F462356

General Info

Members Datasets Scaffolds Average Seq Length
549 259 549 301

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10538967|Ga0105248_105389671
Length 316
Sequence MTTAAEAAEGARPVARPTSRMRRLKKSRWGRVVARTPFYLLVALIFVYCLFPFYWVLRSSFTPEVKLFQTPVKYIPSPFTLANYREVLSASFFTDALLNSVIVAGSVTLLSLAIGASAAFALGRFRFHGRSFVMYLMLSMTIFPQIAILGALYTMFSGFHIIGPIDFPKLYDTEWALIFSYLIFTLPFTIWVLTGFMRALPADLEEAAYVDGATPLQVFYKVLLPLIAPGLVTTGLLAFIAAWNEYLFALSFIQSPGKYTVPVAITSFTGASGNAFQTPWGQLMAATVVVTVPLIVATLVLQKRILAGLTAGAVKG

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
134 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
158 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
159 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
160 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
164 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
165 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
166 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
167 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
168 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 5.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 18.94
Rhizosphere 77.05
Stem 0
Stem Tuber 0
Unclassified 4.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10144011 3300004799 Bacteria 2680
2 Ga0058861_10083104 3300004800 Bacteria 4067
3 Ga0070676_10094310 3300005328 Bacteria 1839
4 Ga0070683_100011404 3300005329 Bacteria 7683
5 Ga0070683_100181869 3300005329 Bacteria 1996
6 Ga0070683_100530717 3300005329 Bacteria 1125
7 Ga0070680_100015581 3300005336 Bacteria 5966
8 Ga0070682_100130124 3300005337 Bacteria 1702
9 Ga0070691_10010388 3300005341 Bacteria 4245
10 Ga0070668_100017272 3300005347 Bacteria 5401
11 Ga0070668_100167488 3300005347 Bacteria 1787
12 Ga0070674_100041412 3300005356 Bacteria 3122
13 Ga0070667_100314615 3300005367 Bacteria 1412
14 Ga0070709_10068825 3300005434 Bacteria 2278
15 Ga0070709_10338619 3300005434 Bacteria 1108
16 Ga0070714_100007706 3300005435 Bacteria 8387
17 Ga0070714_100052577 3300005435 Bacteria 3474
18 Ga0070714_100575830 3300005435 Bacteria 1080
19 Ga0070713_100018420 3300005436 Bacteria 5306
20 Ga0070713_100165701 3300005436 Bacteria 1976
21 Ga0070713_100209409 3300005436 Bacteria 1764
22 Ga0070713_100240160 3300005436 Bacteria 1649
23 Ga0070713_100429939 3300005436 Bacteria 1237
24 Ga0070710_10063653 3300005437 Bacteria 2107
25 Ga0070701_10115142 3300005438 Bacteria 1507
26 Ga0070711_100034222 3300005439 Bacteria 3388
27 Ga0070705_100019197 3300005440 Bacteria 3595
28 Ga0070705_100024947 3300005440 Bacteria 3234
29 Ga0070705_100164207 3300005440 Bacteria 1488
30 Ga0070694_100020236 3300005444 Bacteria 4240
31 Ga0070694_100184607 3300005444 Bacteria 1545
32 Ga0070708_100022772 3300005445 Bacteria 5319
33 Ga0070708_100080160 3300005445 Bacteria 2954
34 Ga0070708_100104551 3300005445 Bacteria 2597
35 Ga0070708_100108444 3300005445 Bacteria 2550
36 Ga0070708_100386511 3300005445 Bacteria 1320
37 Ga0070663_100012285 3300005455 Bacteria 5411
38 Ga0070678_100012295 3300005456 Bacteria 5314
39 Ga0070678_100036564 3300005456 Bacteria 3439
40 Ga0070678_100282385 3300005456 Bacteria 1404
41 Ga0070662_100193621 3300005457 Bacteria 1609
42 Ga0070681_10005202 3300005458 Bacteria 12561
43 Ga0070681_10009066 3300005458 Bacteria 9781
44 Ga0068867_100054489 3300005459 Bacteria 2955
45 Ga0070706_100039864 3300005467 Bacteria 4335
46 Ga0070706_100079966 3300005467 Bacteria 3026
47 Ga0070706_100093222 3300005467 Bacteria 2794
48 Ga0070706_100436638 3300005467 Bacteria 1219
49 Ga0070707_100006066 3300005468 Bacteria 11272
50 Ga0070698_100086622 3300005471 Bacteria 3118
51 Ga0070698_100372343 3300005471 Bacteria 1360
52 Ga0070699_100042993 3300005518 Bacteria 3911
53 Ga0070699_100043871 3300005518 Bacteria 3871
54 Ga0070699_100053998 3300005518 Bacteria 3477
55 Ga0070679_100010313 3300005530 Bacteria 8857
56 Ga0070679_100078388 3300005530 Bacteria 3292
57 Ga0070679_100427022 3300005530 Bacteria 1270
58 Ga0070684_100013233 3300005535 Bacteria 6646
59 Ga0070684_100015333 3300005535 Bacteria 6238
60 Ga0070697_100108587 3300005536 Bacteria 2310
61 Ga0070697_100249469 3300005536 Bacteria 1518
62 Ga0070695_100018456 3300005545 Bacteria 4236
63 Ga0070696_100002938 3300005546 Bacteria 11317
64 Ga0070696_100010084 3300005546 Bacteria 6322
65 Ga0070696_100098108 3300005546 Bacteria 2096
66 Ga0070696_100116838 3300005546 Bacteria 1927
67 Ga0070693_100003297 3300005547 Bacteria 7498
68 Ga0070693_100122990 3300005547 Bacteria 1612
69 Ga0070693_100190330 3300005547 Bacteria 1326
70 Ga0070704_100116192 3300005549 Bacteria 2046
71 Ga0070704_100260850 3300005549 Bacteria 1427
72 Ga0068855_100403987 3300005563 Bacteria 1496
73 Ga0068857_100112171 3300005577 Bacteria 2451
74 Ga0068854_100194345 3300005578 Bacteria 1591
75 Ga0068856_100004807 3300005614 Bacteria 13391
76 Ga0068856_100032154 3300005614 Bacteria 5136
77 Ga0068856_100229767 3300005614 Bacteria 1870
78 Ga0068861_100000908 3300005719 Bacteria 17963
79 Ga0068863_100454046 3300005841 Bacteria 1258
80 Ga0081455_10018945 3300005937 Bacteria 6526
81 Ga0081455_10033081 3300005937 Bacteria 4650
82 Ga0081455_10143510 3300005937 Bacteria 1851
83 Ga0081540_1012012 3300005983 Bacteria 5736
84 Ga0081540_1016281 3300005983 Bacteria 4660
85 Ga0081540_1033732 3300005983 Bacteria 2774
86 Ga0070717_10007354 3300006028 Bacteria 8176
87 Ga0070717_10024363 3300006028 Bacteria 4805
88 Ga0075432_10002799 3300006058 Bacteria 5853
89 Ga0075432_10056286 3300006058 Bacteria 1394
90 Ga0070715_10027005 3300006163 Bacteria 2289
91 Ga0070715_10051469 3300006163 Bacteria 1772
92 Ga0070716_100053165 3300006173 Bacteria 2308
93 Ga0070716_100216610 3300006173 Bacteria 1283
94 Ga0070712_100035595 3300006175 Bacteria 3380
95 Ga0070712_100041903 3300006175 Bacteria 3146
96 Ga0097621_100020572 3300006237 Bacteria 5086
97 Ga0097621_100163743 3300006237 Bacteria 1913
98 Ga0075428_100036303 3300006844 Bacteria 5429
99 Ga0075428_100218185 3300006844 Bacteria 2060
100 Ga0075431_100074234 3300006847 Bacteria 3509
101 Ga0075431_100213221 3300006847 Bacteria 1972
102 Ga0075431_100240526 3300006847 Bacteria 1842
103 Ga0075433_10031746 3300006852 Bacteria 4517
104 Ga0075433_10038385 3300006852 Bacteria 4136
105 Ga0075434_100033913 3300006871 Bacteria 5040
106 Ga0075434_100054181 3300006871 Bacteria 3985
107 Ga0075434_100099290 3300006871 Bacteria 2917
108 Ga0075434_100242126 3300006871 Bacteria 1824
109 Ga0075429_100220062 3300006880 Bacteria 1663
110 Ga0075436_100004801 3300006914 Bacteria 9284
111 Ga0075436_100015955 3300006914 Bacteria 5141
112 Ga0075436_100027559 3300006914 Bacteria 3909
113 Ga0075436_100086511 3300006914 Bacteria 2177
114 Ga0075435_100012420 3300007076 Bacteria 6306
115 Ga0075435_100024800 3300007076 Bacteria 4660
116 Ga0075435_100035790 3300007076 Bacteria 3941
117 Ga0075435_100062366 3300007076 Bacteria 3025
118 Ga0105244_10130014 3300009036 Bacteria 1215
119 Ga0105250_10057679 3300009092 Bacteria 1558
120 Ga0111539_10031591 3300009094 Bacteria 6432
121 Ga0111539_10039764 3300009094 Bacteria 5666
122 Ga0111539_10109748 3300009094 Bacteria 3238
123 Ga0105245_10056284 3300009098 Bacteria 3534
124 Ga0105245_10067136 3300009098 Bacteria 3248
125 Ga0105245_10100085 3300009098 Bacteria 2681
126 Ga0105245_10471963 3300009098 Bacteria 1266
127 Ga0114129_10024210 3300009147 Bacteria 8603
128 Ga0114129_10100733 3300009147 Bacteria 3997
129 Ga0114129_10265572 3300009147 Bacteria 2298
130 Ga0114129_10489216 3300009147 Bacteria 1608
131 Ga0114129_10805079 3300009147 Bacteria 1198
132 Ga0105243_10057251 3300009148 Bacteria 3103
133 Ga0105243_10074764 3300009148 Bacteria 2748
134 Ga0105243_10241664 3300009148 Bacteria 1607
135 Ga0105243_10444159 3300009148 Bacteria 1215
136 Ga0105243_10456510 3300009148 Bacteria 1200
137 Ga0105241_10016937 3300009174 Bacteria 5349
138 Ga0105241_10044214 3300009174 Bacteria 3375
139 Ga0105241_10061021 3300009174 Bacteria 2902
140 Ga0105241_10105584 3300009174 Bacteria 2247
141 Ga0105242_10111043 3300009176 Bacteria 2337
142 Ga0105242_10148042 3300009176 Bacteria 2044
143 Ga0105242_10158803 3300009176 Bacteria 1977
144 Ga0105242_10490160 3300009176 Bacteria 1167
145 Ga0105248_10247652 3300009177 Bacteria 2006
146 Ga0105248_10319513 3300009177 Bacteria 1749
147 Ga0105248_10538967 3300009177 Bacteria 1316
148 Ga0105238_10136151 3300009551 Bacteria 2434
149 Ga0105249_10011592 3300009553 Bacteria 7747
150 Ga0105249_10521978 3300009553 Bacteria 1235
151 Ga0105239_10210267 3300010375 Bacteria 2181
152 Ga0105239_10626428 3300010375 Bacteria 1228
153 Ga0157338_1003189 3300012515 Bacteria 1343
154 Ga0157373_10227258 3300013100 Bacteria 1317
155 Ga0157369_10277168 3300013105 Bacteria 1747
156 Ga0157374_10017674 3300013296 Bacteria 6284
157 Ga0157374_10442760 3300013296 Bacteria 1300
158 Ga0157374_10679166 3300013296 Bacteria 1042
159 Ga0157378_10039260 3300013297 Bacteria 4198
160 Ga0157378_10044009 3300013297 Bacteria 3963
161 Ga0163162_10042390 3300013306 Bacteria 4555
162 Ga0163162_10548566 3300013306 Bacteria 1284
163 Ga0157375_10170525 3300013308 Bacteria 2323
164 Ga0157375_10421064 3300013308 Bacteria 1501
165 Ga0163163_10588441 3300014325 Bacteria 1176
166 Ga0157380_10065411 3300014326 Bacteria 2922
167 Ga0157380_10280578 3300014326 Bacteria 1524
168 Ga0182008_10118712 3300014497 Bacteria 1313
169 Ga0157376_10157616 3300014969 Bacteria 2054
170 Ga0157376_10206295 3300014969 Bacteria 1812
171 Ga0163161_10235568 3300017792 Bacteria 1422
172 Ga0197907_10146283 3300020069 Bacteria 3065
173 Ga0197907_10236517 3300020069 Bacteria 1145
174 Ga0206349_1288411 3300020075 Bacteria 4093
175 Ga0206351_10214462 3300020077 Bacteria 3298
176 Ga0206352_10683046 3300020078 Bacteria 2447
177 Ga0206350_10904318 3300020080 Bacteria 3775
178 Ga0206350_10978042 3300020080 Bacteria 1136
179 Ga0206350_11038408 3300020080 Bacteria 1289
180 Ga0206354_11144382 3300020081 Bacteria 1899
181 Ga0154015_1400926 3300020610 Bacteria 3014
182 Ga0213876_10000947 3300021384 Bacteria 19100
183 Ga0213876_10018077 3300021384 Bacteria 3720
184 Ga0213876_10049030 3300021384 Bacteria 2231
185 Ga0213876_10211361 3300021384 Bacteria 1031
186 Ga0213875_10004142 3300021388 Bacteria 8035
187 Ga0224712_10074219 3300022467 Bacteria 1389
188 Ga0207653_10004394 3300025885 Bacteria 4424
189 Ga0207692_10007220 3300025898 Bacteria 4541
190 Ga0207692_10035058 3300025898 Bacteria 2435
191 Ga0207688_10020355 3300025901 Bacteria 3622
192 Ga0207699_10016358 3300025906 Bacteria 3878
193 Ga0207699_10082892 3300025906 Bacteria 1993
194 Ga0207699_10176441 3300025906 Bacteria 1433
195 Ga0207684_10072848 3300025910 Bacteria 2917
196 Ga0207684_10319802 3300025910 Bacteria 1337
197 Ga0207684_10507647 3300025910 Bacteria 1033
198 Ga0207654_10045392 3300025911 Bacteria 2500
199 Ga0207654_10058593 3300025911 Bacteria 2243
200 Ga0207707_10004701 3300025912 Bacteria 11981
201 Ga0207707_10027417 3300025912 Bacteria 4982
202 Ga0207693_10011464 3300025915 Bacteria 7170
203 Ga0207693_10014820 3300025915 Bacteria 6264
204 Ga0207693_10047192 3300025915 Bacteria 3385
205 Ga0207663_10010830 3300025916 Bacteria 4869
206 Ga0207663_10025359 3300025916 Bacteria 3427
207 Ga0207663_10038238 3300025916 Bacteria 2899
208 Ga0207663_10048087 3300025916 Bacteria 2638
209 Ga0207663_10094273 3300025916 Bacteria 1994
210 Ga0207660_10014316 3300025917 Bacteria 5213
211 Ga0207662_10193957 3300025918 Bacteria 1312
212 Ga0207657_10044716 3300025919 Bacteria 3891
213 Ga0207657_10070846 3300025919 Bacteria 2953
214 Ga0207652_10008347 3300025921 Bacteria 8330
215 Ga0207646_10006250 3300025922 Bacteria 12362
216 Ga0207646_10025722 3300025922 Bacteria 5383
217 Ga0207687_10004388 3300025927 Bacteria 9415
218 Ga0207687_10251347 3300025927 Bacteria 1406
219 Ga0207700_10000021 3300025928 Bacteria 168335
220 Ga0207700_10052519 3300025928 Bacteria 3048
221 Ga0207700_10209227 3300025928 Bacteria 1648
222 Ga0207700_10341494 3300025928 Bacteria 1302
223 Ga0207664_10047045 3300025929 Bacteria 3388
224 Ga0207664_10241173 3300025929 Bacteria 1574
225 Ga0207664_10300883 3300025929 Bacteria 1411
226 Ga0207664_10316417 3300025929 Bacteria 1376
227 Ga0207690_10313531 3300025932 Bacteria 1231
228 Ga0207706_10005570 3300025933 Bacteria 11737
229 Ga0207709_10045490 3300025935 Bacteria 2658
230 Ga0207709_10060006 3300025935 Bacteria 2370
231 Ga0207709_10195525 3300025935 Bacteria 1440
232 Ga0207670_10211164 3300025936 Bacteria 1480
233 Ga0207704_10228256 3300025938 Bacteria 1383
234 Ga0207665_10002549 3300025939 Bacteria 12242
235 Ga0207665_10234292 3300025939 Bacteria 1350
236 Ga0207661_10004372 3300025944 Bacteria 9903
237 Ga0207661_10033105 3300025944 Bacteria 4009
238 Ga0207661_10117834 3300025944 Bacteria 2256
239 Ga0207661_10211667 3300025944 Bacteria 1709
240 Ga0207679_10019392 3300025945 Bacteria 4567
241 Ga0207667_10074212 3300025949 Bacteria 3534
242 Ga0207712_10189677 3300025961 Bacteria 1622
243 Ga0207712_10266496 3300025961 Bacteria 1391
244 Ga0207668_10013237 3300025972 Bacteria 5073
245 Ga0207668_10020115 3300025972 Bacteria 4234
246 Ga0207677_10261592 3300026023 Bacteria 1411
247 Ga0207678_10036515 3300026067 Bacteria 4277
248 Ga0207678_10504734 3300026067 Bacteria 1055
249 Ga0207708_10027546 3300026075 Bacteria 4303
250 Ga0207702_10031683 3300026078 Bacteria 4407
251 Ga0207641_10244375 3300026088 Bacteria 1674
252 Ga0207648_10217014 3300026089 Bacteria 1699
253 Ga0207674_10003931 3300026116 Bacteria 18096
254 Ga0207675_100002310 3300026118 Bacteria 18939
255 Ga0207675_100084162 3300026118 Bacteria 2985
256 Ga0207683_10003614 3300026121 Bacteria 13463
257 Ga0207683_10052740 3300026121 Bacteria 3564
258 Ga0207683_10330662 3300026121 Bacteria 1397
259 Ga0207428_10001749 3300027907 Bacteria 22235
260 Ga0207428_10033098 3300027907 Bacteria 4247
261 Ga0268264_10290310 3300028381 Bacteria 1536
262 Ga0307408_100527865 3300031548 Bacteria 1038
263 Ga0307405_10170314 3300031731 Bacteria 1553
264 Ga0307416_100160128 3300032002 Bacteria 2079
265 Ga0307416_100177895 3300032002 Bacteria 1990
266 Ga0373958_0001064 3300034819 Bacteria 3597
267 Ga0373959_0011206 3300034820 Bacteria 1579
268 Ga0373938_0000887 3300034957 Bacteria 4809
269 Ga0373926_0029659 3300035083 Bacteria 1924
270 Ga0373949_0006752 3300035090 Bacteria 2519
271 Ga0373951_0003839 3300035091 Bacteria 3617
272 Ga0373952_0015320 3300035092 Bacteria 1547
273 Ga0373932_0001487 3300035112 Bacteria 6544
274 Ga0373939_0001973 3300035114 Bacteria 4905
275 Ga0373960_0039046 3300035121 Bacteria 1363
276 Ga0373943_0004293 3300035170 Bacteria 6468
277 Ga0373946_0040957 3300035171 Bacteria 1898
278 Ga0373931_0130381 3300035691 Bacteria 1446
279 Ga0373927_0116011 3300035695 Bacteria 1746
280 Ga0373947_0000770 3300035725 Bacteria 19222
281 Ga0373925_0073590 3300037068 Bacteria 2586
282 Ga0395899_0001548 3300037312 Bacteria 19416
283 Ga0395899_0003410 3300037312 Bacteria 12613
284 Ga0395899_0007659 3300037312 Bacteria 8325
285 Ga0395900_0002536 3300037418 Bacteria 19999
286 Ga0395900_0003416 3300037418 Bacteria 17167
287 Ga0395900_0011521 3300037418 Bacteria 9052
288 Ga0395900_0017538 3300037418 Bacteria 7306
289 Ga0395900_0023702 3300037418 Bacteria 6279
290 Ga0395900_0034992 3300037418 Bacteria 5172
291 Ga0395900_0059803 3300037418 Bacteria 3922
292 Ga0395898_0002136 3300037466 Bacteria 24363
293 Ga0395898_0002255 3300037466 Bacteria 23396
294 Ga0395898_0016493 3300037466 Bacteria 7555
295 Ga0395898_0019665 3300037466 Bacteria 6869
296 Ga0395898_0074879 3300037466 Bacteria 3270
297 Ga0395898_0175116 3300037466 Bacteria 2051
298 Ga0395898_0234420 3300037466 Bacteria 1750
299 Ga0395898_0493688 3300037466 Bacteria 1164
300 Ga0395905_0001065 3300037471 Bacteria 34603
301 Ga0395905_0008734 3300037471 Bacteria 9967
302 Ga0395905_0020525 3300037471 Bacteria 6257
303 Ga0395905_0043890 3300037471 Bacteria 4195
304 Ga0395905_0159686 3300037471 Bacteria 2119
305 Ga0395905_0171612 3300037471 Bacteria 2037
306 Ga0395905_0203044 3300037471 Bacteria 1858
307 Ga0436364_0352138 3300037853 Bacteria 4839
308 Ga0436364_0647061 3300037853 Bacteria 8143
309 Ga0436364_1012180 3300037853 Bacteria 2280
310 Ga0395901_0001772 3300038443 Bacteria 22259
311 Ga0395901_0006400 3300038443 Bacteria 11930
312 Ga0395901_0011456 3300038443 Bacteria 8985
313 Ga0395901_0016350 3300038443 Bacteria 7555
314 Ga0395901_0041838 3300038443 Bacteria 4749
315 Ga0395901_0112054 3300038443 Bacteria 2865
316 Ga0395901_0253704 3300038443 Bacteria 1832
317 Ga0395901_0257454 3300038443 Bacteria 1817
318 Ga0436365_0729348 3300039437 Bacteria 25618
319 Ga0436365_0759186 3300039437 Bacteria 1752
320 Ga0436365_0835497 3300039437 Bacteria 5120
321 Ga0436365_1125661 3300039437 Bacteria 17642
322 Ga0436365_1526089 3300039437 Bacteria 2288
323 Ga0436363_0041336 3300039450 Unclassified 1339
324 Ga0451789_0273498 3300041443 Bacteria 4000
325 Ga0451791_1203094 3300041451 Bacteria 1413
326 Ga0451793_0594840 3300041452 Bacteria 1979
327 Ga0451798_0122293 3300041458 Bacteria 1962
328 Ga0451802_0643303 3300041460 Bacteria 4412
329 Ga0451807_1019500 3300041486 Bacteria 1236
330 Ga0451807_1103478 3300041486 Bacteria 1340
331 Ga0451833_0940987 3300041491 Bacteria 2043
332 Ga0451839_0600587 3300041496 Bacteria 1372
333 Ga0451845_0124247 3300041501 Bacteria 2970
334 Ga0451847_0700854 3300041503 Bacteria 2267
335 Ga0451849_0038419 3300041505 Bacteria 1487
336 Ga0451855_1300520 3300041511 Bacteria 4273
337 Ga0451853_1902749 3300041512 Bacteria 2023
338 Ga0451853_3143072 3300041512 Bacteria 2143
339 Ga0439448_0050006 3300042005 Bacteria 1367
340 Ga0466963_0007073 3300044694 Bacteria 6682
341 Ga0466964_0000226 3300044706 Bacteria 16122
342 Ga0466960_0000753 3300044901 Bacteria 11392
343 Ga0466960_0028905 3300044901 Bacteria 2540
344 Ga0466958_0004006 3300045836 Bacteria 7725
345 Ga0466967_0000582 3300045976 Bacteria 18029
346 Ga0466967_0010345 3300045976 Bacteria 6992
347 Ga0495603_0003177 3300046455 Bacteria 9770
348 Ga0495641_0000786 3300046461 Bacteria 26874
349 Ga0495641_0136245 3300046461 Bacteria 1096
350 Ga0495580_0084925 3300046472 Bacteria 2205
351 Ga0495582_0002921 3300046473 Bacteria 9552
352 Ga0495582_0089192 3300046473 Bacteria 1718
353 Ga0495582_0150487 3300046473 Bacteria 1321
354 Ga0495639_0083324 3300046475 Bacteria 1492
355 Ga0495664_0068073 3300046477 Bacteria 2125
356 Ga0495585_0180161 3300046492 Bacteria 1087
357 Ga0495594_0006926 3300046499 Bacteria 5831
358 Ga0495594_0143700 3300046499 Bacteria 1354
359 Ga0495630_0024407 3300046517 Bacteria 4471
360 Ga0495630_0036936 3300046517 Bacteria 3652
361 Ga0495630_0200270 3300046517 Bacteria 1524
362 Ga0495666_0039245 3300046526 Bacteria 2300
363 Ga0495665_0067091 3300046531 Bacteria 1893
364 Ga0495586_0033836 3300046535 Bacteria 2743
365 Ga0495587_0102496 3300046536 Bacteria 1648
366 Ga0495667_0075462 3300046559 Bacteria 2194
367 Ga0495634_0028103 3300046642 Bacteria 3907
368 Ga0495611_0156532 3300046648 Bacteria 1064
369 Ga0495588_0000409 3300046674 Bacteria 23658
370 Ga0495588_0068562 3300046674 Bacteria 1843
371 Ga0495658_0007549 3300046683 Bacteria 5390
372 Ga0495658_0081353 3300046683 Bacteria 1902
373 Ga0495658_0201099 3300046683 Bacteria 1242
374 Ga0495613_0287672 3300046689 Bacteria 1140
375 Ga0495624_0072218 3300046690 Bacteria 2147
376 Ga0495589_0045181 3300046794 Bacteria 2189
377 Ga0495660_0049613 3300046810 Bacteria 2290
378 Ga0495604_0065989 3300047317 Bacteria 2754
379 Ga0495636_0128137 3300047318 Bacteria 1127
380 Ga0495674_0099989 3300047319 Bacteria 2468
381 Ga0495676_0003790 3300047321 Bacteria 13744
382 Ga0495676_0187420 3300047321 Bacteria 1445
383 Ga0496100_0004617 3300048903 Bacteria 7321
384 Ga0496100_0007158 3300048903 Bacteria 6130
385 Ga0496100_0023638 3300048903 Bacteria 3737
386 Ga0496100_0108469 3300048903 Bacteria 1925
387 Ga0496100_0179960 3300048903 Bacteria 1528
388 Ga0496101_0000693 3300048904 Bacteria 20313
389 Ga0496101_0002775 3300048904 Bacteria 10745
390 Ga0496101_0022405 3300048904 Bacteria 4348
391 Ga0496101_0041842 3300048904 Bacteria 3269
392 Ga0496101_0072002 3300048904 Bacteria 2536
393 Ga0496101_0204217 3300048904 Bacteria 1528
394 Ga0496102_0001895 3300048905 Bacteria 18038
395 Ga0496102_0014246 3300048905 Bacteria 6908
396 Ga0496102_0020208 3300048905 Bacteria 5882
397 Ga0496102_0047172 3300048905 Bacteria 3913
398 Ga0496102_0092736 3300048905 Bacteria 2797
399 Ga0496102_0113008 3300048905 Bacteria 2533
400 Ga0496103_0002705 3300048906 Bacteria 11061
401 Ga0496103_0026182 3300048906 Bacteria 3531
402 Ga0496103_0073038 3300048906 Bacteria 2149
403 Ga0496103_0087629 3300048906 Bacteria 1962
404 Ga0496104_0003324 3300048907 Bacteria 13881
405 Ga0496104_0005986 3300048907 Bacteria 10655
406 Ga0496104_0008544 3300048907 Bacteria 9103
407 Ga0496104_0075725 3300048907 Bacteria 3204
408 Ga0496104_0127880 3300048907 Bacteria 2439
409 Ga0496104_0226841 3300048907 Bacteria 1780
410 Ga0496104_0330386 3300048907 Bacteria 1438
411 Ga0496105_0002977 3300048908 Bacteria 12447
412 Ga0496105_0004578 3300048908 Bacteria 10420
413 Ga0496105_0005614 3300048908 Bacteria 9540
414 Ga0496105_0026421 3300048908 Bacteria 4734
415 Ga0496105_0081858 3300048908 Bacteria 2666
416 Ga0496105_0184951 3300048908 Bacteria 1705
417 Ga0496106_0021833 3300048909 Bacteria 4754
418 Ga0496106_0031401 3300048909 Bacteria 3958
419 Ga0496106_0043233 3300048909 Bacteria 3380
420 Ga0496106_0046868 3300048909 Bacteria 3251
421 Ga0496106_0179309 3300048909 Bacteria 1681
422 Ga0496106_0231933 3300048909 Archaea 1474
423 Ga0496107_0008377 3300048910 Bacteria 7152
424 Ga0496107_0015713 3300048910 Bacteria 5307
425 Ga0496107_0100876 3300048910 Bacteria 2116
426 Ga0496108_0003471 3300048911 Bacteria 12645
427 Ga0496108_0005479 3300048911 Bacteria 10263
428 Ga0496108_0007986 3300048911 Bacteria 8581
429 Ga0496108_0017582 3300048911 Bacteria 5850
430 Ga0496108_0044047 3300048911 Bacteria 3727
431 Ga0496108_0127479 3300048911 Bacteria 2186
432 Ga0496108_0139256 3300048911 Bacteria 2090
433 Ga0496108_0191138 3300048911 Bacteria 1774
434 Ga0496109_0001336 3300048912 Bacteria 20366
435 Ga0496109_0005025 3300048912 Bacteria 11050
436 Ga0496109_0007036 3300048912 Bacteria 9492
437 Ga0496109_0010195 3300048912 Bacteria 8021
438 Ga0496109_0021057 3300048912 Bacteria 5765
439 Ga0496109_0046000 3300048912 Bacteria 3962
440 Ga0496109_0049707 3300048912 Bacteria 3818
441 Ga0496109_0166944 3300048912 Bacteria 2064
442 Ga0496109_0432291 3300048912 Bacteria 1243
443 Ga0496110_0003580 3300048913 Bacteria 11935
444 Ga0496110_0038536 3300048913 Bacteria 4159
445 Ga0496110_0058128 3300048913 Bacteria 3406
446 Ga0496110_0076559 3300048913 Bacteria 2975
447 Ga0496110_0153515 3300048913 Bacteria 2085
448 Ga0496110_0338418 3300048913 Bacteria 1371
449 Ga0496111_0019129 3300048914 Bacteria 4753
450 Ga0496111_0023260 3300048914 Bacteria 4350
451 Ga0496111_0025684 3300048914 Bacteria 4156
452 Ga0496111_0029993 3300048914 Bacteria 3866
453 Ga0496111_0060666 3300048914 Bacteria 2741
454 Ga0496111_0075042 3300048914 Bacteria 2464
455 Ga0496111_0075488 3300048914 Bacteria 2456
456 Ga0496111_0076299 3300048914 Bacteria 2443
457 Ga0496111_0084188 3300048914 Bacteria 2324
458 Ga0496111_0085054 3300048914 Bacteria 2312
459 Ga0496111_0236005 3300048914 Bacteria 1358
460 Ga0496112_0040014 3300048915 Bacteria 4583
461 Ga0496112_0054583 3300048915 Bacteria 3926
462 Ga0496112_0076357 3300048915 Bacteria 3313
463 Ga0496112_0171515 3300048915 Bacteria 2134
464 Ga0496113_0000346 3300048916 Bacteria 22110
465 Ga0496113_0002890 3300048916 Bacteria 10113
466 Ga0496113_0009805 3300048916 Bacteria 6301
467 Ga0496113_0076705 3300048916 Bacteria 2554
468 Ga0496113_0216998 3300048916 Bacteria 1524
469 Ga0496114_0001899 3300048917 Bacteria 15893
470 Ga0496114_0002596 3300048917 Bacteria 13791
471 Ga0496114_0114798 3300048917 Bacteria 2310
472 Ga0496114_0137640 3300048917 Bacteria 2112
473 Ga0496114_0140314 3300048917 Bacteria 2092
474 Ga0496114_0143830 3300048917 Bacteria 2066
475 Ga0496115_0001634 3300048918 Bacteria 16139
476 Ga0496115_0006018 3300048918 Bacteria 8857
477 Ga0496115_0010948 3300048918 Bacteria 6791
478 Ga0496115_0015102 3300048918 Bacteria 5851
479 Ga0496115_0046551 3300048918 Bacteria 3467
480 Ga0501031_0145163 3300049568 Bacteria 1550
481 Ga0501032_0186176 3300049569 Bacteria 1358
482 Ga0501033_0363526 3300049570 Bacteria 1012
483 Ga0501036_0145862 3300049572 Bacteria 1996
484 Ga0501036_0227001 3300049572 Bacteria 1567
485 Ga0501039_0041078 3300049575 Bacteria 3571
486 Ga0501040_0025556 3300049576 Bacteria 3971
487 Ga0501040_0122981 3300049576 Bacteria 1821
488 Ga0501041_0006034 3300049577 Bacteria 7088
489 Ga0501042_0044659 3300049578 Bacteria 3157
490 Ga0501043_0086705 3300049579 Bacteria 2460
491 Ga0501046_0005954 3300049580 Bacteria 10858
492 Ga0501048_0058027 3300049582 Bacteria 2744
493 Ga0501067_0004758 3300049583 Bacteria 7517
494 Ga0501069_0000850 3300049585 Bacteria 14463
495 Ga0501071_0087137 3300049587 Bacteria 2290
496 Ga0501072_0002123 3300049588 Bacteria 14774
497 Ga0501072_0100053 3300049588 Bacteria 2304
498 Ga0501074_0142605 3300049590 Bacteria 1713
499 Ga0501075_0037652 3300049591 Bacteria 3614
500 Ga0501076_0008642 3300049592 Bacteria 7474
501 Ga0501077_0123441 3300049593 Bacteria 1641
502 Ga0501080_0287631 3300049742 Bacteria 1493
503 Ga0501081_0008682 3300049743 Bacteria 6604
504 Ga0501045_0029366 3300049824 Bacteria 3974
505 Ga0501045_0088032 3300049824 Bacteria 2293
506 nmdc:mga05p37_27560_c1 3300050507 Bacteria 6917
507 nmdc:mga06r32_42841_c1 3300050510 Bacteria 4306
508 nmdc:mga06r32_63939_c1 3300050510 Bacteria 3548
509 nmdc:mga08y16_52186_c1 3300050511 Bacteria 4279
510 nmdc:mga08y16_52675_c1 3300050511 Bacteria 4258
511 nmdc:mga0n895_19753_c1 3300050512 Bacteria 6268
512 nmdc:mga0n895_43505_c1 3300050512 Bacteria 4376
513 nmdc:mga0n895_45214_c1 3300050512 Bacteria 4296
514 nmdc:mga0n895_599201_c1 3300050512 Bacteria 1104
515 nmdc:mga0n895_74174_c1 3300050512 Bacteria 3379
516 nmdc:mga0rr50_26271_c1 3300050513 Bacteria 4060
517 nmdc:mga0rr50_363360_c1 3300050513 Bacteria 1219
518 nmdc:mga0rr50_54674_c1 3300050513 Bacteria 2976
519 nmdc:mga0rr50_8323_c1 3300050513 Bacteria 6453
520 nmdc:mga08x19_12011_c1 3300050514 Bacteria 5212
521 nmdc:mga08x19_37293_c1 3300050514 Bacteria 3085
522 nmdc:mga08x19_64587_c1 3300050514 Bacteria 2376
523 nmdc:mga0a205_112352_c1 3300050515 Bacteria 2623
524 nmdc:mga0a205_13443_c1 3300050515 Bacteria 7623
525 nmdc:mga0a205_186107_c1 3300050515 Bacteria 1970
526 nmdc:mga0a205_38862_c1 3300050515 Bacteria 4580
527 nmdc:mga0a205_39278_c1 3300050515 Bacteria 4556
528 Ga0495595_0049775 3300053084 Bacteria 1939
529 Ga0501084_0062691 3300054114 Bacteria 3112
530 Ga0501084_0241526 3300054114 Bacteria 1525
531 Ga0587084_023016 3300059477 Bacteria 948
532 Ga0587073_0002338 3300059492 Bacteria 2407
533 Ga0587077_004611 3300059493 Bacteria 1824
534 Ga0587077_004813 3300059493 Bacteria 1803
535 Ga0587082_001911 3300059504 Unclassified 2264
536 Ga0587082_009276 3300059504 Bacteria 1392
537 Ga0587083_0001635 3300059505 Bacteria 2579
538 Ga0587083_0009133 3300059505 Bacteria 1573
539 Ga0587079_002040 3300059647 Bacteria 2400
540 Ga0587107_003176 3300059652 Bacteria 1568
541 Ga0587071_006246 3300060344 Bacteria 1856
542 Ga0587071_007913 3300060344 Bacteria 1710
543 Ga0587071_012785 3300060344 Bacteria 1437
544 Ga0587071_027669 3300060344 Bacteria 1075
545 Ga0587111_0007187 3300060346 Bacteria 1800
546 Ga0587111_0022298 3300060346 Bacteria 1229
547 Ga0501082_0094050 3300060353 Bacteria 2590
548 Ga0530510_0008323 3300061734 Bacteria 7233
549 Ga0530510_0083564 3300061734 Bacteria 2325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_1203094 Ga0451791_1203094_13_753 246
2 3300049576 Ga0501040_0025556 Ga0501040_0025556_1309_2226 262
3 3300049579 Ga0501043_0086705 Ga0501043_0086705_1292_2209 262
4 3300049824 Ga0501045_0029366 Ga0501045_0029366_316_1233 262
5 3300031548 Ga0307408_100527865 Ga0307408_1005278652 264
6 3300032002 Ga0307416_100177895 Ga0307416_1001778952 264
7 3300046477 Ga0495664_0068073 Ga0495664_0068073_708_1562 264
8 3300046536 Ga0495587_0102496 Ga0495587_0102496_739_1593 264
9 3300046559 Ga0495667_0075462 Ga0495667_0075462_790_1644 264
10 3300046689 Ga0495613_0287672 Ga0495613_0287672_13_867 264
11 3300046690 Ga0495624_0072218 Ga0495624_0072218_1266_2120 264
12 3300047317 Ga0495604_0065989 Ga0495604_0065989_1564_2418 264
13 3300048911 Ga0496108_0127479 Ga0496108_0127479_578_1498 264
14 3300048912 Ga0496109_0166944 Ga0496109_0166944_191_1111 264
15 3300046794 Ga0495589_0045181 Ga0495589_0045181_451_1305 265
16 3300049568 Ga0501031_0145163 Ga0501031_0145163_451_1320 267
17 3300049569 Ga0501032_0186176 Ga0501032_0186176_474_1343 267
18 3300049570 Ga0501033_0363526 Ga0501033_0363526_89_958 267
19 3300049572 Ga0501036_0145862 Ga0501036_0145862_975_1844 267
20 3300049572 Ga0501036_0227001 Ga0501036_0227001_10_927 267
21 3300049575 Ga0501039_0041078 Ga0501039_0041078_1204_2073 267
22 3300049576 Ga0501040_0122981 Ga0501040_0122981_699_1568 267
23 3300049577 Ga0501041_0006034 Ga0501041_0006034_247_1116 267
24 3300049578 Ga0501042_0044659 Ga0501042_0044659_1186_2055 267
25 3300049580 Ga0501046_0005954 Ga0501046_0005954_7473_8342 267
26 3300049582 Ga0501048_0058027 Ga0501048_0058027_441_1310 267
27 3300049587 Ga0501071_0087137 Ga0501071_0087137_1089_1958 267
28 3300049588 Ga0501072_0002123 Ga0501072_0002123_6327_7196 267
29 3300049588 Ga0501072_0100053 Ga0501072_0100053_1138_2055 267
30 3300049590 Ga0501074_0142605 Ga0501074_0142605_226_1143 267
31 3300049591 Ga0501075_0037652 Ga0501075_0037652_1560_2429 267
32 3300049592 Ga0501076_0008642 Ga0501076_0008642_1075_1944 267
33 3300049593 Ga0501077_0123441 Ga0501077_0123441_218_1087 267
34 3300049743 Ga0501081_0008682 Ga0501081_0008682_2218_3087 267
35 3300049824 Ga0501045_0088032 Ga0501045_0088032_1059_1928 267
36 3300054114 Ga0501084_0062691 Ga0501084_0062691_40_909 267
37 3300060353 Ga0501082_0094050 Ga0501082_0094050_1194_2063 267
38 3300061734 Ga0530510_0083564 Ga0530510_0083564_1007_1876 267
39 3300046683 Ga0495658_0007549 Ga0495658_0007549_2391_3311 268
40 3300005436 Ga0070713_100240160 Ga0070713_1002401602 270
41 3300006028 Ga0070717_10024363 Ga0070717_100243632 270
42 3300025929 Ga0207664_10316417 Ga0207664_103164172 270
43 3300049583 Ga0501067_0004758 Ga0501067_0004758_2711_3646 270
44 3300049585 Ga0501069_0000850 Ga0501069_0000850_6064_6999 270
45 3300053084 Ga0495595_0049775 Ga0495595_0049775_92_1006 270
46 3300049742 Ga0501080_0287631 Ga0501080_0287631_366_1181 271
47 3300037312 Ga0395899_0003410 Ga0395899_0003410_9092_9991 272
48 3300037418 Ga0395900_0003416 Ga0395900_0003416_12533_13432 272
49 3300037466 Ga0395898_0002255 Ga0395898_0002255_20186_21085 272
50 3300037471 Ga0395905_0001065 Ga0395905_0001065_21183_22082 272
51 3300038443 Ga0395901_0011456 Ga0395901_0011456_5367_6266 272
52 3300044706 Ga0466964_0000226 Ga0466964_0000226_1907_2815 272
53 3300044901 Ga0466960_0000753 Ga0466960_0000753_4840_5748 272
54 3300045976 Ga0466967_0000582 Ga0466967_0000582_3486_4394 272
55 3300005445 Ga0070708_100108444 Ga0070708_1001084442 273
56 3300005467 Ga0070706_100436638 Ga0070706_1004366382 273
57 3300005471 Ga0070698_100372343 Ga0070698_1003723432 273
58 3300025910 Ga0207684_10319802 Ga0207684_103198022 273
59 3300009177 Ga0105248_10247652 Ga0105248_102476522 274
60 3300014497 Ga0182008_10118712 Ga0182008_101187121 274
61 3300037418 Ga0395900_0034992 Ga0395900_0034992_1149_2009 274
62 3300037466 Ga0395898_0074879 Ga0395898_0074879_2315_3175 274
63 3300041486 Ga0451807_1103478 Ga0451807_1103478_504_1328 274
64 3300041496 Ga0451839_0600587 Ga0451839_0600587_537_1361 274
65 3300054114 Ga0501084_0241526 Ga0501084_0241526_298_1170 274
66 3300047321 Ga0495676_0187420 Ga0495676_0187420_56_910 275
67 3300048909 Ga0496106_0231933 Ga0496106_0231933_16_870 275
68 3300005329 Ga0070683_100530717 Ga0070683_1005307171 276
69 3300014325 Ga0163163_10588441 Ga0163163_105884412 276
70 3300025944 Ga0207661_10211667 Ga0207661_102116672 276
71 3300046455 Ga0495603_0003177 Ga0495603_0003177_160_990 276
72 3300046517 Ga0495630_0024407 Ga0495630_0024407_1209_2039 276
73 3300046535 Ga0495586_0033836 Ga0495586_0033836_1555_2385 276
74 3300046642 Ga0495634_0028103 Ga0495634_0028103_988_1818 276
75 3300047319 Ga0495674_0099989 Ga0495674_0099989_298_1128 276
76 3300005434 Ga0070709_10338619 Ga0070709_103386191 277
77 3300005435 Ga0070714_100052577 Ga0070714_1000525773 277
78 3300005437 Ga0070710_10063653 Ga0070710_100636532 277
79 3300005439 Ga0070711_100034222 Ga0070711_1000342223 277
80 3300005456 Ga0070678_100282385 Ga0070678_1002823852 277
81 3300005530 Ga0070679_100427022 Ga0070679_1004270222 277
82 3300005535 Ga0070684_100013233 Ga0070684_1000132332 277
83 3300005546 Ga0070696_100098108 Ga0070696_1000981081 277
84 3300005547 Ga0070693_100122990 Ga0070693_1001229901 277
85 3300005577 Ga0068857_100112171 Ga0068857_1001121713 277
86 3300006173 Ga0070716_100216610 Ga0070716_1002166102 277
87 3300006175 Ga0070712_100035595 Ga0070712_1000355953 277
88 3300009174 Ga0105241_10016937 Ga0105241_100169373 277
89 3300025898 Ga0207692_10035058 Ga0207692_100350583 277
90 3300025906 Ga0207699_10082892 Ga0207699_100828922 277
91 3300025915 Ga0207693_10047192 Ga0207693_100471923 277
92 3300025916 Ga0207663_10010830 Ga0207663_100108305 277
93 3300025929 Ga0207664_10300883 Ga0207664_103008832 277
94 3300025939 Ga0207665_10002549 Ga0207665_1000254915 277
95 3300025944 Ga0207661_10033105 Ga0207661_100331052 277
96 3300026116 Ga0207674_10003931 Ga0207674_100039315 277
97 3300037418 Ga0395900_0059803 Ga0395900_0059803_2271_3125 277
98 3300037466 Ga0395898_0493688 Ga0395898_0493688_156_1010 277
99 3300037471 Ga0395905_0203044 Ga0395905_0203044_225_1079 277
100 3300045836 Ga0466958_0004006 Ga0466958_0004006_2867_3754 277
101 3300045976 Ga0466967_0010345 Ga0466967_0010345_2471_3358 277
102 3300046461 Ga0495641_0136245 Ga0495641_0136245_228_1082 277
103 3300048903 Ga0496100_0108469 Ga0496100_0108469_250_1149 277
104 3300048910 Ga0496107_0100876 Ga0496107_0100876_249_1148 277
105 3300048914 Ga0496111_0029993 Ga0496111_0029993_39_902 277
106 3300048917 Ga0496114_0001899 Ga0496114_0001899_46_909 277
107 3300048918 Ga0496115_0046551 Ga0496115_0046551_2367_3266 277
108 3300013308 Ga0157375_10421064 Ga0157375_104210641 278
109 3300025915 Ga0207693_10011464 Ga0207693_100114642 278
110 3300037418 Ga0395900_0011521 Ga0395900_0011521_4771_5724 278
111 3300037471 Ga0395905_0020525 Ga0395905_0020525_1126_2079 278
112 3300038443 Ga0395901_0112054 Ga0395901_0112054_930_1883 278
113 3300009174 Ga0105241_10061021 Ga0105241_100610213 280
114 3300013297 Ga0157378_10044009 Ga0157378_100440094 280
115 3300025945 Ga0207679_10019392 Ga0207679_100193923 280
116 3300048904 Ga0496101_0000693 Ga0496101_0000693_16018_16881 280
117 3300048905 Ga0496102_0001895 Ga0496102_0001895_4847_5710 280
118 3300048908 Ga0496105_0026421 Ga0496105_0026421_710_1573 280
119 3300048909 Ga0496106_0179309 Ga0496106_0179309_136_999 280
120 3300048911 Ga0496108_0003471 Ga0496108_0003471_6218_7081 280
121 3300048912 Ga0496109_0001336 Ga0496109_0001336_16913_17776 280
122 3300048913 Ga0496110_0003580 Ga0496110_0003580_2286_3149 280
123 3300048914 Ga0496111_0019129 Ga0496111_0019129_3521_4384 280
124 3300048918 Ga0496115_0001634 Ga0496115_0001634_10352_11215 280
125 3300005329 Ga0070683_100011404 Ga0070683_1000114043 281
126 3300005336 Ga0070680_100015581 Ga0070680_1000155817 281
127 3300005367 Ga0070667_100314615 Ga0070667_1003146152 281
128 3300005434 Ga0070709_10068825 Ga0070709_100688252 281
129 3300005435 Ga0070714_100007706 Ga0070714_1000077066 281
130 3300005436 Ga0070713_100209409 Ga0070713_1002094092 281
131 3300005440 Ga0070705_100164207 Ga0070705_1001642072 281
132 3300005445 Ga0070708_100104551 Ga0070708_1001045513 281
133 3300005458 Ga0070681_10005202 Ga0070681_1000520215 281
134 3300005468 Ga0070707_100006066 Ga0070707_1000060663 281
135 3300005530 Ga0070679_100010313 Ga0070679_1000103139 281
136 3300005535 Ga0070684_100015333 Ga0070684_1000153333 281
137 3300005547 Ga0070693_100003297 Ga0070693_1000032976 281
138 3300005549 Ga0070704_100116192 Ga0070704_1001161922 281
139 3300005614 Ga0068856_100032154 Ga0068856_1000321542 281
140 3300006058 Ga0075432_10056286 Ga0075432_100562862 281
141 3300006844 Ga0075428_100036303 Ga0075428_1000363038 281
142 3300006847 Ga0075431_100240526 Ga0075431_1002405261 281
143 3300006914 Ga0075436_100027559 Ga0075436_1000275594 281
144 3300007076 Ga0075435_100035790 Ga0075435_1000357901 281
145 3300009094 Ga0111539_10031591 Ga0111539_100315914 281
146 3300009098 Ga0105245_10100085 Ga0105245_101000852 281
147 3300009147 Ga0114129_10489216 Ga0114129_104892162 281
148 3300009148 Ga0105243_10241664 Ga0105243_102416641 281
149 3300009174 Ga0105241_10105584 Ga0105241_101055842 281
150 3300009177 Ga0105248_10319513 Ga0105248_103195132 281
151 3300013100 Ga0157373_10227258 Ga0157373_102272582 281
152 3300013296 Ga0157374_10017674 Ga0157374_100176747 281
153 3300025906 Ga0207699_10016358 Ga0207699_100163583 281
154 3300025911 Ga0207654_10045392 Ga0207654_100453922 281
155 3300025912 Ga0207707_10004701 Ga0207707_1000470115 281
156 3300025917 Ga0207660_10014316 Ga0207660_100143167 281
157 3300025919 Ga0207657_10070846 Ga0207657_100708463 281
158 3300025921 Ga0207652_10008347 Ga0207652_100083479 281
159 3300025922 Ga0207646_10006250 Ga0207646_1000625010 281
160 3300025927 Ga0207687_10004388 Ga0207687_100043889 281
161 3300025928 Ga0207700_10000021 Ga0207700_1000002172 281
162 3300025935 Ga0207709_10045490 Ga0207709_100454903 281
163 3300025944 Ga0207661_10004372 Ga0207661_100043729 281
164 3300026078 Ga0207702_10031683 Ga0207702_100316831 281
165 3300037418 Ga0395900_0017538 Ga0395900_0017538_5000_5908 281
166 3300037466 Ga0395898_0002136 Ga0395898_0002136_19826_20734 281
167 3300037471 Ga0395905_0008734 Ga0395905_0008734_2975_3883 281
168 3300038443 Ga0395901_0001772 Ga0395901_0001772_9715_10623 281
169 3300048905 Ga0496102_0020208 Ga0496102_0020208_38_979 281
170 3300048906 Ga0496103_0002705 Ga0496103_0002705_7453_8394 281
171 3300048911 Ga0496108_0191138 Ga0496108_0191138_66_1007 281
172 3300048914 Ga0496111_0023260 Ga0496111_0023260_187_1122 281
173 3300048914 Ga0496111_0075488 Ga0496111_0075488_528_1469 281
174 3300048914 Ga0496111_0236005 Ga0496111_0236005_93_1028 281
175 3300048916 Ga0496113_0076705 Ga0496113_0076705_1005_1940 281
176 3300048917 Ga0496114_0002596 Ga0496114_0002596_5973_6914 281
177 3300050510 nmdc:mga06r32_42841_c1 nmdc:mga06r32_42841_c1_212_1120 281
178 3300050513 nmdc:mga0rr50_54674_c1 nmdc:mga0rr50_54674_c1_602_1510 281
179 3300050514 nmdc:mga08x19_37293_c1 nmdc:mga08x19_37293_c1_2070_2978 281
180 3300050515 nmdc:mga0a205_13443_c1 nmdc:mga0a205_13443_c1_4799_5707 281
181 3300059492 Ga0587073_0002338 Ga0587073_0002338_302_1147 281
182 3300005337 Ga0070682_100130124 Ga0070682_1001301242 282
183 3300005436 Ga0070713_100018420 Ga0070713_1000184203 282
184 3300005455 Ga0070663_100012285 Ga0070663_1000122852 282
185 3300005456 Ga0070678_100012295 Ga0070678_1000122952 282
186 3300005614 Ga0068856_100004807 Ga0068856_1000048076 282
187 3300006163 Ga0070715_10027005 Ga0070715_100270052 282
188 3300006173 Ga0070716_100053165 Ga0070716_1000531652 282
189 3300006237 Ga0097621_100020572 Ga0097621_1000205722 282
190 3300009174 Ga0105241_10044214 Ga0105241_100442142 282
191 3300014969 Ga0157376_10157616 Ga0157376_101576162 282
192 3300025898 Ga0207692_10007220 Ga0207692_100072202 282
193 3300025906 Ga0207699_10176441 Ga0207699_101764412 282
194 3300025911 Ga0207654_10058593 Ga0207654_100585932 282
195 3300025916 Ga0207663_10038238 Ga0207663_100382382 282
196 3300025916 Ga0207663_10094273 Ga0207663_100942732 282
197 3300025929 Ga0207664_10241173 Ga0207664_102411732 282
198 3300026067 Ga0207678_10036515 Ga0207678_100365154 282
199 3300026121 Ga0207683_10003614 Ga0207683_1000361412 282
200 3300035092 Ga0373952_0015320 Ga0373952_0015320_582_1493 282
201 3300037471 Ga0395905_0171612 Ga0395905_0171612_897_1835 282
202 3300038443 Ga0395901_0253704 Ga0395901_0253704_32_970 282
203 3300046517 Ga0495630_0200270 Ga0495630_0200270_392_1333 282
204 3300048903 Ga0496100_0179960 Ga0496100_0179960_357_1271 282
205 3300048904 Ga0496101_0072002 Ga0496101_0072002_1201_2142 282
206 3300048904 Ga0496101_0204217 Ga0496101_0204217_258_1172 282
207 3300048905 Ga0496102_0047172 Ga0496102_0047172_258_1172 282
208 3300048906 Ga0496103_0026182 Ga0496103_0026182_2356_3270 282
209 3300048907 Ga0496104_0127880 Ga0496104_0127880_155_1093 282
210 3300048907 Ga0496104_0226841 Ga0496104_0226841_657_1598 282
211 3300048907 Ga0496104_0330386 Ga0496104_0330386_250_1188 282
212 3300048908 Ga0496105_0184951 Ga0496105_0184951_659_1600 282
213 3300048909 Ga0496106_0043233 Ga0496106_0043233_1911_2849 282
214 3300048909 Ga0496106_0046868 Ga0496106_0046868_690_1631 282
215 3300048910 Ga0496107_0015713 Ga0496107_0015713_1337_2251 282
216 3300048911 Ga0496108_0139256 Ga0496108_0139256_347_1291 282
217 3300048912 Ga0496109_0021057 Ga0496109_0021057_896_1840 282
218 3300048913 Ga0496110_0153515 Ga0496110_0153515_32_976 282
219 3300048913 Ga0496110_0338418 Ga0496110_0338418_306_1247 282
220 3300048914 Ga0496111_0075042 Ga0496111_0075042_1017_1928 282
221 3300048914 Ga0496111_0085054 Ga0496111_0085054_335_1273 282
222 3300048915 Ga0496112_0054583 Ga0496112_0054583_484_1398 282
223 3300048916 Ga0496113_0216998 Ga0496113_0216998_374_1288 282
224 3300048917 Ga0496114_0140314 Ga0496114_0140314_119_1057 282
225 3300048917 Ga0496114_0143830 Ga0496114_0143830_262_1203 282
226 3300048918 Ga0496115_0015102 Ga0496115_0015102_3769_4683 282
227 3300004799 Ga0058863_10144011 Ga0058863_101440113 283
228 3300004800 Ga0058861_10083104 Ga0058861_100831043 283
229 3300005328 Ga0070676_10094310 Ga0070676_100943102 283
230 3300005329 Ga0070683_100181869 Ga0070683_1001818692 283
231 3300005341 Ga0070691_10010388 Ga0070691_100103883 283
232 3300005347 Ga0070668_100017272 Ga0070668_1000172722 283
233 3300005347 Ga0070668_100167488 Ga0070668_1001674882 283
234 3300005356 Ga0070674_100041412 Ga0070674_1000414123 283
235 3300005435 Ga0070714_100575830 Ga0070714_1005758301 283
236 3300005436 Ga0070713_100165701 Ga0070713_1001657012 283
237 3300005436 Ga0070713_100429939 Ga0070713_1004299391 283
238 3300005438 Ga0070701_10115142 Ga0070701_101151422 283
239 3300005440 Ga0070705_100019197 Ga0070705_1000191972 283
240 3300005440 Ga0070705_100024947 Ga0070705_1000249473 283
241 3300005444 Ga0070694_100020236 Ga0070694_1000202364 283
242 3300005444 Ga0070694_100184607 Ga0070694_1001846072 283
243 3300005445 Ga0070708_100022772 Ga0070708_1000227723 283
244 3300005445 Ga0070708_100080160 Ga0070708_1000801601 283
245 3300005445 Ga0070708_100386511 Ga0070708_1003865111 283
246 3300005456 Ga0070678_100036564 Ga0070678_1000365642 283
247 3300005457 Ga0070662_100193621 Ga0070662_1001936212 283
248 3300005458 Ga0070681_10009066 Ga0070681_100090668 283
249 3300005459 Ga0068867_100054489 Ga0068867_1000544892 283
250 3300005467 Ga0070706_100039864 Ga0070706_1000398641 283
251 3300005467 Ga0070706_100079966 Ga0070706_1000799663 283
252 3300005467 Ga0070706_100093222 Ga0070706_1000932222 283
253 3300005471 Ga0070698_100086622 Ga0070698_1000866223 283
254 3300005518 Ga0070699_100042993 Ga0070699_1000429933 283
255 3300005518 Ga0070699_100043871 Ga0070699_1000438713 283
256 3300005518 Ga0070699_100053998 Ga0070699_1000539982 283
257 3300005530 Ga0070679_100078388 Ga0070679_1000783882 283
258 3300005536 Ga0070697_100108587 Ga0070697_1001085872 283
259 3300005536 Ga0070697_100249469 Ga0070697_1002494692 283
260 3300005545 Ga0070695_100018456 Ga0070695_1000184562 283
261 3300005546 Ga0070696_100002938 Ga0070696_1000029386 283
262 3300005546 Ga0070696_100010084 Ga0070696_1000100849 283
263 3300005546 Ga0070696_100116838 Ga0070696_1001168382 283
264 3300005547 Ga0070693_100190330 Ga0070693_1001903302 283
265 3300005549 Ga0070704_100260850 Ga0070704_1002608502 283
266 3300005563 Ga0068855_100403987 Ga0068855_1004039872 283
267 3300005578 Ga0068854_100194345 Ga0068854_1001943452 283
268 3300005614 Ga0068856_100229767 Ga0068856_1002297672 283
269 3300005719 Ga0068861_100000908 Ga0068861_1000009088 283
270 3300005841 Ga0068863_100454046 Ga0068863_1004540462 283
271 3300005937 Ga0081455_10018945 Ga0081455_100189456 283
272 3300005937 Ga0081455_10033081 Ga0081455_100330812 283
273 3300005937 Ga0081455_10143510 Ga0081455_101435102 283
274 3300005983 Ga0081540_1012012 Ga0081540_10120125 283
275 3300005983 Ga0081540_1016281 Ga0081540_10162814 283
276 3300005983 Ga0081540_1033732 Ga0081540_10337322 283
277 3300006028 Ga0070717_10007354 Ga0070717_1000735410 283
278 3300006058 Ga0075432_10002799 Ga0075432_100027994 283
279 3300006163 Ga0070715_10051469 Ga0070715_100514692 283
280 3300006175 Ga0070712_100041903 Ga0070712_1000419033 283
281 3300006237 Ga0097621_100163743 Ga0097621_1001637432 283
282 3300006844 Ga0075428_100218185 Ga0075428_1002181852 283
283 3300006847 Ga0075431_100074234 Ga0075431_1000742342 283
284 3300006847 Ga0075431_100213221 Ga0075431_1002132212 283
285 3300006852 Ga0075433_10031746 Ga0075433_100317463 283
286 3300006852 Ga0075433_10038385 Ga0075433_100383853 283
287 3300006871 Ga0075434_100033913 Ga0075434_1000339133 283
288 3300006871 Ga0075434_100054181 Ga0075434_1000541813 283
289 3300006871 Ga0075434_100099290 Ga0075434_1000992903 283
290 3300006871 Ga0075434_100242126 Ga0075434_1002421262 283
291 3300006880 Ga0075429_100220062 Ga0075429_1002200622 283
292 3300006914 Ga0075436_100004801 Ga0075436_1000048012 283
293 3300006914 Ga0075436_100015955 Ga0075436_1000159551 283
294 3300006914 Ga0075436_100086511 Ga0075436_1000865111 283
295 3300007076 Ga0075435_100012420 Ga0075435_10001242010 283
296 3300007076 Ga0075435_100024800 Ga0075435_1000248003 283
297 3300007076 Ga0075435_100062366 Ga0075435_1000623662 283
298 3300009036 Ga0105244_10130014 Ga0105244_101300142 283
299 3300009092 Ga0105250_10057679 Ga0105250_100576792 283
300 3300009094 Ga0111539_10039764 Ga0111539_100397643 283
301 3300009094 Ga0111539_10109748 Ga0111539_101097483 283
302 3300009098 Ga0105245_10056284 Ga0105245_100562842 283
303 3300009098 Ga0105245_10067136 Ga0105245_100671362 283
304 3300009098 Ga0105245_10471963 Ga0105245_104719632 283
305 3300009147 Ga0114129_10024210 Ga0114129_100242102 283
306 3300009147 Ga0114129_10100733 Ga0114129_101007333 283
307 3300009147 Ga0114129_10265572 Ga0114129_102655721 283
308 3300009147 Ga0114129_10805079 Ga0114129_108050792 283
309 3300009148 Ga0105243_10057251 Ga0105243_100572513 283
310 3300009148 Ga0105243_10074764 Ga0105243_100747643 283
311 3300009148 Ga0105243_10444159 Ga0105243_104441592 283
312 3300009148 Ga0105243_10456510 Ga0105243_104565102 283
313 3300009176 Ga0105242_10111043 Ga0105242_101110433 283
314 3300009176 Ga0105242_10148042 Ga0105242_101480422 283
315 3300009176 Ga0105242_10158803 Ga0105242_101588032 283
316 3300009176 Ga0105242_10490160 Ga0105242_104901601 283
317 3300009177 Ga0105248_10538967 Ga0105248_105389671 283
318 3300009551 Ga0105238_10136151 Ga0105238_101361512 283
319 3300009553 Ga0105249_10011592 Ga0105249_100115924 283
320 3300009553 Ga0105249_10521978 Ga0105249_105219781 283
321 3300010375 Ga0105239_10210267 Ga0105239_102102671 283
322 3300010375 Ga0105239_10626428 Ga0105239_106264281 283
323 3300012515 Ga0157338_1003189 Ga0157338_10031891 283
324 3300013105 Ga0157369_10277168 Ga0157369_102771682 283
325 3300013296 Ga0157374_10442760 Ga0157374_104427602 283
326 3300013296 Ga0157374_10679166 Ga0157374_106791662 283
327 3300013297 Ga0157378_10039260 Ga0157378_100392602 283
328 3300013306 Ga0163162_10042390 Ga0163162_100423903 283
329 3300013306 Ga0163162_10548566 Ga0163162_105485661 283
330 3300013308 Ga0157375_10170525 Ga0157375_101705252 283
331 3300014326 Ga0157380_10065411 Ga0157380_100654113 283
332 3300014326 Ga0157380_10280578 Ga0157380_102805782 283
333 3300014969 Ga0157376_10206295 Ga0157376_102062952 283
334 3300017792 Ga0163161_10235568 Ga0163161_102355682 283
335 3300020069 Ga0197907_10146283 Ga0197907_101462833 283
336 3300020069 Ga0197907_10236517 Ga0197907_102365172 283
337 3300020075 Ga0206349_1288411 Ga0206349_12884113 283
338 3300020077 Ga0206351_10214462 Ga0206351_102144622 283
339 3300020078 Ga0206352_10683046 Ga0206352_106830462 283
340 3300020080 Ga0206350_10904318 Ga0206350_109043183 283
341 3300020080 Ga0206350_10978042 Ga0206350_109780422 283
342 3300020080 Ga0206350_11038408 Ga0206350_110384081 283
343 3300020081 Ga0206354_11144382 Ga0206354_111443822 283
344 3300020610 Ga0154015_1400926 Ga0154015_14009263 283
345 3300021384 Ga0213876_10000947 Ga0213876_1000094712 283
346 3300021384 Ga0213876_10018077 Ga0213876_100180771 283
347 3300021384 Ga0213876_10049030 Ga0213876_100490302 283
348 3300021384 Ga0213876_10211361 Ga0213876_102113612 283
349 3300021388 Ga0213875_10004142 Ga0213875_100041423 283
350 3300022467 Ga0224712_10074219 Ga0224712_100742192 283
351 3300025885 Ga0207653_10004394 Ga0207653_100043941 283
352 3300025901 Ga0207688_10020355 Ga0207688_100203552 283
353 3300025910 Ga0207684_10072848 Ga0207684_100728483 283
354 3300025910 Ga0207684_10507647 Ga0207684_105076471 283
355 3300025912 Ga0207707_10027417 Ga0207707_100274175 283
356 3300025915 Ga0207693_10014820 Ga0207693_100148204 283
357 3300025916 Ga0207663_10025359 Ga0207663_100253592 283
358 3300025916 Ga0207663_10048087 Ga0207663_100480872 283
359 3300025918 Ga0207662_10193957 Ga0207662_101939572 283
360 3300025919 Ga0207657_10044716 Ga0207657_100447163 283
361 3300025922 Ga0207646_10025722 Ga0207646_100257222 283
362 3300025927 Ga0207687_10251347 Ga0207687_102513471 283
363 3300025928 Ga0207700_10052519 Ga0207700_100525193 283
364 3300025928 Ga0207700_10209227 Ga0207700_102092272 283
365 3300025928 Ga0207700_10341494 Ga0207700_103414942 283
366 3300025929 Ga0207664_10047045 Ga0207664_100470454 283
367 3300025932 Ga0207690_10313531 Ga0207690_103135312 283
368 3300025933 Ga0207706_10005570 Ga0207706_100055704 283
369 3300025935 Ga0207709_10060006 Ga0207709_100600062 283
370 3300025935 Ga0207709_10195525 Ga0207709_101955252 283
371 3300025936 Ga0207670_10211164 Ga0207670_102111642 283
372 3300025938 Ga0207704_10228256 Ga0207704_102282562 283
373 3300025939 Ga0207665_10234292 Ga0207665_102342922 283
374 3300025944 Ga0207661_10117834 Ga0207661_101178342 283
375 3300025949 Ga0207667_10074212 Ga0207667_100742124 283
376 3300025961 Ga0207712_10189677 Ga0207712_101896772 283
377 3300025961 Ga0207712_10266496 Ga0207712_102664962 283
378 3300025972 Ga0207668_10013237 Ga0207668_100132372 283
379 3300025972 Ga0207668_10020115 Ga0207668_100201153 283
380 3300026023 Ga0207677_10261592 Ga0207677_102615922 283
381 3300026067 Ga0207678_10504734 Ga0207678_105047341 283
382 3300026075 Ga0207708_10027546 Ga0207708_100275464 283
383 3300026088 Ga0207641_10244375 Ga0207641_102443752 283
384 3300026089 Ga0207648_10217014 Ga0207648_102170142 283
385 3300026118 Ga0207675_100002310 Ga0207675_1000023103 283
386 3300026118 Ga0207675_100084162 Ga0207675_1000841623 283
387 3300026121 Ga0207683_10052740 Ga0207683_100527403 283
388 3300026121 Ga0207683_10330662 Ga0207683_103306622 283
389 3300027907 Ga0207428_10001749 Ga0207428_1000174913 283
390 3300027907 Ga0207428_10033098 Ga0207428_100330983 283
391 3300028381 Ga0268264_10290310 Ga0268264_102903102 283
392 3300031731 Ga0307405_10170314 Ga0307405_101703141 283
393 3300032002 Ga0307416_100160128 Ga0307416_1001601282 283
394 3300034819 Ga0373958_0001064 Ga0373958_0001064_2601_3548 283
395 3300034820 Ga0373959_0011206 Ga0373959_0011206_59_1006 283
396 3300034957 Ga0373938_0000887 Ga0373938_0000887_951_1898 283
397 3300035083 Ga0373926_0029659 Ga0373926_0029659_429_1343 283
398 3300035090 Ga0373949_0006752 Ga0373949_0006752_827_1774 283
399 3300035091 Ga0373951_0003839 Ga0373951_0003839_1614_2561 283
400 3300035112 Ga0373932_0001487 Ga0373932_0001487_4749_5696 283
401 3300035114 Ga0373939_0001973 Ga0373939_0001973_371_1318 283
402 3300035121 Ga0373960_0039046 Ga0373960_0039046_385_1332 283
403 3300035170 Ga0373943_0004293 Ga0373943_0004293_1824_2738 283
404 3300035171 Ga0373946_0040957 Ga0373946_0040957_853_1767 283
405 3300035691 Ga0373931_0130381 Ga0373931_0130381_357_1304 283
406 3300035695 Ga0373927_0116011 Ga0373927_0116011_601_1515 283
407 3300035725 Ga0373947_0000770 Ga0373947_0000770_13923_14837 283
408 3300037068 Ga0373925_0073590 Ga0373925_0073590_1643_2557 283
409 3300037312 Ga0395899_0001548 Ga0395899_0001548_6498_7412 283
410 3300037312 Ga0395899_0007659 Ga0395899_0007659_6350_7291 283
411 3300037418 Ga0395900_0002536 Ga0395900_0002536_13252_14166 283
412 3300037418 Ga0395900_0023702 Ga0395900_0023702_1330_2271 283
413 3300037466 Ga0395898_0016493 Ga0395898_0016493_6498_7412 283
414 3300037466 Ga0395898_0019665 Ga0395898_0019665_2211_3152 283
415 3300037466 Ga0395898_0175116 Ga0395898_0175116_61_1002 283
416 3300037466 Ga0395898_0234420 Ga0395898_0234420_29_943 283
417 3300037471 Ga0395905_0043890 Ga0395905_0043890_516_1457 283
418 3300037471 Ga0395905_0159686 Ga0395905_0159686_957_1898 283
419 3300037853 Ga0436364_0352138 Ga0436364_0352138_3797_4648 283
420 3300037853 Ga0436364_0647061 Ga0436364_0647061_5902_6753 283
421 3300037853 Ga0436364_1012180 Ga0436364_1012180_963_1814 283
422 3300038443 Ga0395901_0006400 Ga0395901_0006400_4137_5078 283
423 3300038443 Ga0395901_0016350 Ga0395901_0016350_144_1058 283
424 3300038443 Ga0395901_0041838 Ga0395901_0041838_157_1098 283
425 3300038443 Ga0395901_0257454 Ga0395901_0257454_169_1083 283
426 3300039437 Ga0436365_0729348 Ga0436365_0729348_9658_10509 283
427 3300039437 Ga0436365_0759186 Ga0436365_0759186_378_1229 283
428 3300039437 Ga0436365_0835497 Ga0436365_0835497_1259_2110 283
429 3300039437 Ga0436365_1125661 Ga0436365_1125661_1481_2332 283
430 3300039437 Ga0436365_1526089 Ga0436365_1526089_1001_1852 283
431 3300039450 Ga0436363_0041336 Ga0436363_0041336_356_1207 283
432 3300041443 Ga0451789_0273498 Ga0451789_0273498_2336_3253 283
433 3300041452 Ga0451793_0594840 Ga0451793_0594840_293_1210 283
434 3300041458 Ga0451798_0122293 Ga0451798_0122293_975_1892 283
435 3300041460 Ga0451802_0643303 Ga0451802_0643303_1375_2292 283
436 3300041486 Ga0451807_1019500 Ga0451807_1019500_213_1151 283
437 3300041491 Ga0451833_0940987 Ga0451833_0940987_38_955 283
438 3300041501 Ga0451845_0124247 Ga0451845_0124247_1343_2260 283
439 3300041503 Ga0451847_0700854 Ga0451847_0700854_1104_2021 283
440 3300041505 Ga0451849_0038419 Ga0451849_0038419_23_940 283
441 3300041511 Ga0451855_1300520 Ga0451855_1300520_2831_3748 283
442 3300041512 Ga0451853_1902749 Ga0451853_1902749_564_1481 283
443 3300041512 Ga0451853_3143072 Ga0451853_3143072_130_1068 283
444 3300042005 Ga0439448_0050006 Ga0439448_0050006_111_1031 283
445 3300044694 Ga0466963_0007073 Ga0466963_0007073_1464_2378 283
446 3300044901 Ga0466960_0028905 Ga0466960_0028905_687_1604 283
447 3300046461 Ga0495641_0000786 Ga0495641_0000786_13503_14417 283
448 3300046472 Ga0495580_0084925 Ga0495580_0084925_115_1029 283
449 3300046473 Ga0495582_0002921 Ga0495582_0002921_750_1664 283
450 3300046473 Ga0495582_0089192 Ga0495582_0089192_682_1623 283
451 3300046473 Ga0495582_0150487 Ga0495582_0150487_261_1202 283
452 3300046475 Ga0495639_0083324 Ga0495639_0083324_237_1178 283
453 3300046492 Ga0495585_0180161 Ga0495585_0180161_134_1075 283
454 3300046499 Ga0495594_0006926 Ga0495594_0006926_2601_3515 283
455 3300046499 Ga0495594_0143700 Ga0495594_0143700_105_1046 283
456 3300046517 Ga0495630_0036936 Ga0495630_0036936_1814_2728 283
457 3300046526 Ga0495666_0039245 Ga0495666_0039245_874_1788 283
458 3300046531 Ga0495665_0067091 Ga0495665_0067091_449_1390 283
459 3300046648 Ga0495611_0156532 Ga0495611_0156532_109_1050 283
460 3300046674 Ga0495588_0000409 Ga0495588_0000409_12682_13596 283
461 3300046674 Ga0495588_0068562 Ga0495588_0068562_15_956 283
462 3300046683 Ga0495658_0081353 Ga0495658_0081353_318_1259 283
463 3300046683 Ga0495658_0201099 Ga0495658_0201099_286_1200 283
464 3300046810 Ga0495660_0049613 Ga0495660_0049613_247_1188 283
465 3300047318 Ga0495636_0128137 Ga0495636_0128137_142_1083 283
466 3300047321 Ga0495676_0003790 Ga0495676_0003790_3462_4376 283
467 3300048903 Ga0496100_0004617 Ga0496100_0004617_1812_2759 283
468 3300048903 Ga0496100_0007158 Ga0496100_0007158_56_979 283
469 3300048903 Ga0496100_0023638 Ga0496100_0023638_500_1441 283
470 3300048904 Ga0496101_0002775 Ga0496101_0002775_7269_8192 283
471 3300048904 Ga0496101_0022405 Ga0496101_0022405_3070_4017 283
472 3300048904 Ga0496101_0041842 Ga0496101_0041842_1071_1988 283
473 3300048905 Ga0496102_0014246 Ga0496102_0014246_4448_5371 283
474 3300048905 Ga0496102_0092736 Ga0496102_0092736_1070_1987 283
475 3300048905 Ga0496102_0113008 Ga0496102_0113008_401_1342 283
476 3300048906 Ga0496103_0073038 Ga0496103_0073038_812_1729 283
477 3300048906 Ga0496103_0087629 Ga0496103_0087629_471_1418 283
478 3300048907 Ga0496104_0003324 Ga0496104_0003324_12328_13269 283
479 3300048907 Ga0496104_0005986 Ga0496104_0005986_4931_5854 283
480 3300048907 Ga0496104_0008544 Ga0496104_0008544_5228_6175 283
481 3300048907 Ga0496104_0075725 Ga0496104_0075725_142_1059 283
482 3300048908 Ga0496105_0002977 Ga0496105_0002977_403_1344 283
483 3300048908 Ga0496105_0004578 Ga0496105_0004578_5177_6100 283
484 3300048908 Ga0496105_0005614 Ga0496105_0005614_3384_4331 283
485 3300048908 Ga0496105_0081858 Ga0496105_0081858_809_1726 283
486 3300048909 Ga0496106_0021833 Ga0496106_0021833_3461_4384 283
487 3300048909 Ga0496106_0031401 Ga0496106_0031401_657_1574 283
488 3300048910 Ga0496107_0008377 Ga0496107_0008377_1143_2090 283
489 3300048911 Ga0496108_0005479 Ga0496108_0005479_6117_7058 283
490 3300048911 Ga0496108_0007986 Ga0496108_0007986_354_1301 283
491 3300048911 Ga0496108_0017582 Ga0496108_0017582_4064_4981 283
492 3300048911 Ga0496108_0044047 Ga0496108_0044047_110_1024 283
493 3300048912 Ga0496109_0005025 Ga0496109_0005025_4383_5306 283
494 3300048912 Ga0496109_0007036 Ga0496109_0007036_1181_2122 283
495 3300048912 Ga0496109_0010195 Ga0496109_0010195_5597_6511 283
496 3300048912 Ga0496109_0046000 Ga0496109_0046000_545_1492 283
497 3300048912 Ga0496109_0049707 Ga0496109_0049707_703_1620 283
498 3300048912 Ga0496109_0432291 Ga0496109_0432291_70_1011 283
499 3300048913 Ga0496110_0038536 Ga0496110_0038536_1181_2122 283
500 3300048913 Ga0496110_0058128 Ga0496110_0058128_1540_2457 283
501 3300048913 Ga0496110_0076559 Ga0496110_0076559_1293_2234 283
502 3300048914 Ga0496111_0025684 Ga0496111_0025684_203_1144 283
503 3300048914 Ga0496111_0060666 Ga0496111_0060666_10_957 283
504 3300048914 Ga0496111_0076299 Ga0496111_0076299_1406_2347 283
505 3300048914 Ga0496111_0084188 Ga0496111_0084188_1088_2005 283
506 3300048915 Ga0496112_0040014 Ga0496112_0040014_3546_4469 283
507 3300048915 Ga0496112_0076357 Ga0496112_0076357_461_1402 283
508 3300048915 Ga0496112_0171515 Ga0496112_0171515_677_1594 283
509 3300048916 Ga0496113_0000346 Ga0496113_0000346_20689_21630 283
510 3300048916 Ga0496113_0002890 Ga0496113_0002890_6516_7463 283
511 3300048916 Ga0496113_0009805 Ga0496113_0009805_1188_2105 283
512 3300048917 Ga0496114_0114798 Ga0496114_0114798_1188_2105 283
513 3300048917 Ga0496114_0137640 Ga0496114_0137640_44_985 283
514 3300048918 Ga0496115_0006018 Ga0496115_0006018_4614_5561 283
515 3300048918 Ga0496115_0010948 Ga0496115_0010948_3857_4798 283
516 3300050507 nmdc:mga05p37_27560_c1 nmdc:mga05p37_27560_c1_1800_2747 283
517 3300050510 nmdc:mga06r32_63939_c1 nmdc:mga06r32_63939_c1_650_1567 283
518 3300050511 nmdc:mga08y16_52186_c1 nmdc:mga08y16_52186_c1_2297_3217 283
519 3300050511 nmdc:mga08y16_52675_c1 nmdc:mga08y16_52675_c1_1801_2718 283
520 3300050512 nmdc:mga0n895_19753_c1 nmdc:mga0n895_19753_c1_1309_2226 283
521 3300050512 nmdc:mga0n895_43505_c1 nmdc:mga0n895_43505_c1_3132_4052 283
522 3300050512 nmdc:mga0n895_45214_c1 nmdc:mga0n895_45214_c1_1308_2228 283
523 3300050512 nmdc:mga0n895_599201_c1 nmdc:mga0n895_599201_c1_39_959 283
524 3300050512 nmdc:mga0n895_74174_c1 nmdc:mga0n895_74174_c1_934_1848 283
525 3300050513 nmdc:mga0rr50_26271_c1 nmdc:mga0rr50_26271_c1_1892_2812 283
526 3300050513 nmdc:mga0rr50_363360_c1 nmdc:mga0rr50_363360_c1_56_976 283
527 3300050513 nmdc:mga0rr50_8323_c1 nmdc:mga0rr50_8323_c1_1889_2806 283
528 3300050514 nmdc:mga08x19_12011_c1 nmdc:mga08x19_12011_c1_4264_5181 283
529 3300050514 nmdc:mga08x19_64587_c1 nmdc:mga08x19_64587_c1_1382_2302 283
530 3300050515 nmdc:mga0a205_112352_c1 nmdc:mga0a205_112352_c1_1471_2412 283
531 3300050515 nmdc:mga0a205_186107_c1 nmdc:mga0a205_186107_c1_80_1027 283
532 3300050515 nmdc:mga0a205_38862_c1 nmdc:mga0a205_38862_c1_1762_2679 283
533 3300050515 nmdc:mga0a205_39278_c1 nmdc:mga0a205_39278_c1_2381_3301 283
534 3300059477 Ga0587084_023016 Ga0587084_023016_37_888 283
535 3300059493 Ga0587077_004611 Ga0587077_004611_181_1032 283
536 3300059493 Ga0587077_004813 Ga0587077_004813_27_878 283
537 3300059504 Ga0587082_001911 Ga0587082_001911_276_1127 283
538 3300059504 Ga0587082_009276 Ga0587082_009276_365_1216 283
539 3300059505 Ga0587083_0001635 Ga0587083_0001635_1594_2445 283
540 3300059505 Ga0587083_0009133 Ga0587083_0009133_163_1014 283
541 3300059647 Ga0587079_002040 Ga0587079_002040_1532_2383 283
542 3300059652 Ga0587107_003176 Ga0587107_003176_169_1020 283
543 3300060344 Ga0587071_006246 Ga0587071_006246_945_1796 283
544 3300060344 Ga0587071_007913 Ga0587071_007913_816_1667 283
545 3300060344 Ga0587071_012785 Ga0587071_012785_62_913 283
546 3300060344 Ga0587071_027669 Ga0587071_027669_188_1039 283
547 3300060346 Ga0587111_0007187 Ga0587111_0007187_18_869 283
548 3300060346 Ga0587111_0022298 Ga0587111_0022298_335_1186 283
549 3300061734 Ga0530510_0008323 Ga0530510_0008323_5532_6386 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

111

310

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8806 10 274
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8709 10 283
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8682 10 274
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8671 10 279
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8622 10 283
ID Description Score Start End Superfamily
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9166 11 273 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9067 11 273 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9051 4 269 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8965 8 273 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8924 4 269 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A527VUA2-F1-model_v4 Carbohydrate ABC transporter permease 0.9731 59 255 GO:0005886
GO:0055085
AF-A0A527VUA2-F1-model_v4 Carbohydrate ABC transporter permease 0.9586 59 255 GO:0005886
GO:0055085
AF-A0A536V476-F1-model_v4 ABC transporter permease subunit 0.9566 20 283 GO:0005886
GO:0055085
AF-A0A2M8Q5F9-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9544 57 283 GO:0005886
GO:0055085
AF-A0A538KE07-F1-model_v4 Carbohydrate ABC transporter permease 0.9536 3 234 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
88.46 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map