F462339

General Info

Members Datasets Scaffolds Average Seq Length
549 262 1098 128

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1099361|Ga0081540_10993612
Length 152
Sequence MNTSAVLVGLGPGENPGDTRIVSLPPMFVHTERVRFRDLDPMGHVNNAVFLTYIESARVAFLQHLGAATTLEDMSIIVARIEIDFRAPVGFGEDVGISVRASRFGGKSFDLDYVLRVGDTVVAEAKSVLVAYDYGKGEAVELPDDWREKLAA

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
147 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
148 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
183 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
184 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
185 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
189 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
192 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
193 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
194 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 14.03
Rhizosphere 83.79
Stem 0
Stem Tuber 0
Unclassified 19.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1099361 3300005983 Bacteria 1258
2 JGI25404J52841_10037812 3300003659 Bacteria 1025
3 JGI25404J52841_10077918 3300003659 Unclassified 692
4 Ga0070676_10195930 3300005328 Unclassified 1322
5 Ga0070683_100231496 3300005329 Bacteria 1757
6 Ga0070683_100422510 3300005329 Bacteria 1272
7 Ga0070683_101028779 3300005329 Archaea 791
8 Ga0070690_100048076 3300005330 Bacteria 2716
9 Ga0068869_100414340 3300005334 Archaea 1111
10 Ga0070680_100055406 3300005336 Bacteria 3240
11 Ga0070682_100062763 3300005337 Unclassified 2354
12 Ga0070682_100259185 3300005337 Unclassified 1258
13 Ga0068868_100343147 3300005338 Unclassified 1277
14 Ga0070691_10613247 3300005341 Unclassified 644
15 Ga0070668_100685219 3300005347 Archaea 903
16 Ga0070668_101211841 3300005347 Bacteria 684
17 Ga0070669_100241016 3300005353 Archaea 1436
18 Ga0070671_100107766 3300005355 Bacteria 2339
19 Ga0070671_101620625 3300005355 Archaea 574
20 Ga0070673_102113965 3300005364 Unclassified 535
21 Ga0070709_11002317 3300005434 Unclassified 664
22 Ga0070714_100023849 3300005435 Bacteria 5032
23 Ga0070714_100051246 3300005435 Bacteria 3518
24 Ga0070714_100691482 3300005435 Bacteria 984
25 Ga0070713_100050535 3300005436 Bacteria 3435
26 Ga0070713_100276065 3300005436 Bacteria 1540
27 Ga0070713_100408376 3300005436 Unclassified 1269
28 Ga0070713_100718114 3300005436 Unclassified 955
29 Ga0070710_10021676 3300005437 Bacteria 3352
30 Ga0070710_10035437 3300005437 Bacteria 2721
31 Ga0070710_10207404 3300005437 Bacteria 1240
32 Ga0070701_10158627 3300005438 Bacteria 1309
33 Ga0070701_10540865 3300005438 Unclassified 763
34 Ga0070711_100023398 3300005439 Bacteria 4017
35 Ga0070711_100070557 3300005439 Bacteria 2460
36 Ga0070705_100131813 3300005440 Bacteria 1631
37 Ga0070700_100188761 3300005441 Archaea 1439
38 Ga0070694_100115904 3300005444 Bacteria 1915
39 Ga0070694_100477574 3300005444 Archaea 989
40 Ga0070708_100432299 3300005445 Bacteria 1242
41 Ga0070663_100904318 3300005455 Archaea 763
42 Ga0070662_101139101 3300005457 Unclassified 670
43 Ga0070681_10433441 3300005458 Unclassified 1226
44 Ga0068867_100817224 3300005459 Archaea 832
45 Ga0070685_11137082 3300005466 Bacteria 591
46 Ga0070706_100563239 3300005467 Archaea 1060
47 Ga0070706_101384214 3300005467 Bacteria 644
48 Ga0070699_100310088 3300005518 Bacteria 1417
49 Ga0070679_100027403 3300005530 Bacteria 5607
50 Ga0070679_100358918 3300005530 Unclassified 1405
51 Ga0070684_100095441 3300005535 Bacteria 2649
52 Ga0070697_100954541 3300005536 Bacteria 761
53 Ga0070672_101042884 3300005543 Archaea 725
54 Ga0070686_100132416 3300005544 Unclassified 1726
55 Ga0070686_100209711 3300005544 Unclassified 1401
56 Ga0070695_100168915 3300005545 Unclassified 1542
57 Ga0070696_100090374 3300005546 Bacteria 2179
58 Ga0070696_100099065 3300005546 Bacteria 2086
59 Ga0070696_101118202 3300005546 Unclassified 663
60 Ga0070693_100004041 3300005547 Bacteria 6901
61 Ga0070704_100076420 3300005549 Bacteria 2449
62 Ga0070704_100262044 3300005549 Bacteria 1424
63 Ga0070704_100394168 3300005549 Bacteria 1180
64 Ga0068857_101413418 3300005577 Bacteria 677
65 Ga0068854_100928083 3300005578 Unclassified 767
66 Ga0068856_100038708 3300005614 Bacteria 4681
67 Ga0068856_100098626 3300005614 Bacteria 2912
68 Ga0068856_100377631 3300005614 Bacteria 1436
69 Ga0070702_100092959 3300005615 Bacteria 1833
70 Ga0070702_100145108 3300005615 Bacteria 1516
71 Ga0068852_100685993 3300005616 Archaea 1034
72 Ga0068864_100183980 3300005618 Bacteria 1912
73 Ga0068866_10730591 3300005718 Unclassified 682
74 Ga0068861_100284803 3300005719 Archaea 1424
75 Ga0068863_100229133 3300005841 Bacteria 1792
76 Ga0068858_101128248 3300005842 Archaea 770
77 Ga0068862_100094146 3300005844 Bacteria 2613
78 Ga0081455_10009873 3300005937 Bacteria 9768
79 Ga0081540_1002897 3300005983 Bacteria 13839
80 Ga0081540_1010706 3300005983 Bacteria 6181
81 Ga0081539_10001744 3300005985 Bacteria 34702
82 Ga0081539_10004194 3300005985 Bacteria 16284
83 Ga0070717_10145402 3300006028 Unclassified 2047
84 Ga0070717_10350127 3300006028 Archaea 1321
85 Ga0070717_10466109 3300006028 Bacteria 1140
86 Ga0075432_10006755 3300006058 Bacteria 3908
87 Ga0070715_10001689 3300006163 Bacteria 6560
88 Ga0070715_10017762 3300006163 Unclassified 2697
89 Ga0070716_100006193 3300006173 Bacteria 5839
90 Ga0070716_100184277 3300006173 Archaea 1373
91 Ga0070716_100282840 3300006173 Bacteria 1145
92 Ga0070716_100790167 3300006173 Bacteria 734
93 Ga0070712_100003672 3300006175 Bacteria 9461
94 Ga0070712_100004135 3300006175 Bacteria 8921
95 Ga0070712_100137584 3300006175 Bacteria 1859
96 Ga0070712_100194197 3300006175 Archaea 1590
97 Ga0070712_100519930 3300006175 Bacteria 1000
98 Ga0097621_100121613 3300006237 Bacteria 2214
99 Ga0068871_100186010 3300006358 Unclassified 1787
100 Ga0075428_100002467 3300006844 Bacteria 20074
101 Ga0075428_100219488 3300006844 Bacteria 2053
102 Ga0075428_100856381 3300006844 Bacteria 965
103 Ga0075430_100622455 3300006846 Bacteria 890
104 Ga0075431_100065847 3300006847 Archaea 3741
105 Ga0075431_100079647 3300006847 Bacteria 3381
106 Ga0075433_10006383 3300006852 Bacteria 9326
107 Ga0075433_10149508 3300006852 Bacteria 2077
108 Ga0075433_10956580 3300006852 Unclassified 746
109 Ga0075434_100013389 3300006871 Bacteria 7802
110 Ga0075434_100107766 3300006871 Bacteria 2796
111 Ga0075434_100228704 3300006871 Bacteria 1879
112 Ga0075434_100270571 3300006871 Archaea 1718
113 Ga0075434_101920420 3300006871 Bacteria 598
114 Ga0075436_100017490 3300006914 Bacteria 4909
115 Ga0075436_100060178 3300006914 Bacteria 2623
116 Ga0075436_100101431 3300006914 Unclassified 2005
117 Ga0075436_100530957 3300006914 Unclassified 863
118 Ga0075435_100010954 3300007076 Bacteria 6647
119 Ga0075435_100013957 3300007076 Bacteria 5990
120 Ga0075435_100093057 3300007076 Archaea 2490
121 Ga0075435_100105206 3300007076 Bacteria 2342
122 Ga0075435_100177837 3300007076 Bacteria 1797
123 Ga0111539_10347493 3300009094 Archaea 1726
124 Ga0111539_10360930 3300009094 Unclassified 1691
125 Ga0111539_12394883 3300009094 Unclassified 612
126 Ga0105245_10018013 3300009098 Bacteria 6168
127 Ga0105245_10287574 3300009098 Archaea 1609
128 Ga0105247_10631466 3300009101 Archaea 798
129 Ga0105247_11059250 3300009101 Unclassified 637
130 Ga0105247_11199245 3300009101 Archaea 604
131 Ga0114129_10015779 3300009147 Bacteria 10740
132 Ga0114129_10029455 3300009147 Bacteria 7776
133 Ga0114129_10141355 3300009147 Archaea 3299
134 Ga0114129_10632913 3300009147 Bacteria 1382
135 Ga0114129_10948041 3300009147 Bacteria 1087
136 Ga0114129_11242291 3300009147 Archaea 926
137 Ga0114129_12136916 3300009147 Bacteria 675
138 Ga0114129_12283292 3300009147 Archaea 650
139 Ga0105243_10548386 3300009148 Bacteria 1104
140 Ga0105243_10956708 3300009148 Bacteria 856
141 Ga0105243_11349300 3300009148 Archaea 732
142 Ga0105243_11585105 3300009148 Archaea 681
143 Ga0105241_10071981 3300009174 Unclassified 2685
144 Ga0105241_10517034 3300009174 Bacteria 1067
145 Ga0105242_10328249 3300009176 Bacteria 1406
146 Ga0105242_10329842 3300009176 Bacteria 1403
147 Ga0105242_11853220 3300009176 Archaea 643
148 Ga0105248_10288899 3300009177 Bacteria 1846
149 Ga0105248_12010083 3300009177 Unclassified 657
150 Ga0105249_10273757 3300009553 Bacteria 1683
151 Ga0105249_10308914 3300009553 Bacteria 1589
152 Ga0105249_10543943 3300009553 Archaea 1211
153 Ga0105249_12292555 3300009553 Unclassified 613
154 Ga0105239_10119326 3300010375 Bacteria 2927
155 Ga0105239_11091754 3300010375 Bacteria 918
156 Ga0157371_10081967 3300013102 Bacteria 2284
157 Ga0157370_11512363 3300013104 Archaea 603
158 Ga0157374_10305434 3300013296 Bacteria 1575
159 Ga0157374_11079234 3300013296 Archaea 823
160 Ga0157378_10160561 3300013297 Archaea 2102
161 Ga0157378_11099296 3300013297 Bacteria 832
162 Ga0163162_10381658 3300013306 Archaea 1542
163 Ga0163162_10793119 3300013306 Bacteria 1065
164 Ga0157372_10285451 3300013307 Bacteria 1919
165 Ga0157372_11019447 3300013307 Unclassified 958
166 Ga0157372_12360742 3300013307 Archaea 611
167 Ga0157375_10048162 3300013308 Bacteria 4168
168 Ga0157375_10591620 3300013308 Archaea 1269
169 Ga0157375_11118909 3300013308 Bacteria 922
170 Ga0157375_11176729 3300013308 Unclassified 899
171 Ga0163163_10045948 3300014325 Bacteria 4288
172 Ga0163163_10991116 3300014325 Bacteria 903
173 Ga0157380_10214582 3300014326 Archaea 1717
174 Ga0157376_10184084 3300014969 Unclassified 1911
175 Ga0157376_10319752 3300014969 Archaea 1475
176 Ga0157376_12399975 3300014969 Archaea 567
177 Ga0182005_1172706 3300015265 Unclassified 638
178 Ga0197907_11180918 3300020069 Unclassified 653
179 Ga0207692_10021861 3300025898 Unclassified 2934
180 Ga0207692_10036484 3300025898 Bacteria 2397
181 Ga0207692_10250874 3300025898 Archaea 1060
182 Ga0207692_10717776 3300025898 Archaea 650
183 Ga0207710_10596549 3300025900 Archaea 577
184 Ga0207688_10230081 3300025901 Bacteria 1119
185 Ga0207685_10004779 3300025905 Bacteria 3491
186 Ga0207685_10032012 3300025905 Bacteria 1889
187 Ga0207685_10120248 3300025905 Unclassified 1152
188 Ga0207685_10608161 3300025905 Archaea 587
189 Ga0207699_10741441 3300025906 Archaea 720
190 Ga0207699_10864305 3300025906 Unclassified 666
191 Ga0207684_10113001 3300025910 Bacteria 2325
192 Ga0207684_10550064 3300025910 Archaea 987
193 Ga0207654_10218578 3300025911 Unclassified 1263
194 Ga0207707_10391904 3300025912 Unclassified 1193
195 Ga0207693_10006074 3300025915 Bacteria 10003
196 Ga0207693_10012081 3300025915 Bacteria 6981
197 Ga0207693_10015299 3300025915 Bacteria 6157
198 Ga0207693_10015308 3300025915 Bacteria 6155
199 Ga0207693_10017930 3300025915 Bacteria 5644
200 Ga0207663_10002688 3300025916 Bacteria 8578
201 Ga0207663_10052252 3300025916 Unclassified 2548
202 Ga0207663_10136428 3300025916 Archaea 1703
203 Ga0207663_10413598 3300025916 Bacteria 1034
204 Ga0207663_11218122 3300025916 Bacteria 606
205 Ga0207660_10007669 3300025917 Bacteria 6988
206 Ga0207662_10199762 3300025918 Bacteria 1294
207 Ga0207649_10770568 3300025920 Archaea 749
208 Ga0207652_10881666 3300025921 Bacteria 791
209 Ga0207646_10059448 3300025922 Bacteria 3414
210 Ga0207646_10681054 3300025922 Bacteria 920
211 Ga0207681_10211649 3300025923 Archaea 1495
212 Ga0207687_11358677 3300025927 Unclassified 611
213 Ga0207700_10081161 3300025928 Bacteria 2532
214 Ga0207700_11655822 3300025928 Archaea 565
215 Ga0207664_10083010 3300025929 Bacteria 2611
216 Ga0207664_10486451 3300025929 Archaea 1104
217 Ga0207664_10515751 3300025929 Archaea 1071
218 Ga0207664_10704231 3300025929 Bacteria 908
219 Ga0207664_11159685 3300025929 Unclassified 690
220 Ga0207644_10038027 3300025931 Bacteria 3388
221 Ga0207644_10344178 3300025931 Bacteria 1210
222 Ga0207644_10756605 3300025931 Bacteria 812
223 Ga0207690_10779438 3300025932 Archaea 789
224 Ga0207706_10025218 3300025933 Bacteria 5330
225 Ga0207706_10277067 3300025933 Bacteria 1463
226 Ga0207686_10240441 3300025934 Archaea 1317
227 Ga0207686_10254357 3300025934 Bacteria 1285
228 Ga0207686_10429573 3300025934 Unclassified 1012
229 Ga0207709_10132110 3300025935 Bacteria 1703
230 Ga0207709_11145492 3300025935 Unclassified 640
231 Ga0207670_10211669 3300025936 Bacteria 1479
232 Ga0207670_11748884 3300025936 Archaea 529
233 Ga0207704_10135428 3300025938 Unclassified 1713
234 Ga0207665_10009872 3300025939 Bacteria 6264
235 Ga0207665_10023738 3300025939 Bacteria 4039
236 Ga0207665_10069080 3300025939 Bacteria 2408
237 Ga0207665_11228494 3300025939 Bacteria 598
238 Ga0207691_10828724 3300025940 Archaea 776
239 Ga0207711_10372040 3300025941 Unclassified 1325
240 Ga0207661_10334341 3300025944 Bacteria 1364
241 Ga0207661_10429946 3300025944 Archaea 1200
242 Ga0207661_11100902 3300025944 Archaea 731
243 Ga0207679_10403116 3300025945 Unclassified 1203
244 Ga0207651_10448163 3300025960 Unclassified 1107
245 Ga0207712_10158446 3300025961 Unclassified 1756
246 Ga0207712_10473720 3300025961 Unclassified 1066
247 Ga0207668_11028361 3300025972 Archaea 737
248 Ga0207640_10700870 3300025981 Unclassified 868
249 Ga0207677_10143067 3300026023 Bacteria 1834
250 Ga0207677_10600562 3300026023 Bacteria 966
251 Ga0207677_11123182 3300026023 Archaea 717
252 Ga0207639_10564223 3300026041 Archaea 1046
253 Ga0207678_10123501 3300026067 Unclassified 2209
254 Ga0207678_10401466 3300026067 Bacteria 1187
255 Ga0207708_10040147 3300026075 Bacteria 3567
256 Ga0207708_10698648 3300026075 Unclassified 867
257 Ga0207708_10826899 3300026075 Bacteria 798
258 Ga0207702_10003936 3300026078 Bacteria 13350
259 Ga0207641_10117001 3300026088 Bacteria 2373
260 Ga0207648_10327744 3300026089 Archaea 1377
261 Ga0207648_10763739 3300026089 Bacteria 898
262 Ga0207676_10135360 3300026095 Bacteria 2101
263 Ga0207674_10868419 3300026116 Bacteria 870
264 Ga0207675_100090870 3300026118 Bacteria 2871
265 Ga0207675_100146452 3300026118 Bacteria 2246
266 Ga0207683_10001031 3300026121 Bacteria 25414
267 Ga0207683_10367136 3300026121 Archaea 1322
268 Ga0207698_10077731 3300026142 Bacteria 2662
269 Ga0207428_10008568 3300027907 Bacteria 9228
270 Ga0207428_10452160 3300027907 Archaea 936
271 Ga0268266_11559934 3300028379 Unclassified 636
272 Ga0268265_10986062 3300028380 Archaea 832
273 Ga0307405_10206377 3300031731 Bacteria 1431
274 Ga0307409_100749256 3300031995 Bacteria 980
275 Ga0307409_101743040 3300031995 Unclassified 652
276 Ga0307409_101803705 3300031995 Unclassified 641
277 Ga0307416_100711907 3300032002 Bacteria 1094
278 Ga0307416_100875854 3300032002 Unclassified 997
279 Ga0307416_100910079 3300032002 Bacteria 980
280 Ga0307415_100042131 3300032126 Bacteria 3037
281 Ga0307415_100676873 3300032126 Bacteria 928
282 Ga0373930_0005376 3300034816 Bacteria 2127
283 Ga0373948_0042788 3300034817 Unclassified 952
284 Ga0373950_0004593 3300034818 Bacteria 2027
285 Ga0373958_0006228 3300034819 Bacteria 1850
286 Ga0373958_0203286 3300034819 Archaea 520
287 Ga0373959_0002029 3300034820 Bacteria 3222
288 Ga0373938_0003160 3300034957 Bacteria 2675
289 Ga0373938_0160434 3300034957 Archaea 603
290 Ga0373926_0118352 3300035083 Archaea 998
291 Ga0373928_0000609 3300035084 Bacteria 7018
292 Ga0373928_0022301 3300035084 Unclassified 1342
293 Ga0373929_0001858 3300035085 Bacteria 3957
294 Ga0373940_0031706 3300035088 Unclassified 1412
295 Ga0373940_0318917 3300035088 Archaea 539
296 Ga0373944_0135252 3300035089 Archaea 859
297 Ga0373949_0001462 3300035090 Bacteria 6744
298 Ga0373949_0075928 3300035090 Archaea 888
299 Ga0373949_0123763 3300035090 Bacteria 728
300 Ga0373949_0150206 3300035090 Archaea 673
301 Ga0373951_0078404 3300035091 Unclassified 851
302 Ga0373952_0004065 3300035092 Bacteria 2643
303 Ga0373952_0054753 3300035092 Unclassified 960
304 Ga0373932_0000528 3300035112 Bacteria 11744
305 Ga0373932_0018245 3300035112 Bacteria 1812
306 Ga0373939_0002955 3300035114 Bacteria 3993
307 Ga0373939_0006096 3300035114 Bacteria 2897
308 Ga0373939_0110081 3300035114 Bacteria 958
309 Ga0373941_0001839 3300035115 Bacteria 4573
310 Ga0373941_0111893 3300035115 Archaea 963
311 Ga0373941_0237402 3300035115 Archaea 707
312 Ga0373945_0031177 3300035116 Archaea 1883
313 Ga0373945_0398573 3300035116 Unclassified 603
314 Ga0373960_0000769 3300035121 Bacteria 6711
315 Ga0373960_0007464 3300035121 Bacteria 2592
316 Ga0373943_0475364 3300035170 Bacteria 728
317 Ga0373943_0621352 3300035170 Archaea 637
318 Ga0373946_0025091 3300035171 Bacteria 2342
319 Ga0373942_0001445 3300035207 Bacteria 6094
320 Ga0373942_0033265 3300035207 Unclassified 1374
321 Ga0373942_0252263 3300035207 Archaea 600
322 Ga0373961_0129545 3300035241 Bacteria 844
323 Ga0373962_0002824 3300035242 Bacteria 4148
324 Ga0373962_0025456 3300035242 Unclassified 1590
325 Ga0373962_0276048 3300035242 Unclassified 590
326 Ga0373931_0000222 3300035691 Bacteria 24235
327 Ga0373931_0152026 3300035691 Bacteria 1350
328 Ga0373931_0479289 3300035691 Unclassified 799
329 Ga0373935_0044367 3300035692 Bacteria 2802
330 Ga0373927_0122527 3300035695 Bacteria 1697
331 Ga0373947_0017241 3300035725 Bacteria 4153
332 Ga0373947_0697622 3300035725 Bacteria 692
333 Ga0373937_0416262 3300036401 Bacteria 1275
334 Ga0373925_0022036 3300037068 Bacteria 4643
335 Ga0395899_0142851 3300037312 Bacteria 1702
336 Ga0395899_0144343 3300037312 Unclassified 1691
337 Ga0395899_0238883 3300037312 Bacteria 1251
338 Ga0395899_0410081 3300037312 Bacteria 895
339 Ga0395900_0003096 3300037418 Bacteria 18061
340 Ga0395900_0004308 3300037418 Bacteria 15090
341 Ga0395900_0047205 3300037418 Bacteria 4434
342 Ga0395900_0107344 3300037418 Bacteria 2868
343 Ga0395900_0147792 3300037418 Archaea 2402
344 Ga0395900_0250358 3300037418 Bacteria 1773
345 Ga0395900_0316285 3300037418 Unclassified 1543
346 Ga0395900_1012616 3300037418 Bacteria 750
347 Ga0395900_1440778 3300037418 Bacteria 601
348 Ga0395898_0002328 3300037466 Bacteria 22664
349 Ga0395898_0050100 3300037466 Bacteria 4088
350 Ga0395898_0082849 3300037466 Bacteria 3092
351 Ga0395898_0110843 3300037466 Bacteria 2630
352 Ga0395898_0152949 3300037466 Bacteria 2207
353 Ga0395898_0267638 3300037466 Bacteria 1630
354 Ga0395898_0354624 3300037466 Bacteria 1399
355 Ga0395905_0006266 3300037471 Bacteria 12006
356 Ga0395905_0163981 3300037471 Bacteria 2088
357 Ga0395905_0217236 3300037471 Bacteria 1790
358 Ga0395905_0298478 3300037471 Bacteria 1498
359 Ga0395905_0678797 3300037471 Unclassified 932
360 Ga0395901_0009681 3300038443 Bacteria 9774
361 Ga0395901_0017072 3300038443 Bacteria 7399
362 Ga0395901_0026155 3300038443 Bacteria 5992
363 Ga0395901_0169879 3300038443 Bacteria 2288
364 Ga0395901_0188675 3300038443 Bacteria 2162
365 Ga0395901_0210854 3300038443 Bacteria 2033
366 Ga0395901_0405910 3300038443 Bacteria 1399
367 Ga0395901_0541227 3300038443 Bacteria 1181
368 Ga0395901_0570507 3300038443 Archaea 1144
369 Ga0242420_068360 3300038996 Archaea 719
370 Ga0451791_1900519 3300041451 Archaea 1826
371 Ga0451797_1261825 3300041453 Archaea 874
372 Ga0451795_1480427 3300041456 Archaea 1059
373 Ga0451800_0756811 3300041459 Bacteria 2832
374 Ga0451806_574502 3300041462 Archaea 511
375 Ga0451804_0217607 3300041463 Unclassified 888
376 Ga0451807_1094284 3300041486 Archaea 988
377 Ga0451833_0261430 3300041491 Archaea 816
378 Ga0451835_0508574 3300041492 Archaea 806
379 Ga0451837_0610944 3300041494 Bacteria 929
380 Ga0451839_0291819 3300041496 Bacteria 1839
381 Ga0451841_0308071 3300041498 Bacteria 1526
382 Ga0451847_0360035 3300041503 Bacteria 3395
383 Ga0451849_0442296 3300041505 Bacteria 4092
384 Ga0451849_1130477 3300041505 Bacteria 750
385 Ga0451851_1024612 3300041507 Unclassified 906
386 Ga0451853_1201227 3300041512 Bacteria 850
387 Ga0451853_2736643 3300041512 Bacteria 1116
388 Ga0439448_0020460 3300042005 Bacteria 2047
389 Ga0439464_0022080 3300042439 Bacteria 1751
390 Ga0466965_0296708 3300044683 Bacteria 876
391 Ga0451576_0006071 3300045051 Bacteria 14903
392 Ga0451576_0602999 3300045051 Unclassified 1154
393 Ga0451576_0726059 3300045051 Bacteria 1044
394 Ga0466967_0024631 3300045976 Bacteria 4951
395 Ga0466967_0505247 3300045976 Bacteria 1187
396 Ga0495603_0001374 3300046455 Bacteria 14134
397 Ga0495603_0281791 3300046455 Archaea 955
398 Ga0495641_0001029 3300046461 Bacteria 23958
399 Ga0495580_0111104 3300046472 Archaea 1903
400 Ga0495582_0148786 3300046473 Archaea 1329
401 Ga0495582_0856696 3300046473 Bacteria 525
402 Ga0495605_0121120 3300046474 Archaea 1186
403 Ga0495605_0386075 3300046474 Archaea 584
404 Ga0495639_0072279 3300046475 Bacteria 1595
405 Ga0495585_0097865 3300046492 Bacteria 1573
406 Ga0495594_0012167 3300046499 Bacteria 4480
407 Ga0495596_0052648 3300046500 Bacteria 1594
408 Ga0495616_0363446 3300046513 Archaea 601
409 Ga0495630_0595464 3300046517 Bacteria 848
410 Ga0495644_0051431 3300046523 Bacteria 1547
411 Ga0495644_0109283 3300046523 Archaea 1049
412 Ga0495642_0117487 3300046528 Archaea 1140
413 Ga0495642_0470571 3300046528 Unclassified 556
414 Ga0495656_0036980 3300046615 Bacteria 2014
415 Ga0495588_0001380 3300046674 Bacteria 10369
416 Ga0495588_0758797 3300046674 Bacteria 507
417 Ga0495658_0196929 3300046683 Archaea 1254
418 Ga0495613_0206426 3300046689 Unclassified 1383
419 Ga0495613_0242147 3300046689 Bacteria 1261
420 Ga0495613_0344341 3300046689 Bacteria 1025
421 Ga0495676_0022953 3300047321 Bacteria 5421
422 Ga0495676_0075207 3300047321 Bacteria 2584
423 Ga0495676_0225074 3300047321 Bacteria 1291
424 Ga0495677_0205110 3300047445 Unclassified 767
425 Ga0496100_0170196 3300048903 Unclassified 1568
426 Ga0496100_0178741 3300048903 Unclassified 1533
427 Ga0496100_1035461 3300048903 Archaea 646
428 Ga0496100_1153299 3300048903 Unclassified 611
429 Ga0496101_0129719 3300048904 Unclassified 1913
430 Ga0496101_0158059 3300048904 Unclassified 1737
431 Ga0496101_1189610 3300048904 Archaea 597
432 Ga0496102_0221858 3300048905 Bacteria 1782
433 Ga0496102_0274135 3300048905 Bacteria 1590
434 Ga0496102_0442473 3300048905 Unclassified 1219
435 Ga0496102_0862486 3300048905 Archaea 827
436 Ga0496103_0086066 3300048906 Unclassified 1981
437 Ga0496103_0090411 3300048906 Unclassified 1931
438 Ga0496103_0157710 3300048906 Bacteria 1455
439 Ga0496103_0300011 3300048906 Archaea 1033
440 Ga0496103_0554492 3300048906 Archaea 733
441 Ga0496104_0000904 3300048907 Bacteria 25446
442 Ga0496104_0005665 3300048907 Bacteria 10939
443 Ga0496104_0343493 3300048907 Unclassified 1405
444 Ga0496105_0000042 3300048908 Bacteria 114886
445 Ga0496105_0039325 3300048908 Bacteria 3898
446 Ga0496105_0057793 3300048908 Bacteria 3202
447 Ga0496105_0090412 3300048908 Bacteria 2528
448 Ga0496105_0624973 3300048908 Unclassified 834
449 Ga0496105_0773406 3300048908 Bacteria 732
450 Ga0496106_0083918 3300048909 Bacteria 2450
451 Ga0496106_0129479 3300048909 Bacteria 1978
452 Ga0496106_0311336 3300048909 Bacteria 1263
453 Ga0496106_0581384 3300048909 Archaea 898
454 Ga0496107_0090753 3300048910 Unclassified 2232
455 Ga0496107_0161203 3300048910 Bacteria 1662
456 Ga0496107_0552307 3300048910 Archaea 853
457 Ga0496107_1114686 3300048910 Bacteria 570
458 Ga0496108_0004712 3300048911 Bacteria 11004
459 Ga0496108_0042074 3300048911 Bacteria 3813
460 Ga0496108_0252655 3300048911 Unclassified 1534
461 Ga0496109_0011012 3300048912 Bacteria 7751
462 Ga0496109_0081455 3300048912 Bacteria 2982
463 Ga0496109_0101445 3300048912 Bacteria 2671
464 Ga0496109_0659318 3300048912 Archaea 983
465 Ga0496110_0000050 3300048913 Bacteria 59023
466 Ga0496110_0001458 3300048913 Bacteria 17154
467 Ga0496110_0068869 3300048913 Bacteria 3133
468 Ga0496110_0414704 3300048913 Bacteria 1228
469 Ga0496110_0416778 3300048913 Bacteria 1224
470 Ga0496111_0000220 3300048914 Bacteria 27215
471 Ga0496111_0001831 3300048914 Bacteria 12514
472 Ga0496111_0036682 3300048914 Unclassified 3506
473 Ga0496111_0331954 3300048914 Unclassified 1126
474 Ga0496111_0471139 3300048914 Bacteria 926
475 Ga0496111_0718614 3300048914 Bacteria 726
476 Ga0496112_0000451 3300048915 Bacteria 27356
477 Ga0496112_0005445 3300048915 Bacteria 11013
478 Ga0496112_0224376 3300048915 Unclassified 1834
479 Ga0496112_0553629 3300048915 Archaea 1084
480 Ga0496112_1242154 3300048915 Unclassified 661
481 Ga0496113_0000110 3300048916 Bacteria 35203
482 Ga0496113_0017651 3300048916 Bacteria 4959
483 Ga0496113_0241577 3300048916 Unclassified 1441
484 Ga0496113_0406225 3300048916 Bacteria 1094
485 Ga0496113_0641256 3300048916 Archaea 850
486 Ga0496113_0923838 3300048916 Archaea 689
487 Ga0496113_1029368 3300048916 Unclassified 648
488 Ga0496114_0035522 3300048917 Bacteria 4116
489 Ga0496114_0042328 3300048917 Bacteria 3775
490 Ga0496114_1121908 3300048917 Bacteria 672
491 Ga0496115_0053098 3300048918 Bacteria 3252
492 Ga0496115_0079948 3300048918 Bacteria 2661
493 Ga0496115_0116179 3300048918 Unclassified 2200
494 Ga0496115_0206139 3300048918 Archaea 1624
495 Ga0501291_140211 3300049514 Archaea 539
496 Ga0501031_0343414 3300049568 Archaea 966
497 Ga0501032_0474958 3300049569 Unclassified 800
498 Ga0501036_0210675 3300049572 Bacteria 1633
499 Ga0501040_0135591 3300049576 Bacteria 1733
500 Ga0501042_0321206 3300049578 Archaea 1118
501 Ga0501042_1199149 3300049578 Archaea 553
502 Ga0501048_0181616 3300049582 Bacteria 1491
503 Ga0501048_0546032 3300049582 Archaea 831
504 Ga0501067_0003757 3300049583 Bacteria 8366
505 Ga0501071_0157314 3300049587 Bacteria 1697
506 Ga0501071_0467561 3300049587 Archaea 966
507 Ga0501072_0393938 3300049588 Unclassified 1099
508 Ga0501072_1612903 3300049588 Unclassified 500
509 Ga0501074_0037820 3300049590 Bacteria 3497
510 Ga0501075_0073493 3300049591 Unclassified 2586
511 Ga0501081_0668167 3300049743 Archaea 779
512 Ga0501045_0378251 3300049824 Unclassified 1054
513 nmdc:mga06z11_554289_c1 3300050494 Bacteria 698
514 nmdc:mga05p37_114062_c1 3300050507 Bacteria 3322
515 nmdc:mga05p37_1303834_c1 3300050507 Bacteria 740
516 nmdc:mga05p37_41422_c1 3300050507 Bacteria 5655
517 nmdc:mga05p37_68857_c1 3300050507 Bacteria 4352
518 nmdc:mga05p37_801134_c1 3300050507 Bacteria 1031
519 nmdc:mga09592_1447850_c1 3300050508 Bacteria 560
520 nmdc:mga06r32_1561054_c1 3300050510 Bacteria 599
521 nmdc:mga08y16_209568_c1 3300050511 Unclassified 2018
522 nmdc:mga08y16_378801_c1 3300050511 Unclassified 1450
523 nmdc:mga08y16_70404_c1 3300050511 Bacteria 3647
524 nmdc:mga08y16_846155_c1 3300050511 Bacteria 904
525 nmdc:mga0n895_103217_c1 3300050512 Bacteria 2863
526 nmdc:mga0n895_1150867_c1 3300050512 Bacteria 751
527 nmdc:mga0n895_26614_c1 3300050512 Bacteria 5481
528 nmdc:mga0n895_33605_c1 3300050512 Bacteria 4931
529 nmdc:mga0n895_399118_c1 3300050512 Unclassified 1391
530 nmdc:mga0n895_658948_c1 3300050512 Bacteria 1045
531 nmdc:mga0n895_699625_c1 3300050512 Bacteria 1009
532 nmdc:mga0rr50_119820_c1 3300050513 Bacteria 2093
533 nmdc:mga0rr50_130787_c1 3300050513 Archaea 2010
534 nmdc:mga0rr50_1376426_c1 3300050513 Archaea 598
535 nmdc:mga0rr50_154839_c1 3300050513 Bacteria 1856
536 nmdc:mga0rr50_795115_c1 3300050513 Unclassified 807
537 nmdc:mga08x19_15674_c1 3300050514 Bacteria 4613
538 nmdc:mga08x19_209012_c1 3300050514 Bacteria 1339
539 nmdc:mga0a205_180286_c1 3300050515 Bacteria 2007
540 nmdc:mga0a205_20501_c1 3300050515 Bacteria 6239
541 nmdc:mga0a205_251869_c1 3300050515 Unclassified 1645
542 nmdc:mga0a205_5890_c1 3300050515 Bacteria 11042
543 nmdc:mga0a205_77938_c1 3300050515 Bacteria 3202
544 Ga0495595_0084683 3300053084 Bacteria 1515
545 Ga0501084_0189911 3300054114 Bacteria 1733
546 Ga0501084_0291767 3300054114 Bacteria 1378
547 Ga0590071_115170 3300059421 Bacteria 684
548 Ga0530510_0173106 3300061734 Bacteria 1599
549 Ga0530510_0322606 3300061734 Archaea 1158
550 Ga0081540_1099361
551 JGI25404J52841_10037812
552 JGI25404J52841_10077918
553 Ga0070676_10195930
554 Ga0070683_100231496
555 Ga0070683_100422510
556 Ga0070683_101028779
557 Ga0070690_100048076
558 Ga0068869_100414340
559 Ga0070680_100055406
560 Ga0070682_100062763
561 Ga0070682_100259185
562 Ga0068868_100343147
563 Ga0070691_10613247
564 Ga0070668_100685219
565 Ga0070668_101211841
566 Ga0070669_100241016
567 Ga0070671_100107766
568 Ga0070671_101620625
569 Ga0070673_102113965
570 Ga0070709_11002317
571 Ga0070714_100023849
572 Ga0070714_100051246
573 Ga0070714_100691482
574 Ga0070713_100050535
575 Ga0070713_100276065
576 Ga0070713_100408376
577 Ga0070713_100718114
578 Ga0070710_10021676
579 Ga0070710_10035437
580 Ga0070710_10207404
581 Ga0070701_10158627
582 Ga0070701_10540865
583 Ga0070711_100023398
584 Ga0070711_100070557
585 Ga0070705_100131813
586 Ga0070700_100188761
587 Ga0070694_100115904
588 Ga0070694_100477574
589 Ga0070708_100432299
590 Ga0070663_100904318
591 Ga0070662_101139101
592 Ga0070681_10433441
593 Ga0068867_100817224
594 Ga0070685_11137082
595 Ga0070706_100563239
596 Ga0070706_101384214
597 Ga0070699_100310088
598 Ga0070679_100027403
599 Ga0070679_100358918
600 Ga0070684_100095441
601 Ga0070697_100954541
602 Ga0070672_101042884
603 Ga0070686_100132416
604 Ga0070686_100209711
605 Ga0070695_100168915
606 Ga0070696_100090374
607 Ga0070696_100099065
608 Ga0070696_101118202
609 Ga0070693_100004041
610 Ga0070704_100076420
611 Ga0070704_100262044
612 Ga0070704_100394168
613 Ga0068857_101413418
614 Ga0068854_100928083
615 Ga0068856_100038708
616 Ga0068856_100098626
617 Ga0068856_100377631
618 Ga0070702_100092959
619 Ga0070702_100145108
620 Ga0068852_100685993
621 Ga0068864_100183980
622 Ga0068866_10730591
623 Ga0068861_100284803
624 Ga0068863_100229133
625 Ga0068858_101128248
626 Ga0068862_100094146
627 Ga0081455_10009873
628 Ga0081540_1002897
629 Ga0081540_1010706
630 Ga0081539_10001744
631 Ga0081539_10004194
632 Ga0070717_10145402
633 Ga0070717_10350127
634 Ga0070717_10466109
635 Ga0075432_10006755
636 Ga0070715_10001689
637 Ga0070715_10017762
638 Ga0070716_100006193
639 Ga0070716_100184277
640 Ga0070716_100282840
641 Ga0070716_100790167
642 Ga0070712_100003672
643 Ga0070712_100004135
644 Ga0070712_100137584
645 Ga0070712_100194197
646 Ga0070712_100519930
647 Ga0097621_100121613
648 Ga0068871_100186010
649 Ga0075428_100002467
650 Ga0075428_100219488
651 Ga0075428_100856381
652 Ga0075430_100622455
653 Ga0075431_100065847
654 Ga0075431_100079647
655 Ga0075433_10006383
656 Ga0075433_10149508
657 Ga0075433_10956580
658 Ga0075434_100013389
659 Ga0075434_100107766
660 Ga0075434_100228704
661 Ga0075434_100270571
662 Ga0075434_101920420
663 Ga0075436_100017490
664 Ga0075436_100060178
665 Ga0075436_100101431
666 Ga0075436_100530957
667 Ga0075435_100010954
668 Ga0075435_100013957
669 Ga0075435_100093057
670 Ga0075435_100105206
671 Ga0075435_100177837
672 Ga0111539_10347493
673 Ga0111539_10360930
674 Ga0111539_12394883
675 Ga0105245_10018013
676 Ga0105245_10287574
677 Ga0105247_10631466
678 Ga0105247_11059250
679 Ga0105247_11199245
680 Ga0114129_10015779
681 Ga0114129_10029455
682 Ga0114129_10141355
683 Ga0114129_10632913
684 Ga0114129_10948041
685 Ga0114129_11242291
686 Ga0114129_12136916
687 Ga0114129_12283292
688 Ga0105243_10548386
689 Ga0105243_10956708
690 Ga0105243_11349300
691 Ga0105243_11585105
692 Ga0105241_10071981
693 Ga0105241_10517034
694 Ga0105242_10328249
695 Ga0105242_10329842
696 Ga0105242_11853220
697 Ga0105248_10288899
698 Ga0105248_12010083
699 Ga0105249_10273757
700 Ga0105249_10308914
701 Ga0105249_10543943
702 Ga0105249_12292555
703 Ga0105239_10119326
704 Ga0105239_11091754
705 Ga0157371_10081967
706 Ga0157370_11512363
707 Ga0157374_10305434
708 Ga0157374_11079234
709 Ga0157378_10160561
710 Ga0157378_11099296
711 Ga0163162_10381658
712 Ga0163162_10793119
713 Ga0157372_10285451
714 Ga0157372_11019447
715 Ga0157372_12360742
716 Ga0157375_10048162
717 Ga0157375_10591620
718 Ga0157375_11118909
719 Ga0157375_11176729
720 Ga0163163_10045948
721 Ga0163163_10991116
722 Ga0157380_10214582
723 Ga0157376_10184084
724 Ga0157376_10319752
725 Ga0157376_12399975
726 Ga0182005_1172706
727 Ga0197907_11180918
728 Ga0207692_10021861
729 Ga0207692_10036484
730 Ga0207692_10250874
731 Ga0207692_10717776
732 Ga0207710_10596549
733 Ga0207688_10230081
734 Ga0207685_10004779
735 Ga0207685_10032012
736 Ga0207685_10120248
737 Ga0207685_10608161
738 Ga0207699_10741441
739 Ga0207699_10864305
740 Ga0207684_10113001
741 Ga0207684_10550064
742 Ga0207654_10218578
743 Ga0207707_10391904
744 Ga0207693_10006074
745 Ga0207693_10012081
746 Ga0207693_10015299
747 Ga0207693_10015308
748 Ga0207693_10017930
749 Ga0207663_10002688
750 Ga0207663_10052252
751 Ga0207663_10136428
752 Ga0207663_10413598
753 Ga0207663_11218122
754 Ga0207660_10007669
755 Ga0207662_10199762
756 Ga0207649_10770568
757 Ga0207652_10881666
758 Ga0207646_10059448
759 Ga0207646_10681054
760 Ga0207681_10211649
761 Ga0207687_11358677
762 Ga0207700_10081161
763 Ga0207700_11655822
764 Ga0207664_10083010
765 Ga0207664_10486451
766 Ga0207664_10515751
767 Ga0207664_10704231
768 Ga0207664_11159685
769 Ga0207644_10038027
770 Ga0207644_10344178
771 Ga0207644_10756605
772 Ga0207690_10779438
773 Ga0207706_10025218
774 Ga0207706_10277067
775 Ga0207686_10240441
776 Ga0207686_10254357
777 Ga0207686_10429573
778 Ga0207709_10132110
779 Ga0207709_11145492
780 Ga0207670_10211669
781 Ga0207670_11748884
782 Ga0207704_10135428
783 Ga0207665_10009872
784 Ga0207665_10023738
785 Ga0207665_10069080
786 Ga0207665_11228494
787 Ga0207691_10828724
788 Ga0207711_10372040
789 Ga0207661_10334341
790 Ga0207661_10429946
791 Ga0207661_11100902
792 Ga0207679_10403116
793 Ga0207651_10448163
794 Ga0207712_10158446
795 Ga0207712_10473720
796 Ga0207668_11028361
797 Ga0207640_10700870
798 Ga0207677_10143067
799 Ga0207677_10600562
800 Ga0207677_11123182
801 Ga0207639_10564223
802 Ga0207678_10123501
803 Ga0207678_10401466
804 Ga0207708_10040147
805 Ga0207708_10698648
806 Ga0207708_10826899
807 Ga0207702_10003936
808 Ga0207641_10117001
809 Ga0207648_10327744
810 Ga0207648_10763739
811 Ga0207676_10135360
812 Ga0207674_10868419
813 Ga0207675_100090870
814 Ga0207675_100146452
815 Ga0207683_10001031
816 Ga0207683_10367136
817 Ga0207698_10077731
818 Ga0207428_10008568
819 Ga0207428_10452160
820 Ga0268266_11559934
821 Ga0268265_10986062
822 Ga0307405_10206377
823 Ga0307409_100749256
824 Ga0307409_101743040
825 Ga0307409_101803705
826 Ga0307416_100711907
827 Ga0307416_100875854
828 Ga0307416_100910079
829 Ga0307415_100042131
830 Ga0307415_100676873
831 Ga0373930_0005376
832 Ga0373948_0042788
833 Ga0373950_0004593
834 Ga0373958_0006228
835 Ga0373958_0203286
836 Ga0373959_0002029
837 Ga0373938_0003160
838 Ga0373938_0160434
839 Ga0373926_0118352
840 Ga0373928_0000609
841 Ga0373928_0022301
842 Ga0373929_0001858
843 Ga0373940_0031706
844 Ga0373940_0318917
845 Ga0373944_0135252
846 Ga0373949_0001462
847 Ga0373949_0075928
848 Ga0373949_0123763
849 Ga0373949_0150206
850 Ga0373951_0078404
851 Ga0373952_0004065
852 Ga0373952_0054753
853 Ga0373932_0000528
854 Ga0373932_0018245
855 Ga0373939_0002955
856 Ga0373939_0006096
857 Ga0373939_0110081
858 Ga0373941_0001839
859 Ga0373941_0111893
860 Ga0373941_0237402
861 Ga0373945_0031177
862 Ga0373945_0398573
863 Ga0373960_0000769
864 Ga0373960_0007464
865 Ga0373943_0475364
866 Ga0373943_0621352
867 Ga0373946_0025091
868 Ga0373942_0001445
869 Ga0373942_0033265
870 Ga0373942_0252263
871 Ga0373961_0129545
872 Ga0373962_0002824
873 Ga0373962_0025456
874 Ga0373962_0276048
875 Ga0373931_0000222
876 Ga0373931_0152026
877 Ga0373931_0479289
878 Ga0373935_0044367
879 Ga0373927_0122527
880 Ga0373947_0017241
881 Ga0373947_0697622
882 Ga0373937_0416262
883 Ga0373925_0022036
884 Ga0395899_0142851
885 Ga0395899_0144343
886 Ga0395899_0238883
887 Ga0395899_0410081
888 Ga0395900_0003096
889 Ga0395900_0004308
890 Ga0395900_0047205
891 Ga0395900_0107344
892 Ga0395900_0147792
893 Ga0395900_0250358
894 Ga0395900_0316285
895 Ga0395900_1012616
896 Ga0395900_1440778
897 Ga0395898_0002328
898 Ga0395898_0050100
899 Ga0395898_0082849
900 Ga0395898_0110843
901 Ga0395898_0152949
902 Ga0395898_0267638
903 Ga0395898_0354624
904 Ga0395905_0006266
905 Ga0395905_0163981
906 Ga0395905_0217236
907 Ga0395905_0298478
908 Ga0395905_0678797
909 Ga0395901_0009681
910 Ga0395901_0017072
911 Ga0395901_0026155
912 Ga0395901_0169879
913 Ga0395901_0188675
914 Ga0395901_0210854
915 Ga0395901_0405910
916 Ga0395901_0541227
917 Ga0395901_0570507
918 Ga0242420_068360
919 Ga0451791_1900519
920 Ga0451797_1261825
921 Ga0451795_1480427
922 Ga0451800_0756811
923 Ga0451806_574502
924 Ga0451804_0217607
925 Ga0451807_1094284
926 Ga0451833_0261430
927 Ga0451835_0508574
928 Ga0451837_0610944
929 Ga0451839_0291819
930 Ga0451841_0308071
931 Ga0451847_0360035
932 Ga0451849_0442296
933 Ga0451849_1130477
934 Ga0451851_1024612
935 Ga0451853_1201227
936 Ga0451853_2736643
937 Ga0439448_0020460
938 Ga0439464_0022080
939 Ga0466965_0296708
940 Ga0451576_0006071
941 Ga0451576_0602999
942 Ga0451576_0726059
943 Ga0466967_0024631
944 Ga0466967_0505247
945 Ga0495603_0001374
946 Ga0495603_0281791
947 Ga0495641_0001029
948 Ga0495580_0111104
949 Ga0495582_0148786
950 Ga0495582_0856696
951 Ga0495605_0121120
952 Ga0495605_0386075
953 Ga0495639_0072279
954 Ga0495585_0097865
955 Ga0495594_0012167
956 Ga0495596_0052648
957 Ga0495616_0363446
958 Ga0495630_0595464
959 Ga0495644_0051431
960 Ga0495644_0109283
961 Ga0495642_0117487
962 Ga0495642_0470571
963 Ga0495656_0036980
964 Ga0495588_0001380
965 Ga0495588_0758797
966 Ga0495658_0196929
967 Ga0495613_0206426
968 Ga0495613_0242147
969 Ga0495613_0344341
970 Ga0495676_0022953
971 Ga0495676_0075207
972 Ga0495676_0225074
973 Ga0495677_0205110
974 Ga0496100_0170196
975 Ga0496100_0178741
976 Ga0496100_1035461
977 Ga0496100_1153299
978 Ga0496101_0129719
979 Ga0496101_0158059
980 Ga0496101_1189610
981 Ga0496102_0221858
982 Ga0496102_0274135
983 Ga0496102_0442473
984 Ga0496102_0862486
985 Ga0496103_0086066
986 Ga0496103_0090411
987 Ga0496103_0157710
988 Ga0496103_0300011
989 Ga0496103_0554492
990 Ga0496104_0000904
991 Ga0496104_0005665
992 Ga0496104_0343493
993 Ga0496105_0000042
994 Ga0496105_0039325
995 Ga0496105_0057793
996 Ga0496105_0090412
997 Ga0496105_0624973
998 Ga0496105_0773406
999 Ga0496106_0083918
1000 Ga0496106_0129479
1001 Ga0496106_0311336
1002 Ga0496106_0581384
1003 Ga0496107_0090753
1004 Ga0496107_0161203
1005 Ga0496107_0552307
1006 Ga0496107_1114686
1007 Ga0496108_0004712
1008 Ga0496108_0042074
1009 Ga0496108_0252655
1010 Ga0496109_0011012
1011 Ga0496109_0081455
1012 Ga0496109_0101445
1013 Ga0496109_0659318
1014 Ga0496110_0000050
1015 Ga0496110_0001458
1016 Ga0496110_0068869
1017 Ga0496110_0414704
1018 Ga0496110_0416778
1019 Ga0496111_0000220
1020 Ga0496111_0001831
1021 Ga0496111_0036682
1022 Ga0496111_0331954
1023 Ga0496111_0471139
1024 Ga0496111_0718614
1025 Ga0496112_0000451
1026 Ga0496112_0005445
1027 Ga0496112_0224376
1028 Ga0496112_0553629
1029 Ga0496112_1242154
1030 Ga0496113_0000110
1031 Ga0496113_0017651
1032 Ga0496113_0241577
1033 Ga0496113_0406225
1034 Ga0496113_0641256
1035 Ga0496113_0923838
1036 Ga0496113_1029368
1037 Ga0496114_0035522
1038 Ga0496114_0042328
1039 Ga0496114_1121908
1040 Ga0496115_0053098
1041 Ga0496115_0079948
1042 Ga0496115_0116179
1043 Ga0496115_0206139
1044 Ga0501291_140211
1045 Ga0501031_0343414
1046 Ga0501032_0474958
1047 Ga0501036_0210675
1048 Ga0501040_0135591
1049 Ga0501042_0321206
1050 Ga0501042_1199149
1051 Ga0501048_0181616
1052 Ga0501048_0546032
1053 Ga0501067_0003757
1054 Ga0501071_0157314
1055 Ga0501071_0467561
1056 Ga0501072_0393938
1057 Ga0501072_1612903
1058 Ga0501074_0037820
1059 Ga0501075_0073493
1060 Ga0501081_0668167
1061 Ga0501045_0378251
1062 nmdc:mga06z11_554289_c1
1063 nmdc:mga05p37_114062_c1
1064 nmdc:mga05p37_1303834_c1
1065 nmdc:mga05p37_41422_c1
1066 nmdc:mga05p37_68857_c1
1067 nmdc:mga05p37_801134_c1
1068 nmdc:mga09592_1447850_c1
1069 nmdc:mga06r32_1561054_c1
1070 nmdc:mga08y16_209568_c1
1071 nmdc:mga08y16_378801_c1
1072 nmdc:mga08y16_70404_c1
1073 nmdc:mga08y16_846155_c1
1074 nmdc:mga0n895_103217_c1
1075 nmdc:mga0n895_1150867_c1
1076 nmdc:mga0n895_26614_c1
1077 nmdc:mga0n895_33605_c1
1078 nmdc:mga0n895_399118_c1
1079 nmdc:mga0n895_658948_c1
1080 nmdc:mga0n895_699625_c1
1081 nmdc:mga0rr50_119820_c1
1082 nmdc:mga0rr50_130787_c1
1083 nmdc:mga0rr50_1376426_c1
1084 nmdc:mga0rr50_154839_c1
1085 nmdc:mga0rr50_795115_c1
1086 nmdc:mga08x19_15674_c1
1087 nmdc:mga08x19_209012_c1
1088 nmdc:mga0a205_180286_c1
1089 nmdc:mga0a205_20501_c1
1090 nmdc:mga0a205_251869_c1
1091 nmdc:mga0a205_5890_c1
1092 nmdc:mga0a205_77938_c1
1093 Ga0495595_0084683
1094 Ga0501084_0189911
1095 Ga0501084_0291767
1096 Ga0590071_115170
1097 Ga0530510_0173106
1098 Ga0530510_0322606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

42

124

0.96

PF13279

4HBT_2

Thioesterase-like superfamily

34

150

0.94

PF20791

Acyl-ACP_TE_C

Acyl-ACP thioesterase C-terminal domain

27

130

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9571 2 107
2cye-assembly3.cif.gz_B crystal structure of thioesterase complexed with coenzyme a and zn from thermus thermophilus hb8 0.9563 3 124
2cye-assembly3.cif.gz_C crystal structure of thioesterase complexed with coenzyme a and zn from thermus thermophilus hb8 0.9492 3 124
2f41-assembly2.cif.gz_C crystal structure of fapr- a global regulator of fatty acid biosynthesis in b. subtilis 0.9485 50 104
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9476 2 107
ID Description Score Start End Superfamily
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9571 2 107 3.10.129.10
2f41C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9485 50 104 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9476 2 107 3.10.129.10
2cyeD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9451 3 126 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9289 1 124 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7W0MZ82-F1-model_v4 Acyl-CoA thioesterase 0.9826 2 126 GO:0047617
AF-D3SXM7-F1-model_v4 Thioesterase domain protein (Thioesterase superfamily protein) 0.9804 2 124 GO:0047617
AF-A0A651DK47-F1-model_v4 Acyl-CoA thioesterase 0.9804 2 124 GO:0047617
AF-A0A6C1NUA5-F1-model_v4 Acyl-CoA thioesterase 0.9777 2 124 GO:0047617
AF-A0A2R6CFQ8-F1-model_v4 Acyl-CoA thioesterase 0.9769 2 125 GO:0047617

Map