F462341

General Info

Members Datasets Scaffolds Average Seq Length
549 400 1098 94

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10055304|Ga0075369_100553042
Length 110
Sequence MKPGGTTIEATRPAMPHYVAIIEDADPDDAVSLWFPDLPGCISGGDDVDEALENAPEALAFYAQELTEDGRELPPPRTLEELKADPAFADDLGTHTAVLIEWPPPADATE

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
65 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
66 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
108 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
109 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
110 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
235 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
242 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
243 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
246 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
247 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
248 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
249 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
250 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
251 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
252 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
253 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
254 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
255 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
264 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
265 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
270 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
271 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
272 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
273 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
274 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
275 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
276 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
277 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
278 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
279 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
280 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
281 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
282 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
283 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
284 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
285 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
286 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
287 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
288 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
289 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
290 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
291 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
292 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
293 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
294 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
295 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
296 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
297 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
298 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
299 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
300 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
301 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
302 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
303 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
304 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
305 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
306 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
307 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
308 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
309 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
310 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
311 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
312 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
313 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
314 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
315 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
316 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
317 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
318 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
319 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
320 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
321 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
322 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
323 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
324 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
325 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
326 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
327 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
328 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
329 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
330 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
331 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
332 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
333 2922368715
334 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
335 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
336 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
337 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
338 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
339 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
340 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
341 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
342 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
343 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
344 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
345 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
346 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
347 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
348 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
349 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
350 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
351 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
352 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
353 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
354 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
355 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
356 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
357 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
358 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
359 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
360 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
361 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
362 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
363 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
364 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
365 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
366 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
367 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
368 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
369 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
370 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
371 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
372 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
373 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
374 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
375 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
376 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
377 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
378 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
379 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
380 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
381 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
382 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
383 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
384 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
385 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
386 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
387 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
388 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
389 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
390 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
391 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
392 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
393 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
394 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
395 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
396 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
397 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
398 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
399 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
400 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.82
Metatranscriptomes 0
Isolates 23.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.95
Nodule 19.13
Rhizoplane 5.83
Rhizosphere 41.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10055304 3300006186 Bacteria 1724
2 JGI25165J46597_1011240 3300003214 Bacteria 1283
3 JGI25153J46596_10000758 3300003215 Bacteria 19728
4 JGI25153J46596_10006310 3300003215 Bacteria 6035
5 rootH2_10019141 3300003320 Bacteria 1307
6 JGI25160J50197_1000575 3300003354 Bacteria 20650
7 JGI25160J50197_1035258 3300003354 Bacteria 1229
8 Ga0055539_1026248 3300003752 Bacteria 676
9 Ga0055542_1005548 3300003762 Bacteria 2828
10 Ga0055531_10004851 3300003794 Bacteria 8017
11 Ga0055543_1007549 3300004625 Bacteria 2499
12 Ga0065165_1001432 3300005262 Bacteria 25860
13 Ga0065165_1004353 3300005262 Bacteria 8877
14 Ga0065165_1007880 3300005262 Bacteria 5117
15 Ga0065165_1035074 3300005262 Bacteria 1544
16 Ga0065165_1091261 3300005262 Bacteria 775
17 Ga0070658_10225840 3300005327 Bacteria 1584
18 Ga0070658_10293985 3300005327 Bacteria 1384
19 Ga0070682_100227435 3300005337 Bacteria 1332
20 Ga0068868_102341628 3300005338 Bacteria 510
21 Ga0070660_101163213 3300005339 Bacteria 654
22 Ga0070668_100065087 3300005347 Bacteria 2827
23 Ga0070668_100280221 3300005347 Bacteria 1392
24 Ga0070669_101752463 3300005353 Bacteria 542
25 Ga0070671_100717576 3300005355 Bacteria 868
26 Ga0070688_100149627 3300005365 Bacteria 1595
27 Ga0070714_100224086 3300005435 Bacteria 1729
28 Ga0070713_100014120 3300005436 Bacteria 5918
29 Ga0070713_101394314 3300005436 Bacteria 680
30 Ga0070663_100100929 3300005455 Bacteria 2153
31 Ga0070663_100146387 3300005455 Bacteria 1808
32 Ga0070663_101768625 3300005455 Bacteria 554
33 Ga0070662_101702267 3300005457 Bacteria 545
34 Ga0068867_100540512 3300005459 Bacteria 1008
35 Ga0070685_10887481 3300005466 Bacteria 663
36 Ga0070679_100873188 3300005530 Bacteria 843
37 Ga0070684_101941530 3300005535 Bacteria 555
38 Ga0068853_101564909 3300005539 Bacteria 639
39 Ga0070665_100127194 3300005548 Bacteria 2550
40 Ga0070665_101047580 3300005548 Bacteria 828
41 Ga0068855_100397123 3300005563 Bacteria 1512
42 Ga0068855_101798774 3300005563 Bacteria 623
43 Ga0070664_101283116 3300005564 Bacteria 691
44 Ga0068857_100245967 3300005577 Bacteria 1639
45 Ga0068856_100447943 3300005614 Bacteria 1312
46 Ga0068856_102452794 3300005614 Bacteria 528
47 Ga0068852_100048696 3300005616 Bacteria 3622
48 Ga0068852_100077563 3300005616 Bacteria 2937
49 Ga0068852_101176797 3300005616 Bacteria 788
50 Ga0068864_101257886 3300005618 Bacteria 740
51 Ga0068861_100310954 3300005719 Bacteria 1369
52 Ga0068851_10114103 3300005834 Bacteria 1445
53 Ga0068863_100352368 3300005841 Bacteria 1434
54 Ga0081540_1018617 3300005983 Bacteria 4252
55 Ga0070717_10109374 3300006028 Bacteria 2356
56 Ga0075365_10214946 3300006038 Bacteria 1348
57 Ga0075363_100309476 3300006048 Bacteria 918
58 Ga0075363_100349400 3300006048 Bacteria 863
59 Ga0075363_100543442 3300006048 Bacteria 693
60 Ga0070716_100965289 3300006173 Bacteria 672
61 Ga0075367_10303029 3300006178 Bacteria 1006
62 Ga0075367_10770037 3300006178 Bacteria 613
63 Ga0075367_10973664 3300006178 Bacteria 541
64 Ga0075369_10076490 3300006186 Bacteria 1480
65 Ga0075366_10070517 3300006195 Bacteria 2081
66 Ga0075370_10204022 3300006353 Bacteria 1166
67 Ga0075370_10229007 3300006353 Bacteria 1099
68 Ga0075370_10243348 3300006353 Bacteria 1065
69 Ga0099823_1035107 3300006944 Bacteria 3932
70 Ga0105244_10178733 3300009036 Bacteria 1007
71 Ga0105240_10009222 3300009093 Bacteria 13997
72 Ga0105240_11050091 3300009093 Bacteria 869
73 Ga0105240_11547373 3300009093 Bacteria 695
74 Ga0105245_10656561 3300009098 Bacteria 1079
75 Ga0105243_10449378 3300009148 Bacteria 1209
76 Ga0105241_10084853 3300009174 Bacteria 2488
77 Ga0105241_10146801 3300009174 Bacteria 1925
78 Ga0105242_10527849 3300009176 Bacteria 1127
79 Ga0105248_10758453 3300009177 Bacteria 1095
80 Ga0105248_11472574 3300009177 Bacteria 771
81 Ga0105237_10004071 3300009545 Bacteria 17048
82 Ga0105237_11600575 3300009545 Bacteria 658
83 Ga0105237_11710565 3300009545 Bacteria 636
84 Ga0105237_11964657 3300009545 Bacteria 593
85 Ga0105238_10518704 3300009551 Bacteria 1194
86 Ga0105238_12945886 3300009551 Bacteria 512
87 Ga0105239_10022556 3300010375 Bacteria 6941
88 Ga0105239_10062710 3300010375 Bacteria 4080
89 Ga0105239_11009941 3300010375 Bacteria 956
90 Ga0105239_11062577 3300010375 Bacteria 932
91 Ga0105239_11958274 3300010375 Bacteria 680
92 Ga0105246_10715028 3300011119 Bacteria 879
93 Ga0105246_11917706 3300011119 Bacteria 569
94 Ga0157370_10653587 3300013104 Bacteria 961
95 Ga0157370_10902059 3300013104 Bacteria 802
96 Ga0157369_10437706 3300013105 Bacteria 1355
97 Ga0157374_12176913 3300013296 Bacteria 581
98 Ga0157375_10449802 3300013308 Bacteria 1454
99 Ga0157375_10850686 3300013308 Bacteria 1059
100 Ga0163163_10406144 3300014325 Bacteria 1420
101 Ga0163163_11933234 3300014325 Bacteria 650
102 Ga0163161_10559221 3300017792 Bacteria 938
103 Ga0214542_1000025 3300021321 Bacteria 183588
104 Ga0214542_1025070 3300021321 Bacteria 3196
105 Ga0214545_1000014 3300021324 Bacteria 183588
106 Ga0214545_1026265 3300021324 Bacteria 3196
107 Ga0214543_1000034 3300021327 Bacteria 183712
108 Ga0214543_1037800 3300021327 Bacteria 1418
109 Ga0214543_1046971 3300021327 Bacteria 938
110 Ga0209563_107742 3300025230 Bacteria 1742
111 Ga0207425_1052334 3300025245 Bacteria 741
112 Ga0209677_105527 3300025253 Bacteria 3272
113 Ga0209148_1000250 3300025254 Bacteria 85755
114 Ga0209233_1007282 3300025261 Bacteria 3515
115 Ga0209233_1012099 3300025261 Bacteria 2514
116 Ga0209233_1045612 3300025261 Bacteria 921
117 Ga0209564_1004543 3300025295 Bacteria 8427
118 Ga0209758_1000141 3300025297 Bacteria 172481
119 Ga0209758_1002489 3300025297 Bacteria 18724
120 Ga0209758_1002656 3300025297 Bacteria 17698
121 Ga0209758_1004664 3300025297 Bacteria 11209
122 Ga0209758_1006949 3300025297 Bacteria 7890
123 Ga0209758_1024528 3300025297 Bacteria 2684
124 Ga0209256_1005035 3300025299 Bacteria 7885
125 Ga0209256_1065104 3300025299 Bacteria 836
126 Ga0207426_1001130 3300025302 Bacteria 24183
127 Ga0207426_1002781 3300025302 Bacteria 10527
128 Ga0207426_1010387 3300025302 Bacteria 3614
129 Ga0209051_1075663 3300025303 Bacteria 993
130 Ga0209257_1008027 3300025304 Bacteria 6153
131 Ga0209257_1154959 3300025304 Bacteria 501
132 Ga0207656_10178731 3300025321 Bacteria 1018
133 Ga0207647_10613887 3300025904 Bacteria 599
134 Ga0207699_10765649 3300025906 Bacteria 709
135 Ga0207705_10094974 3300025909 Bacteria 2187
136 Ga0207654_10216986 3300025911 Bacteria 1267
137 Ga0207654_11004885 3300025911 Bacteria 607
138 Ga0207695_10000062 3300025913 Bacteria 351979
139 Ga0207671_10010896 3300025914 Bacteria 7450
140 Ga0207671_11466834 3300025914 Bacteria 527
141 Ga0207693_10037335 3300025915 Bacteria 3829
142 Ga0207663_11040835 3300025916 Bacteria 657
143 Ga0207649_10606258 3300025920 Bacteria 842
144 Ga0207694_10908332 3300025924 Bacteria 745
145 Ga0207659_10418537 3300025926 Bacteria 1123
146 Ga0207687_10187001 3300025927 Bacteria 1609
147 Ga0207700_10168232 3300025928 Bacteria 1826
148 Ga0207700_11941032 3300025928 Bacteria 515
149 Ga0207690_11771229 3300025932 Bacteria 516
150 Ga0207709_10520868 3300025935 Bacteria 931
151 Ga0207711_10156098 3300025941 Bacteria 2062
152 Ga0207661_10450278 3300025944 Bacteria 1173
153 Ga0207679_10235543 3300025945 Bacteria 1548
154 Ga0207679_10308707 3300025945 Bacteria 1366
155 Ga0207640_10704940 3300025981 Bacteria 866
156 Ga0207640_11667815 3300025981 Bacteria 575
157 Ga0207677_11581419 3300026023 Bacteria 607
158 Ga0207639_11171645 3300026041 Bacteria 721
159 Ga0207639_11231056 3300026041 Bacteria 703
160 Ga0207678_10096623 3300026067 Bacteria 2525
161 Ga0207678_10119129 3300026067 Bacteria 2253
162 Ga0207702_10757728 3300026078 Bacteria 958
163 Ga0207702_10788139 3300026078 Bacteria 939
164 Ga0207702_10999733 3300026078 Bacteria 830
165 Ga0207641_10999731 3300026088 Bacteria 833
166 Ga0207648_10058561 3300026089 Bacteria 3360
167 Ga0207676_11110751 3300026095 Bacteria 782
168 Ga0207683_10530618 3300026121 Bacteria 1088
169 Ga0207683_10702865 3300026121 Bacteria 937
170 Ga0207698_10087218 3300026142 Bacteria 2541
171 Ga0207698_10572163 3300026142 Bacteria 1110
172 Ga0209389_1000004 3300027296 Bacteria 263759
173 Ga0209389_1000023 3300027296 Bacteria 150730
174 Ga0209589_1000010 3300027357 Bacteria 237657
175 Ga0209489_100011 3300027361 Bacteria 244710
176 Ga0209489_100295 3300027361 Bacteria 87273
177 Ga0209700_100013 3300027363 Bacteria 341906
178 Ga0268266_10154808 3300028379 Bacteria 2069
179 Ga0268266_10216994 3300028379 Bacteria 1757
180 Ga0268266_10775813 3300028379 Bacteria 925
181 Ga0268266_11111043 3300028379 Bacteria 765
182 Ga0307508_10361374 3300031616 Bacteria 1043
183 Ga0307518_10362293 3300031838 Bacteria 836
184 Ga0307510_10066188 3300033180 Bacteria 3651
185 Ga0373925_0716249 3300037068 Bacteria 825
186 Ga0395899_0093709 3300037312 Bacteria 2174
187 Ga0395900_0070462 3300037418 Bacteria 3594
188 Ga0395900_0074736 3300037418 Bacteria 3484
189 Ga0395898_0025787 3300037466 Bacteria 5920
190 Ga0395905_0001880 3300037471 Bacteria 24197
191 Ga0395905_0021085 3300037471 Bacteria 6170
192 Ga0395905_0179771 3300037471 Bacteria 1986
193 Ga0395901_0050184 3300038443 Bacteria 4336
194 Ga0395901_0606724 3300038443 Bacteria 1103
195 Ga0395901_1144318 3300038443 Bacteria 747
196 Ga0436365_1617917 3300039437 Bacteria 1662
197 Ga0451793_1039646 3300041452 Bacteria 1595
198 Ga0451795_0937440 3300041456 Bacteria 944
199 Ga0451800_0295393 3300041459 Bacteria 579
200 Ga0451802_1164245 3300041460 Bacteria 685
201 Ga0451807_2605205 3300041486 Bacteria 660
202 Ga0451839_1498512 3300041496 Bacteria 1236
203 Ga0451841_0360177 3300041498 Bacteria 1292
204 Ga0451847_0468780 3300041503 Bacteria 1001
205 Ga0451853_2762354 3300041512 Bacteria 1242
206 Ga0466972_0000185 3300044658 Bacteria 48335
207 Ga0466972_0159335 3300044658 Bacteria 1060
208 Ga0466965_0033463 3300044683 Bacteria 2512
209 Ga0466966_0003231 3300044684 Bacteria 10743
210 Ga0466966_0254641 3300044684 Bacteria 1057
211 Ga0466961_0000149 3300044693 Bacteria 47561
212 Ga0466964_0217133 3300044706 Bacteria 927
213 Ga0466968_0020483 3300044735 Bacteria 2670
214 Ga0466970_0485575 3300044765 Bacteria 710
215 Ga0466959_0002125 3300045049 Bacteria 12544
216 Ga0466958_0293755 3300045836 Bacteria 1043
217 Ga0466967_1313484 3300045976 Bacteria 720
218 Ga0495592_0018397 3300046454 Bacteria 5314
219 Ga0495592_0242582 3300046454 Bacteria 1195
220 Ga0495629_0001978 3300046459 Bacteria 15974
221 Ga0495629_0407255 3300046459 Bacteria 924
222 Ga0495638_0070345 3300046460 Bacteria 2142
223 Ga0495651_0005132 3300046462 Bacteria 9987
224 Ga0495651_0020034 3300046462 Bacteria 5190
225 Ga0495653_0717684 3300046463 Bacteria 606
226 Ga0495605_0171528 3300046474 Bacteria 958
227 Ga0495664_0019691 3300046477 Bacteria 3883
228 Ga0495664_0692602 3300046477 Bacteria 602
229 Ga0495585_0075331 3300046492 Bacteria 1835
230 Ga0495585_0168919 3300046492 Bacteria 1131
231 Ga0495607_0072448 3300046501 Bacteria 1918
232 Ga0495583_0204156 3300046506 Bacteria 802
233 Ga0495606_0089725 3300046507 Bacteria 1893
234 Ga0495606_0090155 3300046507 Bacteria 1887
235 Ga0495606_0286410 3300046507 Bacteria 898
236 Ga0495606_0349417 3300046507 Bacteria 785
237 Ga0495610_0043036 3300046512 Bacteria 2253
238 Ga0495618_0319281 3300046514 Bacteria 962
239 Ga0495618_0567963 3300046514 Bacteria 678
240 Ga0495620_0083544 3300046515 Bacteria 1289
241 Ga0495628_0041832 3300046516 Bacteria 3657
242 Ga0495628_0820558 3300046516 Bacteria 650
243 Ga0495643_0075038 3300046522 Bacteria 1770
244 Ga0495643_0256487 3300046522 Bacteria 814
245 Ga0495648_0197133 3300046524 Bacteria 1011
246 Ga0495648_0227965 3300046524 Bacteria 914
247 Ga0495648_0286089 3300046524 Bacteria 779
248 Ga0495652_0006382 3300046529 Bacteria 10976
249 Ga0495652_0028004 3300046529 Bacteria 4962
250 Ga0495640_0113325 3300046533 Bacteria 1769
251 Ga0495640_0232055 3300046533 Bacteria 1160
252 Ga0495587_0012318 3300046536 Bacteria 5389
253 Ga0495609_0026520 3300046538 Bacteria 2653
254 Ga0495645_0064635 3300046543 Bacteria 2647
255 Ga0495622_0037933 3300046557 Bacteria 2243
256 Ga0495667_0003325 3300046559 Bacteria 10762
257 Ga0495668_0355399 3300046616 Bacteria 804
258 Ga0495634_0050010 3300046642 Bacteria 2809
259 Ga0495611_0336631 3300046648 Bacteria 693
260 Ga0495625_0599781 3300046660 Bacteria 661
261 Ga0495635_0020196 3300046663 Bacteria 4641
262 Ga0495635_0117799 3300046663 Bacteria 1812
263 Ga0495661_0345522 3300046665 Bacteria 734
264 Ga0495588_0024225 3300046674 Bacteria 3013
265 Ga0495657_0101287 3300046675 Bacteria 1835
266 Ga0495599_0055282 3300046678 Bacteria 2486
267 Ga0495623_0003727 3300046679 Bacteria 10051
268 Ga0495646_0048859 3300046680 Bacteria 2569
269 Ga0495658_0228367 3300046683 Bacteria 1167
270 Ga0495669_0290222 3300046684 Bacteria 788
271 Ga0495669_0547364 3300046684 Bacteria 563
272 Ga0495613_0131745 3300046689 Bacteria 1790
273 Ga0495613_0164637 3300046689 Bacteria 1576
274 Ga0495624_0847360 3300046690 Bacteria 539
275 Ga0495671_0102451 3300046692 Bacteria 1399
276 Ga0495671_0231588 3300046692 Bacteria 893
277 Ga0495649_0080910 3300046694 Bacteria 1737
278 Ga0495649_0379602 3300046694 Bacteria 711
279 Ga0495589_0059824 3300046794 Bacteria 1872
280 Ga0495600_0017476 3300046809 Bacteria 4563
281 Ga0495600_0136605 3300046809 Bacteria 1592
282 Ga0495581_0314126 3300047315 Bacteria 915
283 Ga0495604_0004384 3300047317 Bacteria 11173
284 Ga0495604_0013302 3300047317 Bacteria 6552
285 Ga0495604_0742682 3300047317 Bacteria 621
286 Ga0495674_0325014 3300047319 Bacteria 1252
287 Ga0495674_0824212 3300047319 Bacteria 720
288 Ga0495676_0034778 3300047321 Bacteria 4224
289 Ga0495680_0010819 3300047322 Bacteria 8123
290 Ga0495687_261209 3300047443 Bacteria 511
291 Ga0495675_0049127 3300047444 Bacteria 2682
292 Ga0495673_0144299 3300047469 Bacteria 925
293 Ga0495684_0080366 3300047471 Bacteria 2475
294 Ga0495686_0030915 3300047472 Bacteria 3475
295 Ga0495686_0580480 3300047472 Bacteria 582
296 Ga0495686_0654828 3300047472 Bacteria 539
297 Ga0495593_0041858 3300047673 Bacteria 2461
298 Ga0495593_0449537 3300047673 Bacteria 645
299 Ga0495602_0018268 3300048088 Bacteria 7008
300 Ga0495626_0167747 3300048091 Bacteria 917
301 Ga0496100_0041752 3300048903 Bacteria 2926
302 Ga0496100_0071164 3300048903 Bacteria 2321
303 Ga0496101_0060682 3300048904 Bacteria 2745
304 Ga0496101_0121218 3300048904 Bacteria 1977
305 Ga0496101_0624347 3300048904 Bacteria 852
306 Ga0496101_0906811 3300048904 Bacteria 694
307 Ga0496102_0170385 3300048905 Bacteria 2050
308 Ga0496102_0857379 3300048905 Bacteria 830
309 Ga0496104_0045128 3300048907 Bacteria 4144
310 Ga0496104_0661548 3300048907 Bacteria 953
311 Ga0496104_0677370 3300048907 Bacteria 939
312 Ga0496105_0023102 3300048908 Bacteria 5042
313 Ga0496105_0110210 3300048908 Bacteria 2272
314 Ga0496105_0600317 3300048908 Bacteria 854
315 Ga0496107_0148746 3300048910 Bacteria 1732
316 Ga0496107_0423653 3300048910 Bacteria 989
317 Ga0496108_0390498 3300048911 Bacteria 1215
318 Ga0496109_0173611 3300048912 Bacteria 2023
319 Ga0496110_0852686 3300048913 Bacteria 816
320 Ga0496110_1232131 3300048913 Bacteria 657
321 Ga0496111_0359630 3300048914 Bacteria 1077
322 Ga0496112_1155703 3300048915 Bacteria 691
323 Ga0496113_1004497 3300048916 Bacteria 657
324 Ga0496113_1439106 3300048916 Bacteria 533
325 Ga0496114_0132916 3300048917 Bacteria 2150
326 Ga0496114_0205228 3300048917 Bacteria 1727
327 Ga0496115_0057961 3300048918 Bacteria 3116
328 Ga0496116_0149500 3300048919 Bacteria 1300
329 Ga0496118_0017414 3300048921 Bacteria 6542
330 Ga0496118_0266073 3300048921 Bacteria 964
331 Ga0496119_0022940 3300048922 Bacteria 4445
332 Ga0496119_0164335 3300048922 Bacteria 1177
333 Ga0496119_0259282 3300048922 Bacteria 873
334 Ga0496120_0007504 3300048923 Bacteria 8098
335 Ga0496121_0016255 3300048924 Bacteria 7696
336 Ga0496121_0081320 3300048924 Bacteria 2565
337 Ga0496123_0162595 3300048926 Bacteria 1188
338 Ga0496123_0535250 3300048926 Bacteria 506
339 Ga0496124_0138364 3300048927 Bacteria 1925
340 Ga0496124_0312558 3300048927 Bacteria 1129
341 Ga0496124_0649710 3300048927 Bacteria 677
342 Ga0496125_0051715 3300048928 Bacteria 3385
343 Ga0496125_0260472 3300048928 Bacteria 1087
344 Ga0496125_0663351 3300048928 Bacteria 559
345 Ga0496126_0021919 3300048929 Bacteria 6231
346 Ga0496126_0186271 3300048929 Bacteria 1760
347 Ga0496126_0263488 3300048929 Bacteria 1432
348 Ga0496126_0273422 3300048929 Bacteria 1401
349 Ga0496126_0943293 3300048929 Bacteria 651
350 Ga0496126_1132444 3300048929 Bacteria 579
351 Ga0495682_0168179 3300049460 Bacteria 780
352 Ga0501068_0428179 3300049584 Bacteria 855
353 nmdc:mga03683_198846_c1 3300050489 Bacteria 919
354 nmdc:mga00v17_376199_c1 3300050491 Bacteria 923
355 nmdc:mga00v17_915966_c1 3300050491 Bacteria 554
356 nmdc:mga0yw44_269639_c1 3300050492 Bacteria 1136
357 nmdc:mga0yw44_32165_c1 3300050492 Bacteria 3055
358 nmdc:mga0yw44_512811_c1 3300050492 Bacteria 814
359 nmdc:mga0yw44_65382_c1 3300050492 Bacteria 2241
360 nmdc:mga0k408_305921_c1 3300050493 Bacteria 949
361 nmdc:mga06z11_227735_c1 3300050494 Bacteria 1091
362 nmdc:mga06z11_867262_c1 3300050494 Bacteria 550
363 nmdc:mga07m45_147672_c1 3300050496 Bacteria 1363
364 nmdc:mga07m45_259836_c1 3300050496 Bacteria 1010
365 nmdc:mga0sz30_208703_c1 3300050516 Bacteria 868
366 nmdc:mga0sz30_97187_c1 3300050516 Bacteria 1285
367 Ga0500610_0182609 3300053079 Bacteria 1026
368 Ga0495655_0023983 3300053083 Bacteria 1413
369 Ga0495619_0105461 3300053085 Bacteria 1922
370 Ga0495619_0455329 3300053085 Bacteria 882
371 Ga0500578_0273465 3300053086 Bacteria 1010
372 Ga0500578_0302901 3300053086 Bacteria 947
373 Ga0500578_0621277 3300053086 Bacteria 591
374 Ga0500643_000197 3300053087 Bacteria 57531
375 Ga0500644_0521630 3300053088 Bacteria 524
376 Ga0500647_0083497 3300053091 Bacteria 1532
377 Ga0500583_0006974 3300053092 Bacteria 3935
378 Ga0500651_0768675 3300053093 Bacteria 510
379 Ga0500566_0001770 3300053094 Bacteria 12702
380 Ga0500640_132348 3300053095 Bacteria 981
381 Ga0500641_0073996 3300053096 Bacteria 1438
382 Ga0500650_0108264 3300053098 Bacteria 1298
383 Ga0500650_0346814 3300053098 Bacteria 650
384 Ga0500555_002205 3300053103 Bacteria 5691
385 Ga0500557_000029 3300053105 Bacteria 77152
386 Ga0500562_086421 3300053108 Bacteria 850
387 Ga0500569_004068 3300053109 Bacteria 3046
388 Ga0500572_011837 3300053111 Bacteria 2121
389 Ga0500592_011639 3300053116 Bacteria 1407
390 Ga0500594_0006754 3300053118 Bacteria 2584
391 Ga0500595_061822 3300053119 Bacteria 1129
392 Ga0500607_224882 3300053121 Bacteria 777
393 Ga0500614_034973 3300053123 Bacteria 1249
394 Ga0500621_200268 3300053126 Bacteria 708
395 Ga0500621_272083 3300053126 Bacteria 557
396 Ga0500626_310238 3300053128 Bacteria 552
397 Ga0500642_0000220 3300053130 Bacteria 22666
398 Ga0500642_0024025 3300053130 Bacteria 2456
399 Ga0500655_014162 3300053133 Bacteria 1458
400 Ga0500559_0016271 3300053136 Bacteria 3140
401 Ga0500559_0123272 3300053136 Bacteria 1206
402 Ga0500568_0004912 3300053139 Bacteria 7037
403 Ga0500590_183602 3300053148 Bacteria 905
404 Ga0500590_228560 3300053148 Bacteria 760
405 Ga0500590_355483 3300053148 Bacteria 521
406 Ga0500616_0052103 3300053153 Bacteria 2153
407 Ga0500620_026169 3300053155 Bacteria 1804
408 Ga0500622_0016912 3300053156 Bacteria 3889
409 Ga0500627_0002350 3300053158 Bacteria 5590
410 Ga0500633_0121593 3300053160 Bacteria 971
411 Ga0500634_0017558 3300053161 Bacteria 3831
412 Ga0500638_182119 3300053162 Bacteria 905
413 Ga0500638_309841 3300053162 Bacteria 605
414 Ga0500636_0001022 3300053177 Bacteria 14982
415 Ga0500636_0444707 3300053177 Bacteria 588
416 Ga0500625_018471 3300053729 Bacteria 3266
417 Ga0500645_060258 3300053730 Bacteria 1098
418 Ga0500609_009509 3300053731 Bacteria 1310
419 Ga0500599_001216 3300053736 Bacteria 2942
420 Ga0500601_000222 3300053737 Bacteria 11210
421 Ga0500661_028723 3300055283 Bacteria 981
422 2507510961 2507262055 Bacteria 8048963
423 2508544783 2508501009 Bacteria 7784016
424 2508696989 2508501042 Bacteria 8719808
425 2511394877 2511231028 Bacteria 8046582
426 2513623444 2513237092 Bacteria 8341956
427 2513701445 2513237102 Bacteria 7703324
428 2513874613 2513237139 Bacteria 8737671
429 2514015476 2513237161 Bacteria 8871253
430 2515625484 2515154112 Bacteria 8294334
431 2517100546 2517093001 Bacteria 9002274
432 2528849867 2528768022 Bacteria 10457665
433 2617350736 2617270735 Bacteria 9163226
434 2617377873 2617270741 Bacteria 8201522
435 2793064619 2791355196 Bacteria 7323613
436 2805916610 2802429603 Bacteria 8777136
437 2824624693 2824617872 Bacteria 8814715
438 2824633272 2824626560 Bacteria 8813858
439 2824640624 2824635225 Bacteria 8785348
440 2824649848 2824644064 Bacteria 8743947
441 2824657846 2824653114 Bacteria 8493680
442 2824667474 2824661429 Bacteria 9877870
443 2824686073 2824679649 Bacteria 8248951
444 2824703292 2824696289 Bacteria 8335049
445 2824711847 2824704595 Bacteria 9667483
446 2824720106 2824714736 Bacteria 8717648
447 2824728476 2824723954 Bacteria 8758240
448 2824738168 2824732956 Bacteria 7810675
449 2824750534 2824746037 Bacteria 7911610
450 2824761015 2824753945 Bacteria 9787441
451 2824770556 2824763712 Bacteria 9792355
452 2824780457 2824773399 Bacteria 8360218
453 2838127857 2838122688 Bacteria 8803140
454 2841943150 2841941048 Bacteria 8688029
455 2841956171 2841949485 Bacteria 8680857
456 2841960262 2841957949 Bacteria 8652217
457 2841968209 2841966195 Bacteria 8673214
458 2841987954 2841983080 Bacteria 8395090
459 2842042741 2842038055 Bacteria 8002051
460 2842050783 2842045827 Bacteria 8006841
461 2844316959 2844315083 Bacteria 8138177
462 2847938520 2847930680 Bacteria 9342022
463 2847944276 2847939898 Bacteria 8606328
464 2849081492 2849076700 Bacteria 7039503
465 2857512150 2857509624 Bacteria 7472071
466 2874615779 2874612657 Bacteria 8252029
467 2874630603 2874628541 Bacteria 8630250
468 2874649263 2874645413 Bacteria 8214782
469 2879086235 2879083081 Bacteria 8587928
470 2879132534 2879127579 Bacteria 8294491
471 2879146033 2879142872 Bacteria 8267021
472 2881370643 2881364244 Bacteria 7710352
473 2881667397 2881665667 Bacteria 8175609
474 2888389064 2888388044 Bacteria 7304136
475 2888421973 2888419890 Bacteria 7857137
476 2903734006 2903727486 Bacteria 8281579
477 2904667294 2904666416 Bacteria 8226587
478 2904719171 2904711408 Bacteria 9771557
479 2906604622 2906602504 Bacteria 8295279
480 2906651878 2906643746 Bacteria 8722424
481 2908782072 2908775508 Bacteria 8092255
482 2922371242
483 2922393834 2922393267 Bacteria 8285685
484 2929619627 2929615660 Bacteria 9193770
485 2929627902 2929624759 Bacteria 9339455
486 2932785954 2932784394 Bacteria 9704911
487 2932798269 2932794094 Bacteria 7915132
488 2932804065 2932801729 Bacteria 7987968
489 2932817326 2932809354 Bacteria 9135765
490 2932826923 2932818245 Bacteria 9955613
491 2932830998 2932828146 Bacteria 9745859
492 2933581546 2933577622 Bacteria 9116884
493 2935621063 2935616580 Bacteria 9032984
494 2935640139 2935638405 Bacteria 10015038
495 2935655406 2935648319 Bacteria 8801166
496 2935664293 2935656913 Bacteria 8965014
497 2935667022 2935665750 Bacteria 9571747
498 2935680334 2935675223 Bacteria 9928132
499 2935690154 2935684952 Bacteria 9590419
500 2935699760 2935694250 Bacteria 9291695
501 2935704777 2935703347 Bacteria 10242284
502 2935722133 2935713505 Bacteria 9608509
503 2935731443 2935722832 Bacteria 9608746
504 2935735469 2935732158 Bacteria 9706831
505 2935745260 2935741537 Bacteria 9707219
506 2935755165 2935750917 Bacteria 9590372
507 2935762319 2935760218 Bacteria 9817913
508 2935773710 2935769743 Bacteria 7878163
509 2935788385 2935785616 Bacteria 7962367
510 2935796542 2935793552 Bacteria 8012592
511 2935803820 2935801545 Bacteria 9301974
512 2935811737 2935810662 Bacteria 9401221
513 2935829622 2935827899 Bacteria 10038562
514 2935843045 2935837841 Bacteria 9454360
515 2935858870 2935855204 Bacteria 9035059
516 2935866732 2935864058 Bacteria 9784707
517 2935876863 2935873716 Bacteria 9632195
518 2935884130 2935883170 Bacteria 7964738
519 2935976605 2935975950 Bacteria 8347125
520 2935987951 2935984226 Bacteria 8302647
521 2935993500 2935992306 Bacteria 9802711
522 2936004396 2936002035 Bacteria 9362176
523 2936018363 2936011229 Bacteria 8801034
524 2936026874 2936019824 Bacteria 8804134
525 2936035762 2936028420 Bacteria 8965941
526 2936038319 2936037263 Bacteria 9446081
527 2936053841 2936046547 Bacteria 8903709
528 2936058655 2936055302 Bacteria 8785755
529 2940561555 2940556831 Bacteria 9590747
530 2941533738 2941531003 Bacteria 7653939
531 2941544269 2941538514 Bacteria 9402094
532 3005507166 3005506211 Bacteria 6943378
533 3005594527 3005587118 Bacteria 7794411
534 3005596594 3005594810 Bacteria 8716512
535 3005712669 3005710791 Bacteria 7622528
536 3005719717 3005718088 Bacteria 8283608
537 8016516387 8016511872 Bacteria 9921665
538 8016633798 8016630954 Bacteria 9217207
539 8017060150 8017057580 Bacteria 10023680
540 8019579662 8019576017 Bacteria 10049540
541 8019614565 8019608314 Bacteria 10042931
542 8019625189 8019619141 Bacteria 9218857
543 8019636991 8019629233 Bacteria 8687553
544 8019642614 8019638758 Bacteria 9062356
545 8019649968 8019648815 Bacteria 10014479
546 8019664827 8019659431 Bacteria 8577854
547 8019681712 8019678201 Bacteria 8863603
548 8055749117 8055742211 Bacteria 9226248
549 8056969973 8056967851 Bacteria 9038162
550 Ga0075369_10055304
551 JGI25165J46597_1011240
552 JGI25153J46596_10000758
553 JGI25153J46596_10006310
554 rootH2_10019141
555 JGI25160J50197_1000575
556 JGI25160J50197_1035258
557 Ga0055539_1026248
558 Ga0055542_1005548
559 Ga0055531_10004851
560 Ga0055543_1007549
561 Ga0065165_1001432
562 Ga0065165_1004353
563 Ga0065165_1007880
564 Ga0065165_1035074
565 Ga0065165_1091261
566 Ga0070658_10225840
567 Ga0070658_10293985
568 Ga0070682_100227435
569 Ga0068868_102341628
570 Ga0070660_101163213
571 Ga0070668_100065087
572 Ga0070668_100280221
573 Ga0070669_101752463
574 Ga0070671_100717576
575 Ga0070688_100149627
576 Ga0070714_100224086
577 Ga0070713_100014120
578 Ga0070713_101394314
579 Ga0070663_100100929
580 Ga0070663_100146387
581 Ga0070663_101768625
582 Ga0070662_101702267
583 Ga0068867_100540512
584 Ga0070685_10887481
585 Ga0070679_100873188
586 Ga0070684_101941530
587 Ga0068853_101564909
588 Ga0070665_100127194
589 Ga0070665_101047580
590 Ga0068855_100397123
591 Ga0068855_101798774
592 Ga0070664_101283116
593 Ga0068857_100245967
594 Ga0068856_100447943
595 Ga0068856_102452794
596 Ga0068852_100048696
597 Ga0068852_100077563
598 Ga0068852_101176797
599 Ga0068864_101257886
600 Ga0068861_100310954
601 Ga0068851_10114103
602 Ga0068863_100352368
603 Ga0081540_1018617
604 Ga0070717_10109374
605 Ga0075365_10214946
606 Ga0075363_100309476
607 Ga0075363_100349400
608 Ga0075363_100543442
609 Ga0070716_100965289
610 Ga0075367_10303029
611 Ga0075367_10770037
612 Ga0075367_10973664
613 Ga0075369_10076490
614 Ga0075366_10070517
615 Ga0075370_10204022
616 Ga0075370_10229007
617 Ga0075370_10243348
618 Ga0099823_1035107
619 Ga0105244_10178733
620 Ga0105240_10009222
621 Ga0105240_11050091
622 Ga0105240_11547373
623 Ga0105245_10656561
624 Ga0105243_10449378
625 Ga0105241_10084853
626 Ga0105241_10146801
627 Ga0105242_10527849
628 Ga0105248_10758453
629 Ga0105248_11472574
630 Ga0105237_10004071
631 Ga0105237_11600575
632 Ga0105237_11710565
633 Ga0105237_11964657
634 Ga0105238_10518704
635 Ga0105238_12945886
636 Ga0105239_10022556
637 Ga0105239_10062710
638 Ga0105239_11009941
639 Ga0105239_11062577
640 Ga0105239_11958274
641 Ga0105246_10715028
642 Ga0105246_11917706
643 Ga0157370_10653587
644 Ga0157370_10902059
645 Ga0157369_10437706
646 Ga0157374_12176913
647 Ga0157375_10449802
648 Ga0157375_10850686
649 Ga0163163_10406144
650 Ga0163163_11933234
651 Ga0163161_10559221
652 Ga0214542_1000025
653 Ga0214542_1025070
654 Ga0214545_1000014
655 Ga0214545_1026265
656 Ga0214543_1000034
657 Ga0214543_1037800
658 Ga0214543_1046971
659 Ga0209563_107742
660 Ga0207425_1052334
661 Ga0209677_105527
662 Ga0209148_1000250
663 Ga0209233_1007282
664 Ga0209233_1012099
665 Ga0209233_1045612
666 Ga0209564_1004543
667 Ga0209758_1000141
668 Ga0209758_1002489
669 Ga0209758_1002656
670 Ga0209758_1004664
671 Ga0209758_1006949
672 Ga0209758_1024528
673 Ga0209256_1005035
674 Ga0209256_1065104
675 Ga0207426_1001130
676 Ga0207426_1002781
677 Ga0207426_1010387
678 Ga0209051_1075663
679 Ga0209257_1008027
680 Ga0209257_1154959
681 Ga0207656_10178731
682 Ga0207647_10613887
683 Ga0207699_10765649
684 Ga0207705_10094974
685 Ga0207654_10216986
686 Ga0207654_11004885
687 Ga0207695_10000062
688 Ga0207671_10010896
689 Ga0207671_11466834
690 Ga0207693_10037335
691 Ga0207663_11040835
692 Ga0207649_10606258
693 Ga0207694_10908332
694 Ga0207659_10418537
695 Ga0207687_10187001
696 Ga0207700_10168232
697 Ga0207700_11941032
698 Ga0207690_11771229
699 Ga0207709_10520868
700 Ga0207711_10156098
701 Ga0207661_10450278
702 Ga0207679_10235543
703 Ga0207679_10308707
704 Ga0207640_10704940
705 Ga0207640_11667815
706 Ga0207677_11581419
707 Ga0207639_11171645
708 Ga0207639_11231056
709 Ga0207678_10096623
710 Ga0207678_10119129
711 Ga0207702_10757728
712 Ga0207702_10788139
713 Ga0207702_10999733
714 Ga0207641_10999731
715 Ga0207648_10058561
716 Ga0207676_11110751
717 Ga0207683_10530618
718 Ga0207683_10702865
719 Ga0207698_10087218
720 Ga0207698_10572163
721 Ga0209389_1000004
722 Ga0209389_1000023
723 Ga0209589_1000010
724 Ga0209489_100011
725 Ga0209489_100295
726 Ga0209700_100013
727 Ga0268266_10154808
728 Ga0268266_10216994
729 Ga0268266_10775813
730 Ga0268266_11111043
731 Ga0307508_10361374
732 Ga0307518_10362293
733 Ga0307510_10066188
734 Ga0373925_0716249
735 Ga0395899_0093709
736 Ga0395900_0070462
737 Ga0395900_0074736
738 Ga0395898_0025787
739 Ga0395905_0001880
740 Ga0395905_0021085
741 Ga0395905_0179771
742 Ga0395901_0050184
743 Ga0395901_0606724
744 Ga0395901_1144318
745 Ga0436365_1617917
746 Ga0451793_1039646
747 Ga0451795_0937440
748 Ga0451800_0295393
749 Ga0451802_1164245
750 Ga0451807_2605205
751 Ga0451839_1498512
752 Ga0451841_0360177
753 Ga0451847_0468780
754 Ga0451853_2762354
755 Ga0466972_0000185
756 Ga0466972_0159335
757 Ga0466965_0033463
758 Ga0466966_0003231
759 Ga0466966_0254641
760 Ga0466961_0000149
761 Ga0466964_0217133
762 Ga0466968_0020483
763 Ga0466970_0485575
764 Ga0466959_0002125
765 Ga0466958_0293755
766 Ga0466967_1313484
767 Ga0495592_0018397
768 Ga0495592_0242582
769 Ga0495629_0001978
770 Ga0495629_0407255
771 Ga0495638_0070345
772 Ga0495651_0005132
773 Ga0495651_0020034
774 Ga0495653_0717684
775 Ga0495605_0171528
776 Ga0495664_0019691
777 Ga0495664_0692602
778 Ga0495585_0075331
779 Ga0495585_0168919
780 Ga0495607_0072448
781 Ga0495583_0204156
782 Ga0495606_0089725
783 Ga0495606_0090155
784 Ga0495606_0286410
785 Ga0495606_0349417
786 Ga0495610_0043036
787 Ga0495618_0319281
788 Ga0495618_0567963
789 Ga0495620_0083544
790 Ga0495628_0041832
791 Ga0495628_0820558
792 Ga0495643_0075038
793 Ga0495643_0256487
794 Ga0495648_0197133
795 Ga0495648_0227965
796 Ga0495648_0286089
797 Ga0495652_0006382
798 Ga0495652_0028004
799 Ga0495640_0113325
800 Ga0495640_0232055
801 Ga0495587_0012318
802 Ga0495609_0026520
803 Ga0495645_0064635
804 Ga0495622_0037933
805 Ga0495667_0003325
806 Ga0495668_0355399
807 Ga0495634_0050010
808 Ga0495611_0336631
809 Ga0495625_0599781
810 Ga0495635_0020196
811 Ga0495635_0117799
812 Ga0495661_0345522
813 Ga0495588_0024225
814 Ga0495657_0101287
815 Ga0495599_0055282
816 Ga0495623_0003727
817 Ga0495646_0048859
818 Ga0495658_0228367
819 Ga0495669_0290222
820 Ga0495669_0547364
821 Ga0495613_0131745
822 Ga0495613_0164637
823 Ga0495624_0847360
824 Ga0495671_0102451
825 Ga0495671_0231588
826 Ga0495649_0080910
827 Ga0495649_0379602
828 Ga0495589_0059824
829 Ga0495600_0017476
830 Ga0495600_0136605
831 Ga0495581_0314126
832 Ga0495604_0004384
833 Ga0495604_0013302
834 Ga0495604_0742682
835 Ga0495674_0325014
836 Ga0495674_0824212
837 Ga0495676_0034778
838 Ga0495680_0010819
839 Ga0495687_261209
840 Ga0495675_0049127
841 Ga0495673_0144299
842 Ga0495684_0080366
843 Ga0495686_0030915
844 Ga0495686_0580480
845 Ga0495686_0654828
846 Ga0495593_0041858
847 Ga0495593_0449537
848 Ga0495602_0018268
849 Ga0495626_0167747
850 Ga0496100_0041752
851 Ga0496100_0071164
852 Ga0496101_0060682
853 Ga0496101_0121218
854 Ga0496101_0624347
855 Ga0496101_0906811
856 Ga0496102_0170385
857 Ga0496102_0857379
858 Ga0496104_0045128
859 Ga0496104_0661548
860 Ga0496104_0677370
861 Ga0496105_0023102
862 Ga0496105_0110210
863 Ga0496105_0600317
864 Ga0496107_0148746
865 Ga0496107_0423653
866 Ga0496108_0390498
867 Ga0496109_0173611
868 Ga0496110_0852686
869 Ga0496110_1232131
870 Ga0496111_0359630
871 Ga0496112_1155703
872 Ga0496113_1004497
873 Ga0496113_1439106
874 Ga0496114_0132916
875 Ga0496114_0205228
876 Ga0496115_0057961
877 Ga0496116_0149500
878 Ga0496118_0017414
879 Ga0496118_0266073
880 Ga0496119_0022940
881 Ga0496119_0164335
882 Ga0496119_0259282
883 Ga0496120_0007504
884 Ga0496121_0016255
885 Ga0496121_0081320
886 Ga0496123_0162595
887 Ga0496123_0535250
888 Ga0496124_0138364
889 Ga0496124_0312558
890 Ga0496124_0649710
891 Ga0496125_0051715
892 Ga0496125_0260472
893 Ga0496125_0663351
894 Ga0496126_0021919
895 Ga0496126_0186271
896 Ga0496126_0263488
897 Ga0496126_0273422
898 Ga0496126_0943293
899 Ga0496126_1132444
900 Ga0495682_0168179
901 Ga0501068_0428179
902 nmdc:mga03683_198846_c1
903 nmdc:mga00v17_376199_c1
904 nmdc:mga00v17_915966_c1
905 nmdc:mga0yw44_269639_c1
906 nmdc:mga0yw44_32165_c1
907 nmdc:mga0yw44_512811_c1
908 nmdc:mga0yw44_65382_c1
909 nmdc:mga0k408_305921_c1
910 nmdc:mga06z11_227735_c1
911 nmdc:mga06z11_867262_c1
912 nmdc:mga07m45_147672_c1
913 nmdc:mga07m45_259836_c1
914 nmdc:mga0sz30_208703_c1
915 nmdc:mga0sz30_97187_c1
916 Ga0500610_0182609
917 Ga0495655_0023983
918 Ga0495619_0105461
919 Ga0495619_0455329
920 Ga0500578_0273465
921 Ga0500578_0302901
922 Ga0500578_0621277
923 Ga0500643_000197
924 Ga0500644_0521630
925 Ga0500647_0083497
926 Ga0500583_0006974
927 Ga0500651_0768675
928 Ga0500566_0001770
929 Ga0500640_132348
930 Ga0500641_0073996
931 Ga0500650_0108264
932 Ga0500650_0346814
933 Ga0500555_002205
934 Ga0500557_000029
935 Ga0500562_086421
936 Ga0500569_004068
937 Ga0500572_011837
938 Ga0500592_011639
939 Ga0500594_0006754
940 Ga0500595_061822
941 Ga0500607_224882
942 Ga0500614_034973
943 Ga0500621_200268
944 Ga0500621_272083
945 Ga0500626_310238
946 Ga0500642_0000220
947 Ga0500642_0024025
948 Ga0500655_014162
949 Ga0500559_0016271
950 Ga0500559_0123272
951 Ga0500568_0004912
952 Ga0500590_183602
953 Ga0500590_228560
954 Ga0500590_355483
955 Ga0500616_0052103
956 Ga0500620_026169
957 Ga0500622_0016912
958 Ga0500627_0002350
959 Ga0500633_0121593
960 Ga0500634_0017558
961 Ga0500638_182119
962 Ga0500638_309841
963 Ga0500636_0001022
964 Ga0500636_0444707
965 Ga0500625_018471
966 Ga0500645_060258
967 Ga0500609_009509
968 Ga0500599_001216
969 Ga0500601_000222
970 Ga0500661_028723
971 2507510961
972 2508544783
973 2508696989
974 2511394877
975 2513623444
976 2513701445
977 2513874613
978 2514015476
979 2515625484
980 2517100546
981 2528849867
982 2617350736
983 2617377873
984 2793064619
985 2805916610
986 2824624693
987 2824633272
988 2824640624
989 2824649848
990 2824657846
991 2824667474
992 2824686073
993 2824703292
994 2824711847
995 2824720106
996 2824728476
997 2824738168
998 2824750534
999 2824761015
1000 2824770556
1001 2824780457
1002 2838127857
1003 2841943150
1004 2841956171
1005 2841960262
1006 2841968209
1007 2841987954
1008 2842042741
1009 2842050783
1010 2844316959
1011 2847938520
1012 2847944276
1013 2849081492
1014 2857512150
1015 2874615779
1016 2874630603
1017 2874649263
1018 2879086235
1019 2879132534
1020 2879146033
1021 2881370643
1022 2881667397
1023 2888389064
1024 2888421973
1025 2903734006
1026 2904667294
1027 2904719171
1028 2906604622
1029 2906651878
1030 2908782072
1031 2922371242
1032 2922393834
1033 2929619627
1034 2929627902
1035 2932785954
1036 2932798269
1037 2932804065
1038 2932817326
1039 2932826923
1040 2932830998
1041 2933581546
1042 2935621063
1043 2935640139
1044 2935655406
1045 2935664293
1046 2935667022
1047 2935680334
1048 2935690154
1049 2935699760
1050 2935704777
1051 2935722133
1052 2935731443
1053 2935735469
1054 2935745260
1055 2935755165
1056 2935762319
1057 2935773710
1058 2935788385
1059 2935796542
1060 2935803820
1061 2935811737
1062 2935829622
1063 2935843045
1064 2935858870
1065 2935866732
1066 2935876863
1067 2935884130
1068 2935976605
1069 2935987951
1070 2935993500
1071 2936004396
1072 2936018363
1073 2936026874
1074 2936035762
1075 2936038319
1076 2936053841
1077 2936058655
1078 2940561555
1079 2941533738
1080 2941544269
1081 3005507166
1082 3005594527
1083 3005596594
1084 3005712669
1085 3005719717
1086 8016516387
1087 8016633798
1088 8017060150
1089 8019579662
1090 8019614565
1091 8019625189
1092 8019636991
1093 8019642614
1094 8019649968
1095 8019664827
1096 8019681712
1097 8055749117
1098 8056969973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15919

HicB_lk_antitox

HicB_like antitoxin of bacterial toxin-antitoxin system

18

103

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hpc-assembly1.cif.gz_A crystal structure of the hicb antitoxin from e. coli 0.8103 3 90
6g1n-assembly1.cif.gz_B crystal structure of the burkholderia pseudomallei antitoxin hicb 0.787 1 87
6g1c-assembly1.cif.gz_C crystal structure of the n-terminal domain of burkholderia pseudomallei antitoxin hicb 0.7837 3 89
6g1c-assembly1.cif.gz_C crystal structure of the n-terminal domain of burkholderia pseudomallei antitoxin hicb 0.7592 3 89
6g1n-assembly1.cif.gz_D crystal structure of the burkholderia pseudomallei antitoxin hicb 0.7465 1 87
ID Description Score Start End Superfamily
af_P67697_1_89_3.30.160.250 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8078 3 90 3.30.160.250
af_P33229_4_54_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7501 6 39 2.20.25.10
4p78B00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7366 3 86 3.30.160.250
4p78B00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6796 3 86 3.30.160.250
af_P67697_1_89_3.30.160.250 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6706 3 90 3.30.160.250
ID Description Score Start End GO Terms
AF-A0A1I7GMQ7-F1-model_v4 deleted 0.9149 1 96
AF-A0A1H7X0Y0-F1-model_v4 Predicted nuclease of the RNAse H fold, HicB family 0.9144 1 86
AF-A0A1I7GMQ7-F1-model_v4 deleted 0.906 1 96
AF-A0A0D6JBL3-F1-model_v4 HicB-like antitoxin of toxin-antitoxin system domain-containing protein 0.8982 1 85
AF-A0A849HUI8-F1-model_v4 HicB family protein 0.88 1 87

Map