3300031852 Bacteria 1969
246 Ga0307410_10258258 3300031852 Bacteria 1358
247 Ga0307407_10023910 3300031903 Bacteria 3195
248 Ga0307416_100171078 3300032002 Bacteria 2022
249 Ga0307411_10098519 3300032005 Bacteria 2061
250 Ga0307411_10387058 3300032005 Bacteria 1152
251 Ga0307510_10000001 3300033180 Bacteria 1172244
252 Ga0373926_0011866 3300035083 Bacteria 2939
253 Ga0373934_0005826 3300035086 Bacteria 4560
254 Ga0373951_0060081 3300035091 Bacteria 950
255 Ga0373936_0040405 3300035113 Bacteria 1868
256 Ga0373943_0151032 3300035170 Bacteria 1258
257 Ga0373955_0033842 3300035172 Bacteria 2693
258 Ga0373924_0043288 3300035410 Bacteria 1849
259 Ga0373931_0079721 3300035691 Bacteria 1804
260 Ga0373935_0044299 3300035692 Bacteria 2803
261 Ga0373933_0008729 3300035724 Bacteria 5526
262 Ga0373947_0136560 3300035725 Bacteria 1569
263 Ga0373937_0093599 3300036401 Bacteria 2786
264 Ga0373937_0406884 3300036401 Bacteria 1291
265 Ga0316584_0045190 3300036712 Bacteria 3287
266 Ga0373925_0206814 3300037068 Bacteria 1562
267 Ga0436364_0016966 3300037853 Bacteria 2964
268 Ga0436364_1192124 3300037853 Bacteria 1527
269 Ga0436365_0251282 3300039437 Bacteria 7368
270 Ga0436365_0410802 3300039437 Bacteria 48863
271 Ga0436361_0988831 3300039447 Bacteria 2806
272 Ga0436363_1518160 3300039450 Bacteria 3334
273 Ga0439461_0002267 3300041410 Bacteria 3057
274 Ga0439461_0004379 3300041410 Bacteria 2357
275 Ga0439466_0010042 3300041411 Bacteria 3522
276 Ga0439465_0002918 3300041413 Bacteria 5599
277 Ga0439465_0012206 3300041413 Bacteria 2688
278 Ga0439465_0024277 3300041413 Bacteria 1910
279 Ga0439431_0005733 3300041997 Bacteria 2740
280 Ga0439431_0022903 3300041997 Bacteria 1509
281 Ga0439442_001349 3300042002 Bacteria 4857
282 Ga0439445_0044807 3300042004 Bacteria 1182
283 Ga0439448_0019536 3300042005 Bacteria 2087
284 Ga0439434_0028763 3300042435 Bacteria 1684
285 Ga0466972_0006625 3300044658 Bacteria 5814
286 Ga0466972_0041073 3300044658 Bacteria 2252
287 Ga0466972_0055420 3300044658 Bacteria 1907
288 Ga0466972_0058909 3300044658 Bacteria 1843
289 Ga0466972_0081739 3300044658 Bacteria 1538
290 Ga0466972_0101844 3300044658 Bacteria 1359
291 Ga0466965_0019226 3300044683 Bacteria 3280
292 Ga0466965_0085539 3300044683 Bacteria 1598
293 Ga0466966_0011288 3300044684 Bacteria 5928
294 Ga0466966_0015880 3300044684 Bacteria 4977
295 Ga0466966_0084062 3300044684 Bacteria 1980
296 Ga0466961_0002827 3300044693 Bacteria 10795
297 Ga0466961_0143593 3300044693 Bacteria 1493
298 Ga0466963_0104530 3300044694 Bacteria 1941
299 Ga0466971_0005801 3300044719 Bacteria 5373
300 Ga0466968_0018317 3300044735 Bacteria 2808
301 Ga0466970_0047916 3300044765 Bacteria 2278
302 Ga0466970_0067048 3300044765 Bacteria 1927
303 Ga0466970_0067708 3300044765 Bacteria 1917
304 Ga0466957_0002392 3300044842 Bacteria 10072
305 Ga0466957_0008499 3300044842 Bacteria 5842
306 Ga0466957_0011072 3300044842 Bacteria 5191
307 Ga0466957_0537761 3300044842 Bacteria 813
308 Ga0466960_0000871 3300044901 Bacteria 10665
309 Ga0466960_0038730 3300044901 Bacteria 2244
310 Ga0466959_0006257 3300045049 Bacteria 8225
311 Ga0466959_0028687 3300045049 Bacteria 4126
312 Ga0466958_0008315 3300045836 Bacteria 5747
313 Ga0466958_0181871 3300045836 Bacteria 1334
314 Ga0466967_0008697 3300045976 Bacteria 7472
315 Ga0466967_0021892 3300045976 Bacteria 5203
316 Ga0466967_0093206 3300045976 Bacteria 2740
317 Ga0466967_0125808 3300045976 Bacteria 2374
318 Ga0466967_0205953 3300045976 Bacteria 1865
319 Ga0466967_0450153 3300045976 Bacteria 1258
320 Ga0466967_0635031 3300045976 Bacteria 1055
321 Ga0466967_0807626 3300045976 Bacteria 931
322 Ga0495592_0000605 3300046454 Bacteria 25317
323 Ga0495592_0003854 3300046454 Bacteria 10849
324 Ga0495603_0000392 3300046455 Bacteria 24038
325 Ga0495603_0102964 3300046455 Bacteria 1666
326 Ga0495603_0352565 3300046455 Bacteria 844
327 Ga0495629_0023728 3300046459 Bacteria 4369
328 Ga0495629_0345900 3300046459 Bacteria 1015
329 Ga0495638_0002178 3300046460 Bacteria 16423
330 Ga0495638_0356783 3300046460 Bacteria 770
331 Ga0495641_0009500 3300046461 Bacteria 5772
332 Ga0495651_0029818 3300046462 Bacteria 4254
333 Ga0495651_0224138 3300046462 Bacteria 1299
334 Ga0495653_0004186 3300046463 Bacteria 11679
335 Ga0495653_0088675 3300046463 Bacteria 2269
336 Ga0495653_0112008 3300046463 Bacteria 1959
337 Ga0495639_0080432 3300046475 Bacteria 1517
338 Ga0495639_0133491 3300046475 Bacteria 1190
339 Ga0495662_0002142 3300046476 Bacteria 9908
340 Ga0495662_0046107 3300046476 Bacteria 2105
341 Ga0495662_0217181 3300046476 Bacteria 942
342 Ga0495594_0000346 3300046499 Bacteria 23164
343 Ga0495594_0047007 3300046499 Bacteria 2370
344 Ga0495607_0023425 3300046501 Bacteria 3866
345 Ga0495608_0020005 3300046511 Bacteria 4603
346 Ga0495608_0045202 3300046511 Bacteria 2936
347 Ga0495628_0012256 3300046516 Bacteria 7226
348 Ga0495628_0033694 3300046516 Bacteria 4125
349 Ga0495630_0035931 3300046517 Bacteria 3703
350 Ga0495630_0144824 3300046517 Bacteria 1807
351 Ga0495643_0003685 3300046522 Bacteria 11104
352 Ga0495666_0002366 3300046526 Bacteria 9404
353 Ga0495666_0003503 3300046526 Bacteria 7922
354 Ga0495652_0012509 3300046529 Bacteria 7652
355 Ga0495652_0053032 3300046529 Bacteria 3457
356 Ga0495652_0078247 3300046529 Bacteria 2738
357 Ga0495665_0009996 3300046531 Bacteria 5139
358 Ga0495640_0086307 3300046533 Bacteria 2078
359 Ga0495609_0087723 3300046538 Bacteria 1355
360 Ga0495645_0021355 3300046543 Bacteria 4679
361 Ga0495645_0070819 3300046543 Bacteria 2516
362 Ga0495622_0002074 3300046557 Bacteria 9790
363 Ga0495667_0010361 3300046559 Bacteria 6307
364 Ga0495667_0016887 3300046559 Bacteria 4928
365 Ga0495667_0091584 3300046559 Bacteria 1969
366 Ga0495634_0034203 3300046642 Bacteria 3488
367 Ga0495634_0037945 3300046642 Bacteria 3288
368 Ga0495611_0012436 3300046648 Bacteria 3619
369 Ga0495625_0187960 3300046660 Bacteria 1370
370 Ga0495635_0004218 3300046663 Bacteria 9968
371 Ga0495635_0005201 3300046663 Bacteria 9054
372 Ga0495635_0038860 3300046663 Bacteria 3294
373 Ga0495657_0012286 3300046675 Bacteria 6364
374 Ga0495657_0029898 3300046675 Bacteria 3818
375 Ga0495599_0014534 3300046678 Bacteria 4874
376 Ga0495623_0093079 3300046679 Bacteria 1846
377 Ga0495613_0043451 3300046689 Bacteria 3324
378 Ga0495624_0021209 3300046690 Bacteria 4311
379 Ga0495624_0092891 3300046690 Bacteria 1860
380 Ga0495670_0003175 3300046691 Bacteria 8094
381 Ga0495600_0027262 3300046809 Bacteria 3691
382 Ga0495660_0023261 3300046810 Bacteria 3534
383 Ga0495660_0089039 3300046810 Bacteria 1607
384 Ga0495581_0012232 3300047315 Bacteria 4969
385 Ga0495581_0042207 3300047315 Bacteria 2640
386 Ga0495581_0059284 3300047315 Bacteria 2212
387 Ga0495604_0002831 3300047317 Bacteria 13916
388 Ga0495604_0077855 3300047317 Bacteria 2490
389 Ga0495674_0006275 3300047319 Bacteria 11404
390 Ga0495674_0011867 3300047319 Bacteria 8215
391 Ga0495672_0096936 3300047320 Bacteria 1607
392 Ga0495676_0043237 3300047321 Bacteria 3690
393 Ga0495676_0062838 3300047321 Bacteria 2897
394 Ga0495680_0008335 3300047322 Bacteria 9427
395 Ga0495680_0015445 3300047322 Bacteria 6588
396 Ga0495680_0293837 3300047322 Bacteria 1142
397 Ga0495683_0018219 3300047323 Bacteria 3632
398 Ga0495687_040064 3300047443 Bacteria 2067
399 Ga0495675_0030207 3300047444 Bacteria 3458
400 Ga0495685_000806 3300047447 Bacteria 9606
401 Ga0495685_002258 3300047447 Bacteria 6006
402 Ga0495681_0012918 3300047470 Bacteria 4881
403 Ga0495684_0002173 3300047471 Bacteria 15710
404 Ga0495684_0011808 3300047471 Bacteria 6739
405 Ga0495684_0053392 3300047471 Bacteria 3083
406 Ga0495593_0021508 3300047673 Bacteria 3602
407 Ga0495593_0058212 3300047673 Bacteria 2027
408 Ga0495602_0165810 3300048088 Bacteria 1719
409 Ga0496100_0002206 3300048903 Bacteria 9828
410 Ga0496100_0003368 3300048903 Bacteria 8324
411 Ga0496101_0002045 3300048904 Bacteria 12278
412 Ga0496101_0009561 3300048904 Bacteria 6376
413 Ga0496101_0448610 3300048904 Bacteria 1018
414 Ga0496102_0000063 3300048905 Bacteria 164782
415 Ga0496102_0001430 3300048905 Bacteria 21187
416 Ga0496102_0177784 3300048905 Bacteria 2004
417 Ga0496102_0318872 3300048905 Bacteria 1464
418 Ga0496103_0000406 3300048906 Bacteria 38170
419 Ga0496103_0000570 3300048906 Bacteria 29250
420 Ga0496103_0064284 3300048906 Bacteria 2287
421 Ga0496103_0086800 3300048906 Bacteria 1972
422 Ga0496103_0113652 3300048906 Bacteria 1721
423 Ga0496104_0002288 3300048907 Bacteria 16519
424 Ga0496105_0000512 3300048908 Bacteria 25585
425 Ga0496106_0000351 3300048909 Bacteria 32650
426 Ga0496106_0001269 3300048909 Bacteria 18909
427 Ga0496106_0027513 3300048909 Bacteria 4235
428 Ga0496107_0000393 3300048910 Bacteria 23705
429 Ga0496107_0001217 3300048910 Bacteria 15690
430 Ga0496107_0171743 3300048910 Bacteria 1609
431 Ga0496108_0012393 3300048911 Bacteria 6938
432 Ga0496108_0014205 3300048911 Bacteria 6498
433 Ga0496108_0060224 3300048911 Bacteria 3194
434 Ga0496109_0001969 3300048912 Bacteria 17031
435 Ga0496109_0006671 3300048912 Bacteria 9718
436 Ga0496109_0032139 3300048912 Bacteria 4715
437 Ga0496110_0015390 3300048913 Bacteria 6364
438 Ga0496110_0028307 3300048913 Bacteria 4812
439 Ga0496110_0172587 3300048913 Bacteria 1962
440 Ga0496111_0229430 3300048914 Bacteria 1379
441 Ga0496112_0000604 3300048915 Bacteria 24729
442 Ga0496112_0026931 3300048915 Bacteria 5541
443 Ga0496112_0043168 3300048915 Bacteria 4414
444 Ga0496112_0259222 3300048915 Bacteria 1688
445 Ga0496112_0549854 3300048915 Bacteria 1088
446 Ga0496113_0012719 3300048916 Bacteria 5667
447 Ga0496113_0028614 3300048916 Bacteria 4010
448 Ga0496114_0002370 3300048917 Bacteria 14347
449 Ga0496114_0002795 3300048917 Bacteria 13366
450 Ga0496114_0306780 3300048917 Bacteria 1402
451 Ga0496115_0004572 3300048918 Bacteria 10018
452 Ga0496115_0019319 3300048918 Bacteria 5242
453 Ga0496115_0282388 3300048918 Bacteria 1363
454 Ga0496116_0035364 3300048919 Bacteria 3509
455 Ga0496117_0001553 3300048920 Bacteria 32609
456 Ga0496117_0152105 3300048920 Bacteria 1368
457 Ga0496118_0000029 3300048921 Bacteria 340978
458 Ga0496118_0000317 3300048921 Bacteria 83419
459 Ga0496119_0008540 3300048922 Bacteria 8981
460 Ga0496120_0159566 3300048923 Bacteria 1125
461 Ga0496121_0002697 3300048924 Bacteria 26534
462 Ga0496122_0010079 3300048925 Bacteria 9810
463 Ga0496123_0025325 3300048926 Bacteria 4476
464 Ga0496124_0091081 3300048927 Bacteria 2485
465 Ga0496125_0034538 3300048928 Bacteria 4455
466 Ga0496125_0164888 3300048928 Bacteria 1499
467 Ga0496126_0001315 3300048929 Bacteria 39505
468 Ga0496126_0029517 3300048929 Bacteria 5209
469 Ga0496126_0063291 3300048929 Bacteria 3316
470 Ga0501031_0335297 3300049568 Bacteria 979
471 Ga0501032_0170119 3300049569 Bacteria 1429
472 Ga0501034_0005720 3300049571 Bacteria 13516
473 Ga0501034_0008339 3300049571 Bacteria 10963
474 Ga0501034_0294899 3300049571 Bacteria 1559
475 Ga0501034_0346532 3300049571 Bacteria 1415
476 Ga0501037_0000189 3300049573 Bacteria 57204
477 Ga0501038_0007058 3300049574 Bacteria 10370
478 Ga0501042_0145389 3300049578 Bacteria 1709
479 Ga0501043_0001090 3300049579 Bacteria 23858
480 Ga0501043_0146489 3300049579 Bacteria 1849
481 Ga0501046_0001177 3300049580 Bacteria 25444
482 Ga0501046_0174829 3300049580 Bacteria 1609
483 Ga0501047_0003783 3300049581 Bacteria 14248
484 Ga0501047_0008100 3300049581 Bacteria 9915
485 Ga0501048_0008602 3300049582 Bacteria 7708
486 Ga0501067_0026085 3300049583 Bacteria 3239
487 Ga0501069_0027391 3300049585 Bacteria 3123
488 Ga0501070_0000361 3300049586 Bacteria 41441
489 Ga0501070_0004366 3300049586 Bacteria 12150
490 Ga0501073_0059335 3300049589 Bacteria 2673
491 Ga0501073_0114131 3300049589 Bacteria 1873
492 Ga0501074_0187399 3300049590 Bacteria 1475
493 Ga0501079_0395767 3300049741 Bacteria 1083
494 Ga0501083_0198748 3300049744 Bacteria 1308
495 Ga0501035_0000284 3300049822 Bacteria 60210
496 Ga0501035_0004044 3300049822 Bacteria 13970
497 Ga0501035_0015434 3300049822 Bacteria 7046
498 Ga0501035_0354014 3300049822 Bacteria 1228
499 Ga0501044_0000153 3300049823 Bacteria 85673
500 Ga0501044_0003620 3300049823 Bacteria 17384
501 Ga0501044_0370859 3300049823 Bacteria 1348
502 nmdc:mga03n38_15905_c1 3300050490 Bacteria 2916
503 nmdc:mga03n38_23256_c1 3300050490 Bacteria 2518
504 nmdc:mga03n38_25385_c1 3300050490 Bacteria 2433
505 nmdc:mga03n38_88527_c1 3300050490 Bacteria 1469
506 nmdc:mga03n38_98915_c1 3300050490 Bacteria 1404
507 nmdc:mga00v17_109551_c1 3300050491 Bacteria 1751
508 nmdc:mga00v17_113987_c1 3300050491 Bacteria 1717
509 nmdc:mga00v17_38342_c1 3300050491 Bacteria 2865
510 nmdc:mga0yw44_20309_c1 3300050492 Bacteria 3684
511 nmdc:mga0yw44_2592_c1 3300050492 Bacteria 5434
512 nmdc:mga0yw44_351084_c1 3300050492 Bacteria 993
513 nmdc:mga0yw44_85432_c1 3300050492 Bacteria 1985
514 nmdc:mga0k408_73178_c2 3300050493 Bacteria 1341
515 nmdc:mga06z11_15329_c1 3300050494 Bacteria 3418
516 nmdc:mga07m45_2671_c1 3300050496 Bacteria 8407
517 nmdc:mga05p37_16804_c1 3300050507 Bacteria 8821
518 nmdc:mga0qj67_151326_c1 3300050509 Bacteria 1883
519 nmdc:mga08y16_12805_c1 3300050511 Bacteria 8822
520 nmdc:mga08y16_299260_c1 3300050511 Bacteria 1658
521 nmdc:mga0a205_97578_c1 3300050515 Bacteria 2837
522 nmdc:mga0sz30_34595_c1 3300050516 Bacteria 1070
523 nmdc:mga0sz30_4454_c1 3300050516 Bacteria 5062
524 Ga0495601_0012320 3300053077 Bacteria 5129
525 Ga0500578_0272340 3300053086 Bacteria 1012
526 Ga0500643_015409 3300053087 Bacteria 2624
527 Ga0500642_0082539 3300053130 Bacteria 1478
528 Ga0500652_000945 3300053131 Bacteria 9620
529 Ga0500652_007181 3300053131 Bacteria 3631
530 Ga0500559_0165484 3300053136 Bacteria 1040
531 Ga0500561_0000870 3300053137 Bacteria 4839
532 Ga0500600_0002527 3300053149 Bacteria 10304
533 Ga0500616_0039416 3300053153 Bacteria 2547
534 Ga0500634_0007365 3300053161 Bacteria 5421
535 Ga0500645_000006 3300053730 Bacteria 276677
536 Ga0500656_018138 3300053732 Bacteria 848
537 2616693617 2616644814 Bacteria 11555299
538 2644511703 2643221692 Bacteria 7282860
539 2644635433 2643221715 Bacteria 6671032
540 2738666880 2738541264 Bacteria 5935393
541 2738704209 2738541274 Bacteria 6909446
542 2738886894 2738541308 Bacteria 7020677
543 2739145724 2738541356 Bacteria 5935017
544 2739331307 2738543028 Bacteria 6917070
545 2842139657 2842134933 Bacteria 5847019
546 2902804577 2902799365 Bacteria 5419524
547 2902813367 2902810491 Bacteria 6794147
548 2939587896 2939582691 Bacteria 7088898
549 3003006724 3002998708 Bacteria 11715108
550 Ga0500622_0010089
551 JGI24750J21931_1004301
552 JGI24744J21845_10003260
553 rootH2_10020869
554 rootH2_10240050
555 Ga0055540_1000003
556 Ga0070676_10011380
557 Ga0070690_100152703
558 Ga0068869_100027651
559 Ga0068869_100054776
560 Ga0070666_10129643
561 Ga0070680_100303129
562 Ga0070682_100007137
563 Ga0068868_100332781
564 Ga0070689_100000990
565 Ga0070689_100301076
566 Ga0070691_10052347
567 Ga0070661_100285534
568 Ga0070692_10155281
569 Ga0070668_100001103
570 Ga0070668_100004737
571 Ga0070668_100102201
572 Ga0070669_100149911
573 Ga0070675_100089014
574 Ga0070671_100201817
575 Ga0070674_100000673
576 Ga0070688_100009576
577 Ga0070667_100005689
578 Ga0070667_100036471
579 Ga0070667_100240920
580 Ga0070709_10013105
581 Ga0070709_10066516
582 Ga0070714_100021929
583 Ga0070713_100093850
584 Ga0070713_100175143
585 Ga0070710_10000303
586 Ga0070710_10013562
587 Ga0070701_10000604
588 Ga0070701_10019687
589 Ga0070711_100000758
590 Ga0070711_100001858
591 Ga0070705_100001345
592 Ga0070700_100011274
593 Ga0070694_100010661
594 Ga0070694_100093293
595 Ga0070663_100067249
596 Ga0070678_100006667
597 Ga0070678_100084253
598 Ga0070662_100009886
599 Ga0068867_100017975
600 Ga0068853_100058405
601 Ga0068853_100261735
602 Ga0070672_100280322
603 Ga0070695_100043008
604 Ga0070696_100024245
605 Ga0070696_100137216
606 Ga0070693_100051027
607 Ga0070665_100008504
608 Ga0070665_100008641
609 Ga0070665_100119610
610 Ga0070704_100001663
611 Ga0070704_100008698
612 Ga0068855_100323266
613 Ga0068854_100000552
614 Ga0068854_100268132
615 Ga0070702_100004440
616 Ga0070702_100137818
617 Ga0068859_100002195
618 Ga0068859_100051147
619 Ga0068864_100416557
620 Ga0068864_100631142
621 Ga0068866_10003327
622 Ga0068861_100001676
623 Ga0068863_100152284
624 Ga0068863_100451641
625 Ga0068858_100002942
626 Ga0068858_100091216
627 Ga0068860_100000144
628 Ga0068860_100000694
629 Ga0068862_100000140
630 Ga0081455_10012394
631 Ga0081455_10123365
632 Ga0081539_10014020
633 Ga0075365_10014255
634 Ga0075365_10015398
635 Ga0075365_10144802
636 Ga0075363_100002591
637 Ga0075363_100005200
638 Ga0075363_100005542
639 Ga0075363_100009833
640 Ga0075364_10006695
641 Ga0075364_10041629
642 Ga0075364_10125332
643 Ga0075364_10149165
644 Ga0070716_100024502
645 Ga0070712_100000640
646 Ga0070712_100000757
647 Ga0075362_10085729
648 Ga0075362_10086214
649 Ga0075367_10018230
650 Ga0075369_10002687
651 Ga0075369_10044096
652 Ga0075369_10051082
653 Ga0075369_10080351
654 Ga0075369_10124459
655 Ga0097621_100020162
656 Ga0097621_100246281
657 Ga0075370_10011090
658 Ga0075370_10018411
659 Ga0068871_100365539
660 Ga0075430_100148097
661 Ga0075431_100127562
662 Ga0075431_100182451
663 Ga0068865_100000497
664 Ga0097620_100002195
665 Ga0097620_100051148
666 Ga0105250_10011105
667 Ga0111539_10015593
668 Ga0105245_10020509
669 Ga0105247_10000028
670 Ga0105247_10000541
671 Ga0105247_10014961
672 Ga0105247_10053485
673 Ga0114129_10017983
674 Ga0105243_10001274
675 Ga0105243_10156736
676 Ga0105241_10686771
677 Ga0105242_10000572
678 Ga0105248_10000966
679 Ga0105248_10003057
680 Ga0105248_10413083
681 Ga0105237_10133408
682 Ga0105237_10212659
683 Ga0105249_10000013
684 Ga0105249_10007752
685 Ga0105239_10008959
686 Ga0157374_10004812
687 Ga0157378_10004026
688 Ga0157378_10031657
689 Ga0163162_10003207
690 Ga0163162_10023431
691 Ga0163162_10160535
692 Ga0163162_10262028
693 Ga0157372_10097429
694 Ga0157375_10003918
695 Ga0157375_10316088
696 Ga0157380_10011797
697 Ga0157377_10083736
698 Ga0157377_10122722
699 Ga0163161_10002789
700 Ga0163161_10061407
701 Ga0163161_10380848
702 Ga0213876_10009776
703 Ga0213875_10104566
704 Ga0209051_1000011
705 Ga0209051_1026639
706 Ga0207692_10006866
707 Ga0207692_10071636
708 Ga0207642_10003454
709 Ga0207710_10000034
710 Ga0207710_10008174
711 Ga0207688_10010113
712 Ga0207647_10012563
713 Ga0207699_10076658
714 Ga0207699_10314902
715 Ga0207645_10012231
716 Ga0207671_10006301
717 Ga0207671_10043203
718 Ga0207671_10153892
719 Ga0207671_10225794
720 Ga0207693_10000174
721 Ga0207693_10000907
722 Ga0207663_10001086
723 Ga0207663_10192826
724 Ga0207663_10290466
725 Ga0207681_10003783
726 Ga0207659_10068010
727 Ga0207687_10003542
728 Ga0207700_10240608
729 Ga0207664_10033002
730 Ga0207664_10053163
731 Ga0207644_10068936
732 Ga0207706_10010552
733 Ga0207706_10165638
734 Ga0207686_10020485
735 Ga0207709_10010630
736 Ga0207670_10014101
737 Ga0207669_10000561
738 Ga0207669_10204823
739 Ga0207704_10000200
740 Ga0207665_10009023
741 Ga0207665_10197610
742 Ga0207691_10245123
743 Ga0207711_10000232
744 Ga0207711_10019325
745 Ga0207689_10007640
746 Ga0207689_10036694
747 Ga0207712_10000018
748 Ga0207712_10006277
749 Ga0207668_10003874
750 Ga0207668_10017361
751 Ga0207668_10093791
752 Ga0207640_10002035
753 Ga0207640_10228199
754 Ga0207658_10000544
755 Ga0207658_10025734
756 Ga0207658_10376526
757 Ga0207677_10003505
758 Ga0207677_10062759
759 Ga0207703_10009678
760 Ga0207703_10060868
761 Ga0207639_10033676
762 Ga0207678_10051731
763 Ga0207678_10080823
764 Ga0207708_10011538
765 Ga0207708_10027905
766 Ga0207702_10124389
767 Ga0207641_10000803
768 Ga0207641_10205403
769 Ga0207648_10014029
770 Ga0207648_10017277
771 Ga0207676_10102914
772 Ga0207676_10358303
773 Ga0207675_100000185
774 Ga0207683_10000357
775 Ga0207683_10002324
776 Ga0207683_10278369
777 Ga0207698_10054729
778 Ga0207428_10016671
779 Ga0268266_10003124
780 Ga0268266_10010623
781 Ga0268266_10040374
782 Ga0268265_10000037
783 Ga0268265_10027438
784 Ga0268264_10000005
785 Ga0268264_10001293
786 Ga0268264_10351310
787 Ga0265334_10000193
788 Ga0307517_10010188
789 Ga0307511_10056272
790 Ga0265327_10000807
791 Ga0265327_10058215
792 Ga0307508_10106402
793 Ga0307516_10080181
794 Ga0307410_10112784
795 Ga0307410_10258258
796 Ga0307407_10023910
797 Ga0307416_100171078
798 Ga0307411_10098519
799 Ga0307411_10387058
800 Ga0307510_10000001
801 Ga0373926_0011866
802 Ga0373934_0005826
803 Ga0373951_0060081
804 Ga0373936_0040405
805 Ga0373943_0151032
806 Ga0373955_0033842
807 Ga0373924_0043288
808 Ga0373931_0079721
809 Ga0373935_0044299
810 Ga0373933_0008729
811 Ga0373947_0136560
812 Ga0373937_0093599
813 Ga0373937_0406884
814 Ga0316584_0045190
815 Ga0373925_0206814
816 Ga0436364_0016966
817 Ga0436364_1192124
818 Ga0436365_0251282
819 Ga0436365_0410802
820 Ga0436361_0988831
821 Ga0436363_1518160
822 Ga0439461_0002267
823 Ga0439461_0004379
824 Ga0439466_0010042
825 Ga0439465_0002918
826 Ga0439465_0012206
827 Ga0439465_0024277
828 Ga0439431_0005733
829 Ga0439431_0022903
830 Ga0439442_001349
831 Ga0439445_0044807
832 Ga0439448_0019536
833 Ga0439434_0028763
834 Ga0466972_0006625
835 Ga0466972_0041073
836 Ga0466972_0055420
837 Ga0466972_0058909
838 Ga0466972_0081739
839 Ga0466972_0101844
840 Ga0466965_0019226
841 Ga0466965_0085539
842 Ga0466966_0011288
843 Ga0466966_0015880
844 Ga0466966_0084062
845 Ga0466961_0002827
846 Ga0466961_0143593
847 Ga0466963_0104530
848 Ga0466971_0005801
849 Ga0466968_0018317
850 Ga0466970_0047916
851 Ga0466970_0067048
852 Ga0466970_0067708
853 Ga0466957_0002392
854 Ga0466957_0008499
855 Ga0466957_0011072
856 Ga0466957_0537761
857 Ga0466960_0000871
858 Ga0466960_0038730
859 Ga0466959_0006257
860 Ga0466959_0028687
861 Ga0466958_0008315
862 Ga0466958_0181871
863 Ga0466967_0008697
864 Ga0466967_0021892
865 Ga0466967_0093206
866 Ga0466967_0125808
867 Ga0466967_0205953
868 Ga0466967_0450153
869 Ga0466967_0635031
870 Ga0466967_0807626
871 Ga0495592_0000605
872 Ga0495592_0003854
873 Ga0495603_0000392
874 Ga0495603_0102964
875 Ga0495603_0352565
876 Ga0495629_0023728
877 Ga0495629_0345900
878 Ga0495638_0002178
879 Ga0495638_0356783
880 Ga0495641_0009500
881 Ga0495651_0029818
882 Ga0495651_0224138
883 Ga0495653_0004186
884 Ga0495653_0088675
885 Ga0495653_0112008
886 Ga0495639_0080432
887 Ga0495639_0133491
888 Ga0495662_0002142
889 Ga0495662_0046107
890 Ga0495662_0217181
891 Ga0495594_0000346
892 Ga0495594_0047007
893 Ga0495607_0023425
894 Ga0495608_0020005
895 Ga0495608_0045202
896 Ga0495628_0012256
897 Ga0495628_0033694
898 Ga0495630_0035931
899 Ga0495630_0144824
900 Ga0495643_0003685
901 Ga0495666_0002366
902 Ga0495666_0003503
903 Ga0495652_0012509
904 Ga0495652_0053032
905 Ga0495652_0078247
906 Ga0495665_0009996
907 Ga0495640_0086307
908 Ga0495609_0087723
909 Ga0495645_0021355
910 Ga0495645_0070819
911 Ga0495622_0002074
912 Ga0495667_0010361
913 Ga0495667_0016887
914 Ga0495667_0091584
915 Ga0495634_0034203
916 Ga0495634_0037945
917 Ga0495611_0012436
918 Ga0495625_0187960
919 Ga0495635_0004218
920 Ga0495635_0005201
921 Ga0495635_0038860
922 Ga0495657_0012286
923 Ga0495657_0029898
924 Ga0495599_0014534
925 Ga0495623_0093079
926 Ga0495613_0043451
927 Ga0495624_0021209
928 Ga0495624_0092891
929 Ga0495670_0003175
930 Ga0495600_0027262
931 Ga0495660_0023261
932 Ga0495660_0089039
933 Ga0495581_0012232
934 Ga0495581_0042207
935 Ga0495581_0059284
936 Ga0495604_0002831
937 Ga0495604_0077855
938 Ga0495674_0006275
939 Ga0495674_0011867
940 Ga0495672_0096936
941 Ga0495676_0043237
942 Ga0495676_0062838
943 Ga0495680_0008335
944 Ga0495680_0015445
945 Ga0495680_0293837
946 Ga0495683_0018219
947 Ga0495687_040064
948 Ga0495675_0030207
949 Ga0495685_000806
950 Ga0495685_002258
951 Ga0495681_0012918
952 Ga0495684_0002173
953 Ga0495684_0011808
954 Ga0495684_0053392
955 Ga0495593_0021508
956 Ga0495593_0058212
957 Ga0495602_0165810
958 Ga0496100_0002206
959 Ga0496100_0003368
960 Ga0496101_0002045
961 Ga0496101_0009561
962 Ga0496101_0448610
963 Ga0496102_0000063
964 Ga0496102_0001430
965 Ga0496102_0177784
966 Ga0496102_0318872
967 Ga0496103_0000406
968 Ga0496103_0000570
969 Ga0496103_0064284
970 Ga0496103_0086800
971 Ga0496103_0113652
972 Ga0496104_0002288
973 Ga0496105_0000512
974 Ga0496106_0000351
975 Ga0496106_0001269
976 Ga0496106_0027513
977 Ga0496107_0000393
978 Ga0496107_0001217
979 Ga0496107_0171743
980 Ga0496108_0012393
981 Ga0496108_0014205
982 Ga0496108_0060224
983 Ga0496109_0001969
984 Ga0496109_0006671
985 Ga0496109_0032139
986 Ga0496110_0015390
987 Ga0496110_0028307
988 Ga0496110_0172587
989 Ga0496111_0229430
990 Ga0496112_0000604
991 Ga0496112_0026931
992 Ga0496112_0043168
993 Ga0496112_0259222
994 Ga0496112_0549854
995 Ga0496113_0012719
996 Ga0496113_0028614
997 Ga0496114_0002370
998 Ga0496114_0002795
999 Ga0496114_0306780
1000 Ga0496115_0004572
1001 Ga0496115_0019319
1002 Ga0496115_0282388
1003 Ga0496116_0035364
1004 Ga0496117_0001553
1005 Ga0496117_0152105
1006 Ga0496118_0000029
1007 Ga0496118_0000317
1008 Ga0496119_0008540
1009 Ga0496120_0159566
1010 Ga0496121_0002697
1011 Ga0496122_0010079
1012 Ga0496123_0025325
1013 Ga0496124_0091081
1014 Ga0496125_0034538
1015 Ga0496125_0164888
1016 Ga0496126_0001315
1017 Ga0496126_0029517
1018 Ga0496126_0063291
1019 Ga0501031_0335297
1020 Ga0501032_0170119
1021 Ga0501034_0005720
1022 Ga0501034_0008339
1023 Ga0501034_0294899
1024 Ga0501034_0346532
1025 Ga0501037_0000189
1026 Ga0501038_0007058
1027 Ga0501042_0145389
1028 Ga0501043_0001090
1029 Ga0501043_0146489
1030 Ga0501046_0001177
1031 Ga0501046_0174829
1032 Ga0501047_0003783
1033 Ga0501047_0008100
1034 Ga0501048_0008602
1035 Ga0501067_0026085
1036 Ga0501069_0027391
1037 Ga0501070_0000361
1038 Ga0501070_0004366
1039 Ga0501073_0059335
1040 Ga0501073_0114131
1041 Ga0501074_0187399
1042 Ga0501079_0395767
1043 Ga0501083_0198748
1044 Ga0501035_0000284
1045 Ga0501035_0004044
1046 Ga0501035_0015434
1047 Ga0501035_0354014
1048 Ga0501044_0000153
1049 Ga0501044_0003620
1050 Ga0501044_0370859
1051 nmdc:mga03n38_15905_c1
1052 nmdc:mga03n38_23256_c1
1053 nmdc:mga03n38_25385_c1
1054 nmdc:mga03n38_88527_c1
1055 nmdc:mga03n38_98915_c1
1056 nmdc:mga00v17_109551_c1
1057 nmdc:mga00v17_113987_c1
1058 nmdc:mga00v17_38342_c1
1059 nmdc:mga0yw44_20309_c1
1060 nmdc:mga0yw44_2592_c1
1061 nmdc:mga0yw44_351084_c1
1062 nmdc:mga0yw44_85432_c1
1063 nmdc:mga0k408_73178_c2
1064 nmdc:mga06z11_15329_c1
1065 nmdc:mga07m45_2671_c1
1066 nmdc:mga05p37_16804_c1
1067 nmdc:mga0qj67_151326_c1
1068 nmdc:mga08y16_12805_c1
1069 nmdc:mga08y16_299260_c1
1070 nmdc:mga0a205_97578_c1
1071 nmdc:mga0sz30_34595_c1
1072 nmdc:mga0sz30_4454_c1
1073 Ga0495601_0012320
1074 Ga0500578_0272340
1075 Ga0500643_015409
1076 Ga0500642_0082539
1077 Ga0500652_000945
1078 Ga0500652_007181
1079 Ga0500559_0165484
1080 Ga0500561_0000870
1081 Ga0500600_0002527
1082 Ga0500616_0039416
1083 Ga0500634_0007365
1084 Ga0500645_000006
1085 Ga0500656_018138
1086 2616693617
1087 2644511703
1088 2644635433
1089 2738666880
1090 2738704209
1091 2738886894
1092 2739145724
1093 2739331307
1094 2842139657
1095 2902804577
1096 2902813367
1097 2939587896
1098 3003006724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

23

261

0.95

PF00106

adh_short

short chain dehydrogenase

17

216

0.94

PF08659

KR

KR domain

17

205

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9095 6 240
3svt-assembly1.cif.gz_B structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans 0.9047 6 240
4ure-assembly1.cif.gz_A molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 0.9 6 240
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.8976 3 240
3awd-assembly1.cif.gz_D crystal structure of gox2181 0.8953 1 243
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9095 7 183 3.40.50.720
af_Q54PL1_17_278_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9086 6 241 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.906 5 76 3.40.50.720
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9024 1 243 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9021 7 240 3.40.50.720
ID Description Score Start End GO Terms
AF-X7Y7I3-F1-model_v4 deleted 0.9429 6 187
AF-A0A2W4LXE4-F1-model_v4 Short chain dehydrogenase 0.9305 6 138 GO:0016491
AF-A0A1A3S9T7-F1-model_v4 Oxidoreductase 0.9252 2 199 GO:0016491
AF-A0A3A4XSJ3-F1-model_v4 3-oxoacyl-ACP reductase FabG 0.921 5 240 GO:0016616
AF-A0A0J7XM85-F1-model_v4 Short-chain dehydrogenase 0.9204 7 240 GO:0016491

Map