F462297

General Info

Members Datasets Scaffolds Average Seq Length
548 409 293 238

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0000189|Ga0500573_0000189_8192_8923
Length 236
Sequence MLIIAGLGNPGAQYSGNRHNIGFMAIDAIHRRHSFSSWSKKFKALISEGELGGEKVLLVKPQTFMNLSGESVGEAMRFYKLQPENVLAVYDELDLLPGKPRIKTGGGHGXXXGIKSIDAHIGKEYRRLRLKDRVHAYVLGDFAKSDQDWLQTLLDAIADNAEMLARAEDSQFMNKLALATGTPADEEKPKPAAPKKPAGGQSHIHQARNNSAQPKILPTSGPMAEMLKKLLGPKEG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
15 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
16 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
17 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
18 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
19 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
20 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
21 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
22 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
23 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
24 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
25 2519899620 Rhizobium sp. Pop5 Isolate Nodule
26 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
27 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
28 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
29 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
30 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
31 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
32 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
33 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
34 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
35 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
36 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
37 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
38 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
39 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
40 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
41 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
42 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
43 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
44 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
45 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
46 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
47 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
48 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
49 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
50 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
51 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
52 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
53 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
54 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
55 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
56 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
57 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
58 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
59 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
60 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
61 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
62 2643221558 Rhizobium sp. Root149 Isolate Unclassified
63 2643221599 Rhizobium sp. Root708 Isolate Unclassified
64 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
65 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
66 2643221719 Rhizobium sp. Root274 Isolate Unclassified
67 2643221723 Ensifer sp. Root278 Isolate Unclassified
68 2718217882 Rhizobium sp. N741 Isolate Nodule
69 2718217927 Rhizobium sp. N324 Isolate Nodule
70 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
71 2718218009 Rhizobium sp. N561 Isolate Nodule
72 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
73 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
74 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
75 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
76 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
77 2718218363 Rhizobium sp. N113 Isolate Nodule
78 2718218365 Rhizobium sp. N731 Isolate Nodule
79 2718218366 Rhizobium sp. N621 Isolate Nodule
80 2718218423 Rhizobium sp. N941 Isolate Nodule
81 2721755514 Rhizobium sp. N6212 Isolate Nodule
82 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
83 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
84 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
85 2721755809 Rhizobium sp. N541 Isolate Nodule
86 2721755810 Rhizobium sp. N871 Isolate Nodule
87 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
88 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
89 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
90 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
91 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
92 2728369365 Rhizobium sp. N1341 Isolate Nodule
93 2728369397 Rhizobium sp. N1314 Isolate Nodule
94 2738541293 Rhizobium sp. GV031 Isolate Unclassified
95 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
96 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
97 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
98 2791355256 Rhizobium sp. M10 Isolate Nodule
99 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
100 2791355260 Rhizobium sp. L9 Isolate Nodule
101 2791355261 Rhizobium sp. J15 Isolate Nodule
102 2791355262 Rhizobium sp. M1 Isolate Nodule
103 2791355264 Rhizobium sp. S9 Isolate Nodule
104 2791355265 Rhizobium sp. H4 Isolate Nodule
105 2791355266 Rhizobium sp. L43 Isolate Nodule
106 2791355267 Rhizobium sp. L18 Isolate Nodule
107 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
108 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
109 2802429633 Rhizobium anhuiense J3 Isolate Nodule
110 2802429634 Rhizobium anhuiense S10 Isolate Nodule
111 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
112 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
113 2802429637 Rhizobium anhuiense C15 Isolate Nodule
114 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
115 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
116 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
117 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
118 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
119 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
120 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
121 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
122 2838048938 Rhizobium pisi 27/80 Isolate Nodule
123 2838061910 Rhizobium phaseoli L15 Isolate Nodule
124 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
125 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
126 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
127 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
128 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
129 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
130 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
131 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
132 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
133 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
134 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
135 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
136 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
137 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
138 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
139 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
140 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
141 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
142 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
143 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
144 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
145 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
146 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
147 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
148 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
149 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
150 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
151 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
152 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
153 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
154 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
155 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
156 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
157 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
158 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
159 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
160 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
161 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
162 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
163 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
164 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
165 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
166 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
167 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
168 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
169 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
170 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
171 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
172 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
173 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
174 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
175 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
176 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
177 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
178 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
179 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
180 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
181 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
182 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
183 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
184 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
185 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
186 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
187 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
188 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
189 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
190 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
191 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
192 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
193 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
194 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
195 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
196 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
197 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
198 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
199 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
200 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
201 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
202 2933599457 Rhizobium phaseoli M3 Isolate Nodule
203 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
204 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
205 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
206 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
207 2936381700 Rhizobium chutanense C16 Isolate Unclassified
208 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
209 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
210 2996887358 Rhizobium sp. R711 Isolate Nodule
211 2996893221 Rhizobium sp. R635 Isolate Nodule
212 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
213 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
214 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
215 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
216 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
217 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
218 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
219 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
220 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
221 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
222 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
223 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
224 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
225 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
226 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
227 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
228 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
229 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
230 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
231 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
232 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
233 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
234 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
235 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
236 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
237 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
238 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
239 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
240 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
241 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
242 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
243 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
244 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
245 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
246 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
247 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
248 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
249 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
250 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
251 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
252 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
254 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
256 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
257 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
258 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
261 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
268 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
270 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
271 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
272 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
273 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
276 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
277 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
278 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
279 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
280 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
281 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
282 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
283 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
284 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
285 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
286 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
287 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
288 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
289 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
290 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
291 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
295 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
298 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
305 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
322 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
327 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
354 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
361 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
362 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
363 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
364 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
365 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
366 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
367 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
368 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
369 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
370 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
371 8005258706 Rhizobium sp. R693 Isolate Nodule
372 8005275841 Rhizobium sp. N4311 Isolate Nodule
373 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
374 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
375 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
376 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
377 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
378 8005321885 Rhizobium sp. R72 Isolate Nodule
379 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
380 8005382845 Rhizobium sp. R634 Isolate Nodule
381 8005395548 Rhizobium sp. R339 Isolate Nodule
382 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
383 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
384 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
385 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
386 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
387 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
388 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
389 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
390 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
391 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
392 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
393 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
394 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
395 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
396 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
397 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
398 8018176218 Rhizobium sp. N122 Isolate Nodule
399 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
400 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
401 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
402 8024501048 Rhizobium sp. H4 Isolate Nodule
403 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
404 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
405 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
406 8056382006 Rhizobium croatiense 13T Isolate Nodule
407 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
408 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
409 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.1
Metatranscriptomes 0.36
Isolates 46.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.91
Nodule 33.39
Rhizoplane 3.28
Rhizosphere 20.8
Stem 0
Stem Tuber 0
Unclassified 16.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001572 3300002773 Bacteria 9598
2 JGI25152J39213_1003120 3300002773 Bacteria 5790
3 JGI25152J39213_1003379 3300002773 Bacteria 5476
4 JGI25150J39212_1001440 3300002774 Bacteria 6659
5 JGI25159J45721_1000120 3300002987 Bacteria 37322
6 JGI25159J45721_1001458 3300002987 Bacteria 9756
7 JGI25151J46595_10000280 3300003187 Bacteria 58125
8 JGI25151J46595_10020074 3300003187 Bacteria 2825
9 JGI25153J46596_10005459 3300003215 Bacteria 6663
10 JGI25153J46596_10005956 3300003215 Bacteria 6280
11 JGI25153J46596_10008146 3300003215 Bacteria 5049
12 JGI25160J50197_1000001 3300003354 Bacteria 782301
13 JGI25160J50197_1000021 3300003354 Bacteria 215789
14 JGI25160J50197_1001268 3300003354 Bacteria 12798
15 JGI25160J50197_1009037 3300003354 Bacteria 3735
16 JGI25161J50226_1000001 3300003374 Bacteria 655036
17 JGI25161J50226_1001240 3300003374 Bacteria 8244
18 JGI25161J50226_1004078 3300003374 Bacteria 3147
19 Ga0055526_1001766 3300003771 Bacteria 15022
20 Ga0055526_1006894 3300003771 Bacteria 6050
21 Ga0055526_1007936 3300003771 Bacteria 5395
22 Ga0055526_1016628 3300003771 Bacteria 2862
23 Ga0055524_1000994 3300003775 Bacteria 17704
24 Ga0055524_1017012 3300003775 Bacteria 2580
25 Ga0055524_1022782 3300003775 Bacteria 2035
26 Ga0055524_1042667 3300003775 Bacteria 1125
27 Ga0055536_1017481 3300003781 Bacteria 2344
28 Ga0055528_1000290 3300003790 Bacteria 42833
29 Ga0055528_1002459 3300003790 Bacteria 9912
30 Ga0055528_1018265 3300003790 Bacteria 2383
31 Ga0055528_1033630 3300003790 Bacteria 1280
32 Ga0055528_1038693 3300003790 Bacteria 1101
33 Ga0055530_10011441 3300003791 Bacteria 3186
34 Ga0055540_1000592 3300003792 Bacteria 26360
35 Ga0055540_1001344 3300003792 Bacteria 14812
36 Ga0055531_10004872 3300003794 Bacteria 7998
37 Ga0055543_1000003 3300004625 Bacteria 358656
38 Ga0055543_1000164 3300004625 Bacteria 55304
39 Ga0055543_1003307 3300004625 Bacteria 4831
40 Ga0065165_1000033 3300005262 Bacteria 215827
41 Ga0065165_1000335 3300005262 Bacteria 77037
42 Ga0065165_1008287 3300005262 Bacteria 4902
43 Ga0065165_1008530 3300005262 Bacteria 4769
44 Ga0070670_100049146 3300005331 Bacteria 3627
45 Ga0070671_100017144 3300005355 Bacteria 5861
46 Ga0070667_100498405 3300005367 Bacteria 1116
47 Ga0081539_10000991 3300005985 Bacteria 52737
48 Ga0075365_10002132 3300006038 Bacteria 9494
49 Ga0075365_10002309 3300006038 Bacteria 9277
50 Ga0075363_100015347 3300006048 Bacteria 3764
51 Ga0075363_100055517 3300006048 Bacteria 2122
52 Ga0075364_10000266 3300006051 Bacteria 25404
53 Ga0075362_10018986 3300006177 Bacteria 2854
54 Ga0075362_10034539 3300006177 Bacteria 2205
55 Ga0075367_10001001 3300006178 Bacteria 11597
56 Ga0075369_10000834 3300006186 Bacteria 10168
57 Ga0075369_10015394 3300006186 Bacteria 3069
58 Ga0075369_10181232 3300006186 Bacteria 969
59 Ga0075370_10006544 3300006353 Bacteria 5867
60 Ga0079104_1000045 3300006946 Bacteria 183705
61 Ga0105248_10455471 3300009177 Bacteria 1442
62 Ga0123341_1000124 3300009765 Bacteria 35033
63 Ga0123342_1014819 3300009766 Bacteria 7313
64 Ga0123342_1022183 3300009766 Bacteria 4335
65 Ga0105246_10111486 3300011119 Bacteria 2010
66 Ga0171463_1017 3300013249 Bacteria 48649
67 Ga0183363_1050 3300015690 Bacteria 38817
68 Ga0209436_100070 3300025208 Bacteria 51558
69 Ga0207425_1000055 3300025245 Bacteria 152820
70 Ga0207425_1002677 3300025245 Bacteria 6099
71 Ga0207425_1004042 3300025245 Bacteria 4498
72 Ga0207425_1004680 3300025245 Bacteria 4044
73 Ga0209129_1000029 3300025258 Bacteria 401149
74 Ga0209129_1000252 3300025258 Bacteria 55710
75 Ga0209129_1001350 3300025258 Bacteria 13855
76 Ga0209129_1004754 3300025258 Bacteria 5143
77 Ga0209129_1004826 3300025258 Bacteria 5078
78 Ga0209129_1011892 3300025258 Bacteria 2044
79 Ga0209673_1000010 3300025273 Bacteria 596656
80 Ga0209673_1000025 3300025273 Bacteria 404572
81 Ga0209673_1000878 3300025273 Bacteria 39065
82 Ga0209673_1001610 3300025273 Bacteria 19758
83 Ga0209673_1004326 3300025273 Bacteria 7663
84 Ga0209673_1008113 3300025273 Bacteria 4721
85 Ga0209673_1017874 3300025273 Bacteria 2600
86 Ga0209673_1063232 3300025273 Bacteria 914
87 Ga0209130_1000003 3300025284 Bacteria 677988
88 Ga0209130_1000017 3300025284 Bacteria 388431
89 Ga0209130_1000020 3300025284 Bacteria 379297
90 Ga0209676_1006076 3300025292 Bacteria 6077
91 Ga0209676_1011727 3300025292 Bacteria 3506
92 Ga0209676_1012962 3300025292 Bacteria 3235
93 Ga0209025_1000070 3300025294 Bacteria 287776
94 Ga0209025_1000091 3300025294 Bacteria 250401
95 Ga0209025_1000161 3300025294 Bacteria 166506
96 Ga0209025_1002035 3300025294 Bacteria 23068
97 Ga0209025_1007003 3300025294 Bacteria 8557
98 Ga0209025_1012336 3300025294 Bacteria 5494
99 Ga0209025_1035935 3300025294 Bacteria 2229
100 Ga0209564_1000013 3300025295 Bacteria 775755
101 Ga0209564_1000265 3300025295 Bacteria 110606
102 Ga0209564_1000644 3300025295 Bacteria 52727
103 Ga0209564_1001272 3300025295 Bacteria 27752
104 Ga0209564_1004372 3300025295 Bacteria 8682
105 Ga0209564_1004592 3300025295 Bacteria 8344
106 Ga0209758_1000094 3300025297 Bacteria 241068
107 Ga0209758_1002497 3300025297 Bacteria 18675
108 Ga0209758_1002519 3300025297 Bacteria 18566
109 Ga0209758_1004278 3300025297 Bacteria 12055
110 Ga0209758_1005108 3300025297 Bacteria 10385
111 Ga0209758_1005708 3300025297 Bacteria 9392
112 Ga0209758_1009652 3300025297 Bacteria 5947
113 Ga0209050_1004415 3300025298 Bacteria 9515
114 Ga0209050_1005237 3300025298 Bacteria 8269
115 Ga0209050_1023944 3300025298 Bacteria 2130
116 Ga0209256_1000940 3300025299 Bacteria 35371
117 Ga0209256_1001609 3300025299 Bacteria 22077
118 Ga0209256_1002138 3300025299 Bacteria 17084
119 Ga0209256_1002922 3300025299 Bacteria 12855
120 Ga0209256_1004254 3300025299 Bacteria 9156
121 Ga0209256_1005694 3300025299 Bacteria 7000
122 Ga0209256_1008439 3300025299 Bacteria 4776
123 Ga0207426_1000006 3300025302 Bacteria 1025969
124 Ga0207426_1000008 3300025302 Bacteria 848730
125 Ga0207426_1000011 3300025302 Bacteria 791203
126 Ga0207426_1000218 3300025302 Bacteria 135865
127 Ga0207426_1002039 3300025302 Bacteria 14113
128 Ga0209051_1000393 3300025303 Bacteria 60776
129 Ga0209051_1000645 3300025303 Bacteria 39647
130 Ga0209051_1002719 3300025303 Bacteria 12290
131 Ga0209051_1007816 3300025303 Bacteria 5774
132 Ga0209051_1026156 3300025303 Bacteria 2358
133 Ga0209051_1039540 3300025303 Bacteria 1701
134 Ga0209257_1001083 3300025304 Bacteria 35747
135 Ga0209257_1009964 3300025304 Bacteria 4934
136 Ga0209257_1023809 3300025304 Bacteria 2139
137 Ga0207650_10070701 3300025925 Bacteria 2624
138 Ga0207711_10054555 3300025941 Bacteria 3430
139 Ga0207658_10877179 3300025986 Bacteria 816
140 Ga0207678_10027801 3300026067 Bacteria 4938
141 Ga0209281_1000034 3300027111 Bacteria 382562
142 Ga0268266_10054529 3300028379 Bacteria 3435
143 Ga0307513_10003237 3300031456 Bacteria 22198
144 Ga0307508_10389914 3300031616 Bacteria 984
145 Ga0307405_10000170 3300031731 Bacteria 24017
146 Ga0307412_10002136 3300031911 Bacteria 10965
147 Ga0307414_10090562 3300032004 Bacteria 2270
148 Ga0307414_10097819 3300032004 Bacteria 2200
149 Ga0395900_0070984 3300037418 Bacteria 3580
150 Ga0439439_0052153 3300041406 Bacteria 1074
151 Ga0451795_1372635 3300041456 Bacteria 1495
152 Ga0451833_1103729 3300041491 Bacteria 3054
153 Ga0451835_0143687 3300041492 Bacteria 1754
154 Ga0451837_0602560 3300041494 Bacteria 2831
155 Ga0451837_0629985 3300041494 Bacteria 1225
156 Ga0451841_0622163 3300041498 Bacteria 2871
157 Ga0451845_0541100 3300041501 Bacteria 4679
158 Ga0451846_21688 3300041502 Bacteria 1679
159 Ga0451847_0120876 3300041503 Bacteria 5670
160 Ga0451849_1553131 3300041505 Bacteria 6634
161 Ga0451851_0718869 3300041507 Bacteria 3711
162 Ga0451854_16362 3300041510 Bacteria 1839
163 Ga0451853_0592169 3300041512 Bacteria 6014
164 Ga0439445_0015047 3300042004 Bacteria 1891
165 Ga0439432_060043 3300042006 Bacteria 1174
166 Ga0439449_0016539 3300042007 Bacteria 2772
167 Ga0439449_0034642 3300042007 Bacteria 1880
168 Ga0439462_0072674 3300042015 Bacteria 935
169 Ga0495592_0227437 3300046454 Bacteria 1244
170 Ga0495638_0254473 3300046460 Bacteria 966
171 Ga0495651_0119997 3300046462 Bacteria 1933
172 Ga0495650_0097271 3300046471 Bacteria 1110
173 Ga0495605_0023814 3300046474 Bacteria 3214
174 Ga0495607_0055151 3300046501 Bacteria 2287
175 Ga0495583_0010441 3300046506 Bacteria 5414
176 Ga0495606_0028221 3300046507 Bacteria 3963
177 Ga0495610_0001284 3300046512 Bacteria 22438
178 Ga0495610_0084495 3300046512 Bacteria 1450
179 Ga0495610_0149266 3300046512 Bacteria 999
180 Ga0495616_0029910 3300046513 Bacteria 2869
181 Ga0495620_0008324 3300046515 Bacteria 5574
182 Ga0495632_0010504 3300046519 Bacteria 5475
183 Ga0495632_0023287 3300046519 Bacteria 3309
184 Ga0495643_0007330 3300046522 Bacteria 7127
185 Ga0495643_0019929 3300046522 Bacteria 3876
186 Ga0495643_0057970 3300046522 Bacteria 2062
187 Ga0495643_0065317 3300046522 Bacteria 1921
188 Ga0495648_0016246 3300046524 Bacteria 5370
189 Ga0495652_0097799 3300046529 Bacteria 2387
190 Ga0495654_0001905 3300046530 Bacteria 13848
191 Ga0495587_0099502 3300046536 Bacteria 1676
192 Ga0495609_0090334 3300046538 Bacteria 1332
193 Ga0495597_0020023 3300046542 Bacteria 3122
194 Ga0495622_0021567 3300046557 Bacteria 2998
195 Ga0495633_0054801 3300046558 Bacteria 1875
196 Ga0495656_0096855 3300046615 Bacteria 1358
197 Ga0495611_0047914 3300046648 Bacteria 1919
198 Ga0495625_0043877 3300046660 Bacteria 3240
199 Ga0495625_0109808 3300046660 Bacteria 1886
200 Ga0495625_0181831 3300046660 Bacteria 1397
201 Ga0495635_0052547 3300046663 Bacteria 2807
202 Ga0495661_0056455 3300046665 Bacteria 2349
203 Ga0495661_0184016 3300046665 Bacteria 1105
204 Ga0495657_0010582 3300046675 Bacteria 6935
205 Ga0495646_0266971 3300046680 Bacteria 913
206 Ga0495624_0083039 3300046690 Bacteria 1982
207 Ga0495589_0287119 3300046794 Bacteria 764
208 Ga0495660_0042236 3300046810 Bacteria 2520
209 Ga0495604_0008895 3300047317 Bacteria 7939
210 Ga0495636_0107834 3300047318 Bacteria 1223
211 Ga0495672_0052077 3300047320 Bacteria 2406
212 Ga0495687_012523 3300047443 Bacteria 4478
213 Ga0495686_0014886 3300047472 Bacteria 5336
214 Ga0495686_0017574 3300047472 Bacteria 4812
215 Ga0495686_0190709 3300047472 Bacteria 1182
216 Ga0496101_0046834 3300048904 Bacteria 3102
217 Ga0496101_0082911 3300048904 Bacteria 2373
218 Ga0496101_0158444 3300048904 Bacteria 1735
219 Ga0496102_0070167 3300048905 Bacteria 3217
220 Ga0496103_0178295 3300048906 Bacteria 1365
221 Ga0496104_0093226 3300048907 Bacteria 2880
222 Ga0496105_0080307 3300048908 Bacteria 2694
223 Ga0496106_0001054 3300048909 Bacteria 20308
224 Ga0496107_0154555 3300048910 Bacteria 1698
225 Ga0496107_0181528 3300048910 Bacteria 1563
226 Ga0496111_0026731 3300048914 Bacteria 4076
227 Ga0496113_0049301 3300048916 Bacteria 3135
228 Ga0496114_0163759 3300048917 Bacteria 1935
229 Ga0496116_0003082 3300048919 Bacteria 16806
230 Ga0496116_0012537 3300048919 Bacteria 6916
231 Ga0496116_0017728 3300048919 Bacteria 5516
232 Ga0496116_0046798 3300048919 Bacteria 2917
233 Ga0496116_0058169 3300048919 Bacteria 2522
234 Ga0496116_0079117 3300048919 Bacteria 2047
235 Ga0496116_0109240 3300048919 Bacteria 1631
236 Ga0496117_0024813 3300048920 Bacteria 4727
237 Ga0496118_0014245 3300048921 Bacteria 7457
238 Ga0496118_0022203 3300048921 Bacteria 5558
239 Ga0496118_0023607 3300048921 Bacteria 5336
240 Ga0496118_0028387 3300048921 Bacteria 4713
241 Ga0496119_0031580 3300048922 Bacteria 3548
242 Ga0496119_0094603 3300048922 Bacteria 1690
243 Ga0496121_0001531 3300048924 Bacteria 38692
244 Ga0496121_0026114 3300048924 Bacteria 5516
245 Ga0496121_0035236 3300048924 Bacteria 4489
246 Ga0496121_0039195 3300048924 Bacteria 4181
247 Ga0496121_0050502 3300048924 Bacteria 3513
248 Ga0496121_0112780 3300048924 Bacteria 2070
249 Ga0496121_0128427 3300048924 Bacteria 1902
250 Ga0496121_0241126 3300048924 Bacteria 1259
251 Ga0496122_0013481 3300048925 Bacteria 7998
252 Ga0496122_0023236 3300048925 Bacteria 5475
253 Ga0496122_0032126 3300048925 Bacteria 4347
254 Ga0496122_0064920 3300048925 Bacteria 2651
255 Ga0496122_0081062 3300048925 Bacteria 2260
256 Ga0496123_0005261 3300048926 Bacteria 13130
257 Ga0496123_0046270 3300048926 Bacteria 2952
258 Ga0496123_0070960 3300048926 Bacteria 2176
259 Ga0496124_0010044 3300048927 Bacteria 9655
260 Ga0496124_0014104 3300048927 Bacteria 7747
261 Ga0496124_0027396 3300048927 Bacteria 5115
262 Ga0496124_0156693 3300048927 Bacteria 1780
263 Ga0496125_0019828 3300048928 Bacteria 6327
264 Ga0496125_0069658 3300048928 Bacteria 2758
265 Ga0496126_0054005 3300048929 Bacteria 3642
266 Ga0496126_0195993 3300048929 Bacteria 1708
267 Ga0496126_0211615 3300048929 Bacteria 1632
268 Ga0495678_007538 3300049459 Bacteria 5621
269 Ga0501034_0001662 3300049571 Bacteria 28665
270 Ga0501034_0069100 3300049571 Bacteria 3543
271 Ga0501036_0332995 3300049572 Bacteria 1268
272 Ga0501037_0048825 3300049573 Bacteria 3100
273 Ga0501073_0053231 3300049589 Bacteria 2834
274 Ga0501083_0048394 3300049744 Bacteria 2869
275 nmdc:mga00v17_241_c1 3300050491 Bacteria 32423
276 nmdc:mga0yw44_1036_c1 3300050492 Bacteria 10672
277 nmdc:mga0k408_109141_c1 3300050493 Bacteria 1635
278 nmdc:mga06z11_59920_c1 3300050494 Bacteria 1980
279 nmdc:mga06z11_66931_c1 3300050494 Bacteria 1890
280 nmdc:mga07m45_48238_c1 3300050496 Bacteria 2395
281 Ga0495619_0123203 3300053085 Bacteria 1778
282 Ga0500618_002031 3300053125 Bacteria 8183
283 Ga0500658_0000715 3300053134 Bacteria 13705
284 Ga0500658_0054605 3300053134 Bacteria 1642
285 Ga0500559_0018359 3300053136 Bacteria 2956
286 Ga0500568_0006560 3300053139 Bacteria 5824
287 Ga0500573_0000189 3300053140 Bacteria 25044
288 Ga0500590_002985 3300053148 Bacteria 7687
289 Ga0500616_0000577 3300053153 Bacteria 44621
290 Ga0500616_0002510 3300053153 Bacteria 15189
291 Ga0500616_0010239 3300053153 Bacteria 5622
292 Ga0500622_0000429 3300053156 Bacteria 39925
293 Ga0500611_030869 3300053727 Bacteria 1108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_0629985 Ga0451837_0629985_13_675 209
2 3300053085 Ga0495619_0123203 Ga0495619_0123203_26_685 209
3 3300046794 Ga0495589_0287119 Ga0495589_0287119_20_667 215
4 3300047472 Ga0495686_0190709 Ga0495686_0190709_514_1161 215
5 3300031456 Ga0307513_10003237 Ga0307513_1000323715 218
6 3300032004 Ga0307414_10090562 Ga0307414_100905622 223
7 3300025294 Ga0209025_1007003 Ga0209025_10070037 224
8 3300025297 Ga0209758_1009652 Ga0209758_10096523 224
9 3300031911 Ga0307412_10002136 Ga0307412_100021369 226
10 3300041491 Ga0451833_1103729 Ga0451833_1103729_1320_2051 226
11 3300041492 Ga0451835_0143687 Ga0451835_0143687_824_1555 226
12 3300041494 Ga0451837_0602560 Ga0451837_0602560_1349_2080 226
13 3300041498 Ga0451841_0622163 Ga0451841_0622163_1389_2120 226
14 3300041501 Ga0451845_0541100 Ga0451845_0541100_1879_2610 226
15 3300041502 Ga0451846_21688 Ga0451846_21688_30_761 226
16 3300041503 Ga0451847_0120876 Ga0451847_0120876_2096_2827 226
17 3300041505 Ga0451849_1553131 Ga0451849_1553131_2265_2996 226
18 3300041507 Ga0451851_0718869 Ga0451851_0718869_2824_3555 226
19 3300041510 Ga0451854_16362 Ga0451854_16362_1004_1735 226
20 3300041512 Ga0451853_0592169 Ga0451853_0592169_5060_5791 226
21 3300046524 Ga0495648_0016246 Ga0495648_0016246_3752_4483 226
22 3300046558 Ga0495633_0054801 Ga0495633_0054801_800_1531 226
23 3300046648 Ga0495611_0047914 Ga0495611_0047914_23_754 226
24 3300046660 Ga0495625_0181831 Ga0495625_0181831_535_1266 226
25 3300046665 Ga0495661_0056455 Ga0495661_0056455_162_893 226
26 3300048919 Ga0496116_0079117 Ga0496116_0079117_342_1079 226
27 iso_pu_bacteria 2889914905 2889919849 226
28 3300048909 Ga0496106_0001054 Ga0496106_0001054_11492_12208 227
29 3300049571 Ga0501034_0069100 Ga0501034_0069100_1616_2305 227
30 iso_pu_bacteria 2889790730 2889796046 227
31 3300047320 Ga0495672_0052077 Ga0495672_0052077_286_1002 228
32 3300048924 Ga0496121_0112780 Ga0496121_0112780_1197_1958 228
33 3300053134 Ga0500658_0054605 Ga0500658_0054605_744_1460 228
34 3300053153 Ga0500616_0000577 Ga0500616_0000577_7178_7894 228
35 3300053727 Ga0500611_030869 Ga0500611_030869_232_948 228
36 3300006946 Ga0079104_1000045 Ga0079104_1000045132 229
37 3300013249 Ga0171463_1017 Ga0171463_101749 229
38 3300015690 Ga0183363_1050 Ga0183363_105040 229
39 3300027111 Ga0209281_1000034 Ga0209281_1000034208 229
40 3300046660 Ga0495625_0043877 Ga0495625_0043877_755_1468 229
41 3300048924 Ga0496121_0001531 Ga0496121_0001531_35373_36110 229
42 3300048929 Ga0496126_0211615 Ga0496126_0211615_695_1429 229
43 3300053140 Ga0500573_0000189 Ga0500573_0000189_8192_8923 229
44 iso_pu_bacteria 2643221551 2643776345 229
45 iso_pu_bacteria 2643221555 2643794792 229
46 3300002773 JGI25152J39213_1003120 JGI25152J39213_10031204 230
47 3300002774 JGI25150J39212_1001440 JGI25150J39212_10014405 230
48 3300003187 JGI25151J46595_10000280 JGI25151J46595_100002804 230
49 3300003215 JGI25153J46596_10005459 JGI25153J46596_100054593 230
50 3300025245 Ga0207425_1000055 Ga0207425_1000055122 230
51 3300025258 Ga0209129_1000029 Ga0209129_1000029323 230
52 3300025294 Ga0209025_1000070 Ga0209025_100007058 230
53 3300025297 Ga0209758_1000094 Ga0209758_1000094176 230
54 3300048904 Ga0496101_0158444 Ga0496101_0158444_54_800 230
55 3300048919 Ga0496116_0003082 Ga0496116_0003082_15263_16009 230
56 3300048920 Ga0496117_0024813 Ga0496117_0024813_1013_1759 230
57 3300048921 Ga0496118_0014245 Ga0496118_0014245_762_1508 230
58 3300048924 Ga0496121_0026114 Ga0496121_0026114_1353_2099 230
59 3300048926 Ga0496123_0046270 Ga0496123_0046270_1008_1754 230
60 3300048927 Ga0496124_0010044 Ga0496124_0010044_1427_2173 230
61 3300048928 Ga0496125_0019828 Ga0496125_0019828_3995_4741 230
62 iso_pu_bacteria 2582581304 2585258330 230
63 iso_pu_bacteria 3005445848 3005448622 230
64 3300046460 Ga0495638_0254473 Ga0495638_0254473_198_914 231
65 3300048924 Ga0496121_0050502 Ga0496121_0050502_1014_1730 231
66 3300048929 Ga0496126_0195993 Ga0496126_0195993_847_1587 231
67 3300049571 Ga0501034_0001662 Ga0501034_0001662_27557_28276 231
68 iso_pu_bacteria 2585427633 2585996613 231
69 iso_pu_bacteria 2643221558 2643811371 231
70 iso_pu_bacteria 2854896431 2854901284 231
71 iso_pu_bacteria 2854916844 2854918659 231
72 iso_pu_bacteria 2891048133 2891049751 231
73 iso_pu_bacteria 2989771324 2989776053 231
74 3300031616 Ga0307508_10389914 Ga0307508_103899141 232
75 3300041456 Ga0451795_1372635 Ga0451795_1372635_584_1315 232
76 3300046536 Ga0495587_0099502 Ga0495587_0099502_370_1134 232
77 3300046675 Ga0495657_0010582 Ga0495657_0010582_5150_5878 232
78 3300046690 Ga0495624_0083039 Ga0495624_0083039_1136_1900 232
79 3300047317 Ga0495604_0008895 Ga0495604_0008895_856_1620 232
80 3300048904 Ga0496101_0082911 Ga0496101_0082911_934_1674 232
81 3300048919 Ga0496116_0017728 Ga0496116_0017728_1308_2048 232
82 3300048921 Ga0496118_0028387 Ga0496118_0028387_2939_3679 232
83 3300048925 Ga0496122_0023236 Ga0496122_0023236_3735_4475 232
84 3300048927 Ga0496124_0014104 Ga0496124_0014104_3719_4459 232
85 3300053136 Ga0500559_0018359 Ga0500559_0018359_1133_1846 232
86 iso_pu_bacteria 2558860983 2561468650 232
87 iso_pu_bacteria 2775507049 2776914119 232
88 iso_pu_bacteria 2899803654 2899804197 232
89 iso_pu_bacteria 8024486573 8024488206 232
90 iso_pu_bacteria 8055431914 8055432448 232
91 3300003791 Ga0055530_10011441 Ga0055530_100114413 233
92 3300003792 Ga0055540_1001344 Ga0055540_10013447 233
93 3300025292 Ga0209676_1006076 Ga0209676_10060762 233
94 3300025297 Ga0209758_1002519 Ga0209758_100251913 233
95 3300025298 Ga0209050_1004415 Ga0209050_10044155 233
96 3300025303 Ga0209051_1000645 Ga0209051_10006452 233
97 3300025304 Ga0209257_1001083 Ga0209257_100108330 233
98 3300028379 Ga0268266_10054529 Ga0268266_100545294 233
99 3300037418 Ga0395900_0070984 Ga0395900_0070984_195_920 233
100 3300048919 Ga0496116_0058169 Ga0496116_0058169_981_1772 233
101 iso_pu_bacteria 2510461069 2510839535 233
102 iso_pu_bacteria 2513237146 2513925235 233
103 iso_pu_bacteria 2515154113 2515636820 233
104 iso_pu_bacteria 2515154114 2515646314 233
105 iso_pu_bacteria 2517287029 2517407629 233
106 iso_pu_bacteria 2599185170 2599417143 233
107 iso_pu_bacteria 2599185236 2599721541 233
108 iso_pu_bacteria 2643221653 2644298804 233
109 iso_pu_bacteria 2643221719 2644657033 233
110 iso_pu_bacteria 2791355266 2793361968 233
111 iso_pu_bacteria 2818991272 2819241195 233
112 iso_pu_bacteria 2838035591 2838038651 233
113 iso_pu_bacteria 2838661181 2838661427 233
114 iso_pu_bacteria 2936381700 2936387871 233
115 iso_pu_bacteria 2989776772 2989779361 233
116 iso_pu_bacteria 8005246636 8005248908 233
117 iso_pu_bacteria 8005658619 8005658903 233
118 3300005331 Ga0070670_100049146 Ga0070670_1000491463 234
119 3300025925 Ga0207650_10070701 Ga0207650_100707013 234
120 3300053153 Ga0500616_0002510 Ga0500616_0002510_3071_3826 234
121 iso_pu_bacteria 2509276021 2509391857 234
122 iso_pu_bacteria 2510461076 2510895558 234
123 iso_pu_bacteria 2510917022 2511133279 234
124 iso_pu_bacteria 2510917028 2511182530 234
125 iso_pu_bacteria 2510917030 2511199197 234
126 iso_pu_bacteria 2513237084 2513567800 234
127 iso_pu_bacteria 2513237085 2513577122 234
128 iso_pu_bacteria 2513237088 2513599942 234
129 iso_pu_bacteria 2513237093 2513633208 234
130 iso_pu_bacteria 2513237103 2513707787 234
131 iso_pu_bacteria 2513237138 2513865866 234
132 iso_pu_bacteria 2513237144 2513908598 234
133 iso_pu_bacteria 2513237162 2514018129 234
134 iso_pu_bacteria 2515075009 2515113231 234
135 iso_pu_bacteria 2515154116 2515655170 234
136 iso_pu_bacteria 2515154134 2515739655 234
137 iso_pu_bacteria 2516653077 2517036891 234
138 iso_pu_bacteria 2516653085 2517077252 234
139 iso_pu_bacteria 2517093000 2517096010 234
140 iso_pu_bacteria 2519899620 2520377076 234
141 iso_pu_bacteria 2524023209 2524458796 234
142 iso_pu_bacteria 2529292951 2530646626 234
143 iso_pu_bacteria 2534681796 2535517050 234
144 iso_pu_bacteria 2582581294 2585202048 234
145 iso_pu_bacteria 2582581298 2585223027 234
146 iso_pu_bacteria 2582581299 2585228465 234
147 iso_pu_bacteria 2582581307 2585271291 234
148 iso_pu_bacteria 2582581308 2585279230 234
149 iso_pu_bacteria 2582581315 2585323165 234
150 iso_pu_bacteria 2582581316 2585331273 234
151 iso_pu_bacteria 2582581867 2585400899 234
152 iso_pu_bacteria 2585427526 2585524679 234
153 iso_pu_bacteria 2585427527 2585531285 234
154 iso_pu_bacteria 2585427528 2585538367 234
155 iso_pu_bacteria 2585427529 2585545610 234
156 iso_pu_bacteria 2585427530 2585552792 234
157 iso_pu_bacteria 2585427531 2585559036 234
158 iso_pu_bacteria 2585427590 2585822199 234
159 iso_pu_bacteria 2585427593 2585836320 234
160 iso_pu_bacteria 2585427594 2585843405 234
161 iso_pu_bacteria 2585427608 2585898416 234
162 iso_pu_bacteria 2585427609 2585904017 234
163 iso_pu_bacteria 2585427634 2586001141 234
164 iso_pu_bacteria 2585428125 2587980865 234
165 iso_pu_bacteria 2600254933 2600374166 234
166 iso_pu_bacteria 2615840624 2616293189 234
167 iso_pu_bacteria 2615840626 2616311397 234
168 iso_pu_bacteria 2617270742 2617386258 234
169 iso_pu_bacteria 2643221599 2644007091 234
170 iso_pu_bacteria 2643221643 2644242511 234
171 iso_pu_bacteria 2718217882 2719181968 234
172 iso_pu_bacteria 2718217927 2719386579 234
173 iso_pu_bacteria 2718217997 2719666326 234
174 iso_pu_bacteria 2718218009 2719732685 234
175 iso_pu_bacteria 2718218199 2720492746 234
176 iso_pu_bacteria 2718218232 2720614215 234
177 iso_pu_bacteria 2718218233 2720620983 234
178 iso_pu_bacteria 2718218235 2720632307 234
179 iso_pu_bacteria 2718218269 2720776035 234
180 iso_pu_bacteria 2718218363 2721148059 234
181 iso_pu_bacteria 2718218365 2721159510 234
182 iso_pu_bacteria 2718218366 2721164895 234
183 iso_pu_bacteria 2718218423 2721400283 234
184 iso_pu_bacteria 2721755514 2722841065 234
185 iso_pu_bacteria 2721755556 2723027634 234
186 iso_pu_bacteria 2721755684 2723561262 234
187 iso_pu_bacteria 2721755685 2723567885 234
188 iso_pu_bacteria 2721755809 2724039096 234
189 iso_pu_bacteria 2721755810 2724045441 234
190 iso_pu_bacteria 2721755819 2724090642 234
191 iso_pu_bacteria 2721755822 2724105150 234
192 iso_pu_bacteria 2721755823 2724110978 234
193 iso_pu_bacteria 2724679232 2725951430 234
194 iso_pu_bacteria 2728369352 2730108570 234
195 iso_pu_bacteria 2728369365 2730165203 234
196 iso_pu_bacteria 2728369397 2730299142 234
197 iso_pu_bacteria 2738541293 2738800260 234
198 iso_pu_bacteria 2738541333 2739033008 234
199 iso_pu_bacteria 2765235942 2766066048 234
200 iso_pu_bacteria 2791355256 2793294266 234
201 iso_pu_bacteria 2791355259 2793315919 234
202 iso_pu_bacteria 2791355260 2793319347 234
203 iso_pu_bacteria 2791355261 2793328433 234
204 iso_pu_bacteria 2791355262 2793335390 234
205 iso_pu_bacteria 2791355264 2793347078 234
206 iso_pu_bacteria 2791355265 2793351670 234
207 iso_pu_bacteria 2791355267 2793367723 234
208 iso_pu_bacteria 2802429605 2805926901 234
209 iso_pu_bacteria 2802429606 2805932816 234
210 iso_pu_bacteria 2802429633 2806045147 234
211 iso_pu_bacteria 2802429634 2806050058 234
212 iso_pu_bacteria 2802429635 2806056896 234
213 iso_pu_bacteria 2802429636 2806064277 234
214 iso_pu_bacteria 2802429637 2806071545 234
215 iso_pu_bacteria 2818991453 2819641390 234
216 iso_pu_bacteria 2818991461 2819685093 234
217 iso_pu_bacteria 2821123053 2821127354 234
218 iso_pu_bacteria 2838016132 2838021623 234
219 iso_pu_bacteria 2838022645 2838023683 234
220 iso_pu_bacteria 2838042994 2838045139 234
221 iso_pu_bacteria 2838048938 2838053382 234
222 iso_pu_bacteria 2838061910 2838065502 234
223 iso_pu_bacteria 2838068647 2838069981 234
224 iso_pu_bacteria 2838668709 2838670531 234
225 iso_pu_bacteria 2838680041 2838683283 234
226 iso_pu_bacteria 2838686498 2838686875 234
227 iso_pu_bacteria 2838694306 2838697773 234
228 iso_pu_bacteria 2838701080 2838702902 234
229 iso_pu_bacteria 2838707686 2838710889 234
230 iso_pu_bacteria 2838729681 2838730167 234
231 iso_pu_bacteria 2838736955 2838737878 234
232 iso_pu_bacteria 2838742623 2838742818 234
233 iso_pu_bacteria 2841840854 2841841753 234
234 iso_pu_bacteria 2841851746 2841852321 234
235 iso_pu_bacteria 2841864319 2841867128 234
236 iso_pu_bacteria 2842077413 2842079062 234
237 iso_pu_bacteria 2842110456 2842113092 234
238 iso_pu_bacteria 2842118031 2842118428 234
239 iso_pu_bacteria 2842140634 2842141531 234
240 iso_pu_bacteria 2842146304 2842147840 234
241 iso_pu_bacteria 2842156927 2842158221 234
242 iso_pu_bacteria 2842163707 2842168620 234
243 iso_pu_bacteria 2842180545 2842181841 234
244 iso_pu_bacteria 2842192696 2842195888 234
245 iso_pu_bacteria 2842198810 2842199197 234
246 iso_pu_bacteria 2842205361 2842209646 234
247 iso_pu_bacteria 2842217011 2842218117 234
248 iso_pu_bacteria 2842229732 2842230108 234
249 iso_pu_bacteria 2842237096 2842240339 234
250 iso_pu_bacteria 2842243621 2842243997 234
251 iso_pu_bacteria 2842250916 2842252906 234
252 iso_pu_bacteria 2842257432 2842257918 234
253 iso_pu_bacteria 2842264693 2842269454 234
254 iso_pu_bacteria 2842271015 2842271587 234
255 iso_pu_bacteria 2842278818 2842283100 234
256 iso_pu_bacteria 2842285085 2842285436 234
257 iso_pu_bacteria 2842291075 2842292724 234
258 iso_pu_bacteria 2842298080 2842298144 234
259 iso_pu_bacteria 2842304105 2842305218 234
260 iso_pu_bacteria 2842311132 2842314052 234
261 iso_pu_bacteria 2842317721 2842324384 234
262 iso_pu_bacteria 2842341865 2842347348 234
263 iso_pu_bacteria 2842357229 2842360256 234
264 iso_pu_bacteria 2842363717 2842370157 234
265 iso_pu_bacteria 2842370503 2842373914 234
266 iso_pu_bacteria 2842377471 2842379122 234
267 iso_pu_bacteria 2842384541 2842384938 234
268 iso_pu_bacteria 2842395702 2842400176 234
269 iso_pu_bacteria 2842402390 2842402796 234
270 iso_pu_bacteria 2842409023 2842409833 234
271 iso_pu_bacteria 2842415677 2842416482 234
272 iso_pu_bacteria 2842422224 2842423595 234
273 iso_pu_bacteria 2842428310 2842430544 234
274 iso_pu_bacteria 2842434925 2842436644 234
275 iso_pu_bacteria 2842441272 2842443514 234
276 iso_pu_bacteria 2842447887 2842449384 234
277 iso_pu_bacteria 2842462802 2842466798 234
278 iso_pu_bacteria 2842469257 2842471486 234
279 iso_pu_bacteria 2842482326 2842483908 234
280 iso_pu_bacteria 2842489311 2842492239 234
281 iso_pu_bacteria 2842495871 2842502589 234
282 iso_pu_bacteria 2842509118 2842510937 234
283 iso_pu_bacteria 2844454524 2844458172 234
284 iso_pu_bacteria 2852387548 2852390419 234
285 iso_pu_bacteria 2857516855 2857517250 234
286 iso_pu_bacteria 2857531043 2857532230 234
287 iso_pu_bacteria 2919100787 2919106287 234
288 iso_pu_bacteria 2919171160 2919172899 234
289 iso_pu_bacteria 2920822456 2920825442 234
290 iso_pu_bacteria 2923556063 2923559274 234
291 iso_pu_bacteria 2933016740 2933020835 234
292 iso_pu_bacteria 2933570622 2933571025 234
293 iso_pu_bacteria 2933586486 2933588851 234
294 iso_pu_bacteria 2933599457 2933600787 234
295 iso_pu_bacteria 2935894831 2935896841 234
296 iso_pu_bacteria 2935901341 2935901782 234
297 iso_pu_bacteria 2936367885 2936371866 234
298 iso_pu_bacteria 2936375103 2936379700 234
299 iso_pu_bacteria 2996887358 2996892870 234
300 iso_pu_bacteria 2996893221 2996894975 234
301 iso_pu_bacteria 3005409236 3005414398 234
302 iso_pu_bacteria 3005416602 3005417529 234
303 iso_pu_bacteria 639633055 639649349 234
304 iso_pu_bacteria 8005258706 8005259363 234
305 iso_pu_bacteria 8005275841 8005281385 234
306 iso_pu_bacteria 8005282627 8005284646 234
307 iso_pu_bacteria 8005289223 8005295687 234
308 iso_pu_bacteria 8005301065 8005303300 234
309 iso_pu_bacteria 8005307578 8005309565 234
310 iso_pu_bacteria 8005314921 8005315682 234
311 iso_pu_bacteria 8005321885 8005327397 234
312 iso_pu_bacteria 8005376324 8005381102 234
313 iso_pu_bacteria 8005382845 8005388948 234
314 iso_pu_bacteria 8005395548 8005395931 234
315 iso_pu_bacteria 8005430974 8005437453 234
316 iso_pu_bacteria 8005460587 8005463914 234
317 iso_pu_bacteria 8005484373 8005489033 234
318 iso_pu_bacteria 8005497431 8005501066 234
319 iso_pu_bacteria 8005542996 8005545864 234
320 iso_pu_bacteria 8005556819 8005556847 234
321 iso_pu_bacteria 8005563573 8005568171 234
322 iso_pu_bacteria 8005570704 8005573290 234
323 iso_pu_bacteria 8005619151 8005622433 234
324 iso_pu_bacteria 8005626139 8005629934 234
325 iso_pu_bacteria 8005668836 8005672483 234
326 iso_pu_bacteria 8005688590 8005691928 234
327 iso_pu_bacteria 8005695170 8005697579 234
328 iso_pu_bacteria 8018127388 8018128031 234
329 iso_pu_bacteria 8018163183 8018164398 234
330 iso_pu_bacteria 8018176218 8018176881 234
331 iso_pu_bacteria 8023680758 8023682995 234
332 iso_pu_bacteria 8024479707 8024482693 234
333 iso_pu_bacteria 8024501048 8024504606 234
334 iso_pu_bacteria 8046767195 8046771779 234
335 iso_pu_bacteria 8056375014 8056378312 234
336 iso_pu_bacteria 8056382006 8056384247 234
337 iso_pu_bacteria 8056875544 8056875718 234
338 iso_pu_bacteria 8057575449 8057575537 234
339 iso_pu_bacteria 8057874678 8057878490 234
340 3300005985 Ga0081539_10000991 Ga0081539_1000099127 235
341 3300006051 Ga0075364_10000266 Ga0075364_1000026611 235
342 3300050491 nmdc:mga00v17_241_c1 nmdc:mga00v17_241_c1_1588_2328 235
343 3300046454 Ga0495592_0227437 Ga0495592_0227437_287_1051 237
344 3300046462 Ga0495651_0119997 Ga0495651_0119997_822_1586 237
345 3300046529 Ga0495652_0097799 Ga0495652_0097799_920_1684 237
346 3300046530 Ga0495654_0001905 Ga0495654_0001905_12031_12759 237
347 3300046557 Ga0495622_0021567 Ga0495622_0021567_1365_2129 237
348 3300046663 Ga0495635_0052547 Ga0495635_0052547_1490_2254 237
349 3300046680 Ga0495646_0266971 Ga0495646_0266971_13_777 237
350 3300048914 Ga0496111_0026731 Ga0496111_0026731_1644_2366 237
351 3300048922 Ga0496119_0094603 Ga0496119_0094603_129_842 237
352 3300048925 Ga0496122_0081062 Ga0496122_0081062_1429_2151 237
353 3300048926 Ga0496123_0005261 Ga0496123_0005261_10084_10806 237
354 3300053148 Ga0500590_002985 Ga0500590_002985_357_1085 237
355 3300002773 JGI25152J39213_1001572 JGI25152J39213_10015728 238
356 3300002773 JGI25152J39213_1003379 JGI25152J39213_10033793 238
357 3300002987 JGI25159J45721_1000120 JGI25159J45721_10001205 238
358 3300002987 JGI25159J45721_1001458 JGI25159J45721_10014583 238
359 3300003187 JGI25151J46595_10020074 JGI25151J46595_100200744 238
360 3300003215 JGI25153J46596_10005956 JGI25153J46596_100059565 238
361 3300003215 JGI25153J46596_10008146 JGI25153J46596_100081463 238
362 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001454 238
363 3300003354 JGI25160J50197_1000021 JGI25160J50197_100002196 238
364 3300003354 JGI25160J50197_1001268 JGI25160J50197_100126814 238
365 3300003354 JGI25160J50197_1009037 JGI25160J50197_10090373 238
366 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001303 238
367 3300003374 JGI25161J50226_1001240 JGI25161J50226_10012402 238
368 3300003374 JGI25161J50226_1004078 JGI25161J50226_10040782 238
369 3300003771 Ga0055526_1001766 Ga0055526_10017668 238
370 3300003771 Ga0055526_1006894 Ga0055526_10068942 238
371 3300003771 Ga0055526_1007936 Ga0055526_10079364 238
372 3300003771 Ga0055526_1016628 Ga0055526_10166283 238
373 3300003775 Ga0055524_1000994 Ga0055524_10009948 238
374 3300003775 Ga0055524_1017012 Ga0055524_10170121 238
375 3300003775 Ga0055524_1022782 Ga0055524_10227822 238
376 3300003775 Ga0055524_1042667 Ga0055524_10426671 238
377 3300003781 Ga0055536_1017481 Ga0055536_10174812 238
378 3300003790 Ga0055528_1000290 Ga0055528_10002902 238
379 3300003790 Ga0055528_1002459 Ga0055528_10024599 238
380 3300003790 Ga0055528_1018265 Ga0055528_10182653 238
381 3300003790 Ga0055528_1033630 Ga0055528_10336302 238
382 3300003790 Ga0055528_1038693 Ga0055528_10386932 238
383 3300003792 Ga0055540_1000592 Ga0055540_100059225 238
384 3300003794 Ga0055531_10004872 Ga0055531_100048726 238
385 3300004625 Ga0055543_1000003 Ga0055543_1000003319 238
386 3300004625 Ga0055543_1000164 Ga0055543_100016438 238
387 3300004625 Ga0055543_1003307 Ga0055543_10033073 238
388 3300005262 Ga0065165_1000033 Ga0065165_100003396 238
389 3300005262 Ga0065165_1000335 Ga0065165_10003354 238
390 3300005262 Ga0065165_1008287 Ga0065165_10082875 238
391 3300005262 Ga0065165_1008530 Ga0065165_10085304 238
392 3300005355 Ga0070671_100017144 Ga0070671_1000171444 238
393 3300005367 Ga0070667_100498405 Ga0070667_1004984051 238
394 3300006038 Ga0075365_10002132 Ga0075365_100021329 238
395 3300006038 Ga0075365_10002309 Ga0075365_1000230911 238
396 3300006048 Ga0075363_100015347 Ga0075363_1000153473 238
397 3300006048 Ga0075363_100055517 Ga0075363_1000555171 238
398 3300006177 Ga0075362_10018986 Ga0075362_100189863 238
399 3300006177 Ga0075362_10034539 Ga0075362_100345392 238
400 3300006178 Ga0075367_10001001 Ga0075367_100010014 238
401 3300006186 Ga0075369_10000834 Ga0075369_100008345 238
402 3300006186 Ga0075369_10015394 Ga0075369_100153944 238
403 3300006186 Ga0075369_10181232 Ga0075369_101812322 238
404 3300006353 Ga0075370_10006544 Ga0075370_100065447 238
405 3300009177 Ga0105248_10455471 Ga0105248_104554712 238
406 3300009765 Ga0123341_1000124 Ga0123341_100012427 238
407 3300009766 Ga0123342_1014819 Ga0123342_10148195 238
408 3300009766 Ga0123342_1022183 Ga0123342_10221833 238
409 3300011119 Ga0105246_10111486 Ga0105246_101114863 238
410 3300025208 Ga0209436_100070 Ga0209436_10007052 238
411 3300025245 Ga0207425_1002677 Ga0207425_10026772 238
412 3300025245 Ga0207425_1004042 Ga0207425_10040424 238
413 3300025245 Ga0207425_1004680 Ga0207425_10046804 238
414 3300025258 Ga0209129_1000252 Ga0209129_100025213 238
415 3300025258 Ga0209129_1001350 Ga0209129_10013508 238
416 3300025258 Ga0209129_1004754 Ga0209129_10047545 238
417 3300025258 Ga0209129_1004826 Ga0209129_10048263 238
418 3300025258 Ga0209129_1011892 Ga0209129_10118922 238
419 3300025273 Ga0209673_1000010 Ga0209673_1000010416 238
420 3300025273 Ga0209673_1000025 Ga0209673_1000025260 238
421 3300025273 Ga0209673_1000878 Ga0209673_100087836 238
422 3300025273 Ga0209673_1001610 Ga0209673_100161011 238
423 3300025273 Ga0209673_1004326 Ga0209673_10043269 238
424 3300025273 Ga0209673_1008113 Ga0209673_10081134 238
425 3300025273 Ga0209673_1017874 Ga0209673_10178742 238
426 3300025273 Ga0209673_1063232 Ga0209673_10632322 238
427 3300025284 Ga0209130_1000003 Ga0209130_1000003320 238
428 3300025284 Ga0209130_1000017 Ga0209130_1000017286 238
429 3300025284 Ga0209130_1000020 Ga0209130_100002080 238
430 3300025292 Ga0209676_1011727 Ga0209676_10117274 238
431 3300025292 Ga0209676_1012962 Ga0209676_10129623 238
432 3300025294 Ga0209025_1000091 Ga0209025_100009173 238
433 3300025294 Ga0209025_1000161 Ga0209025_1000161112 238
434 3300025294 Ga0209025_1002035 Ga0209025_100203513 238
435 3300025294 Ga0209025_1012336 Ga0209025_10123364 238
436 3300025294 Ga0209025_1035935 Ga0209025_10359355 238
437 3300025295 Ga0209564_1000013 Ga0209564_1000013734 238
438 3300025295 Ga0209564_1000265 Ga0209564_10002655 238
439 3300025295 Ga0209564_1000644 Ga0209564_100064413 238
440 3300025295 Ga0209564_1001272 Ga0209564_100127227 238
441 3300025295 Ga0209564_1004372 Ga0209564_10043722 238
442 3300025295 Ga0209564_1004592 Ga0209564_10045929 238
443 3300025297 Ga0209758_1002497 Ga0209758_100249711 238
444 3300025297 Ga0209758_1004278 Ga0209758_100427811 238
445 3300025297 Ga0209758_1005108 Ga0209758_10051084 238
446 3300025297 Ga0209758_1005708 Ga0209758_10057084 238
447 3300025298 Ga0209050_1005237 Ga0209050_10052377 238
448 3300025298 Ga0209050_1023944 Ga0209050_10239442 238
449 3300025299 Ga0209256_1000940 Ga0209256_100094015 238
450 3300025299 Ga0209256_1001609 Ga0209256_100160912 238
451 3300025299 Ga0209256_1002138 Ga0209256_10021384 238
452 3300025299 Ga0209256_1002922 Ga0209256_10029225 238
453 3300025299 Ga0209256_1004254 Ga0209256_10042543 238
454 3300025299 Ga0209256_1005694 Ga0209256_10056943 238
455 3300025299 Ga0209256_1008439 Ga0209256_10084393 238
456 3300025302 Ga0207426_1000006 Ga0207426_1000006285 238
457 3300025302 Ga0207426_1000008 Ga0207426_1000008149 238
458 3300025302 Ga0207426_1000011 Ga0207426_1000011455 238
459 3300025302 Ga0207426_1000218 Ga0207426_100021839 238
460 3300025302 Ga0207426_1002039 Ga0207426_10020398 238
461 3300025303 Ga0209051_1000393 Ga0209051_100039326 238
462 3300025303 Ga0209051_1002719 Ga0209051_100271910 238
463 3300025303 Ga0209051_1007816 Ga0209051_10078163 238
464 3300025303 Ga0209051_1026156 Ga0209051_10261564 238
465 3300025303 Ga0209051_1039540 Ga0209051_10395402 238
466 3300025304 Ga0209257_1009964 Ga0209257_10099644 238
467 3300025304 Ga0209257_1023809 Ga0209257_10238092 238
468 3300025941 Ga0207711_10054555 Ga0207711_100545555 238
469 3300025986 Ga0207658_10877179 Ga0207658_108771791 238
470 3300026067 Ga0207678_10027801 Ga0207678_100278012 238
471 3300031731 Ga0307405_10000170 Ga0307405_1000017018 238
472 3300032004 Ga0307414_10097819 Ga0307414_100978193 238
473 3300041406 Ga0439439_0052153 Ga0439439_0052153_62_790 238
474 3300042004 Ga0439445_0015047 Ga0439445_0015047_787_1503 238
475 3300042006 Ga0439432_060043 Ga0439432_060043_232_948 238
476 3300042007 Ga0439449_0016539 Ga0439449_0016539_1821_2549 238
477 3300042007 Ga0439449_0034642 Ga0439449_0034642_848_1606 238
478 3300042015 Ga0439462_0072674 Ga0439462_0072674_189_905 238
479 3300046471 Ga0495650_0097271 Ga0495650_0097271_73_816 238
480 3300046474 Ga0495605_0023814 Ga0495605_0023814_1244_1975 238
481 3300046501 Ga0495607_0055151 Ga0495607_0055151_310_1041 238
482 3300046506 Ga0495583_0010441 Ga0495583_0010441_1109_1825 238
483 3300046507 Ga0495606_0028221 Ga0495606_0028221_3117_3848 238
484 3300046512 Ga0495610_0001284 Ga0495610_0001284_1239_1979 238
485 3300046512 Ga0495610_0084495 Ga0495610_0084495_396_1127 238
486 3300046512 Ga0495610_0149266 Ga0495610_0149266_65_781 238
487 3300046513 Ga0495616_0029910 Ga0495616_0029910_1472_2203 238
488 3300046515 Ga0495620_0008324 Ga0495620_0008324_2794_3525 238
489 3300046519 Ga0495632_0010504 Ga0495632_0010504_3718_4455 238
490 3300046519 Ga0495632_0023287 Ga0495632_0023287_1117_1848 238
491 3300046522 Ga0495643_0007330 Ga0495643_0007330_1032_1763 238
492 3300046522 Ga0495643_0019929 Ga0495643_0019929_1577_2293 238
493 3300046522 Ga0495643_0057970 Ga0495643_0057970_1040_1780 238
494 3300046522 Ga0495643_0065317 Ga0495643_0065317_184_900 238
495 3300046538 Ga0495609_0090334 Ga0495609_0090334_310_1041 238
496 3300046542 Ga0495597_0020023 Ga0495597_0020023_1947_2678 238
497 3300046615 Ga0495656_0096855 Ga0495656_0096855_452_1168 238
498 3300046660 Ga0495625_0109808 Ga0495625_0109808_108_839 238
499 3300046665 Ga0495661_0184016 Ga0495661_0184016_158_889 238
500 3300046810 Ga0495660_0042236 Ga0495660_0042236_1338_2069 238
501 3300047318 Ga0495636_0107834 Ga0495636_0107834_339_1070 238
502 3300047443 Ga0495687_012523 Ga0495687_012523_2437_3168 238
503 3300047472 Ga0495686_0014886 Ga0495686_0014886_988_1728 238
504 3300047472 Ga0495686_0017574 Ga0495686_0017574_1947_2678 238
505 3300048904 Ga0496101_0046834 Ga0496101_0046834_1100_1816 238
506 3300048905 Ga0496102_0070167 Ga0496102_0070167_1229_1945 238
507 3300048906 Ga0496103_0178295 Ga0496103_0178295_340_1056 238
508 3300048907 Ga0496104_0093226 Ga0496104_0093226_672_1388 238
509 3300048908 Ga0496105_0080307 Ga0496105_0080307_689_1405 238
510 3300048910 Ga0496107_0154555 Ga0496107_0154555_512_1228 238
511 3300048910 Ga0496107_0181528 Ga0496107_0181528_294_1013 238
512 3300048916 Ga0496113_0049301 Ga0496113_0049301_1787_2503 238
513 3300048917 Ga0496114_0163759 Ga0496114_0163759_339_1055 238
514 3300048919 Ga0496116_0012537 Ga0496116_0012537_1361_2077 238
515 3300048919 Ga0496116_0046798 Ga0496116_0046798_1407_2123 238
516 3300048919 Ga0496116_0109240 Ga0496116_0109240_668_1399 238
517 3300048921 Ga0496118_0022203 Ga0496118_0022203_3649_4365 238
518 3300048921 Ga0496118_0023607 Ga0496118_0023607_1951_2682 238
519 3300048922 Ga0496119_0031580 Ga0496119_0031580_1533_2249 238
520 3300048924 Ga0496121_0035236 Ga0496121_0035236_1043_1759 238
521 3300048924 Ga0496121_0039195 Ga0496121_0039195_1932_2660 238
522 3300048924 Ga0496121_0128427 Ga0496121_0128427_73_789 238
523 3300048924 Ga0496121_0241126 Ga0496121_0241126_54_773 238
524 3300048925 Ga0496122_0013481 Ga0496122_0013481_3817_4533 238
525 3300048925 Ga0496122_0032126 Ga0496122_0032126_2370_3086 238
526 3300048925 Ga0496122_0064920 Ga0496122_0064920_515_1234 238
527 3300048926 Ga0496123_0070960 Ga0496123_0070960_1089_1808 238
528 3300048927 Ga0496124_0027396 Ga0496124_0027396_1299_2015 238
529 3300048927 Ga0496124_0156693 Ga0496124_0156693_200_916 238
530 3300048928 Ga0496125_0069658 Ga0496125_0069658_846_1562 238
531 3300048929 Ga0496126_0054005 Ga0496126_0054005_1266_1982 238
532 3300049459 Ga0495678_007538 Ga0495678_007538_3673_4413 238
533 3300049572 Ga0501036_0332995 Ga0501036_0332995_92_808 238
534 3300049573 Ga0501037_0048825 Ga0501037_0048825_618_1334 238
535 3300049589 Ga0501073_0053231 Ga0501073_0053231_15_731 238
536 3300049744 Ga0501083_0048394 Ga0501083_0048394_1766_2482 238
537 3300050492 nmdc:mga0yw44_1036_c1 nmdc:mga0yw44_1036_c1_108_839 238
538 3300050493 nmdc:mga0k408_109141_c1 nmdc:mga0k408_109141_c1_79_810 238
539 3300050494 nmdc:mga06z11_59920_c1 nmdc:mga06z11_59920_c1_931_1647 238
540 3300050494 nmdc:mga06z11_66931_c1 nmdc:mga06z11_66931_c1_528_1259 238
541 3300050496 nmdc:mga07m45_48238_c1 nmdc:mga07m45_48238_c1_65_796 238
542 3300053125 Ga0500618_002031 Ga0500618_002031_3016_3798 238
543 3300053134 Ga0500658_0000715 Ga0500658_0000715_1160_1891 238
544 3300053139 Ga0500568_0006560 Ga0500568_0006560_3639_4355 238
545 3300053153 Ga0500616_0010239 Ga0500616_0010239_1948_2679 238
546 3300053156 Ga0500622_0000429 Ga0500622_0000429_6761_7477 238
547 iso_pu_bacteria 2599185352 2600194800 238
548 iso_pu_bacteria 2643221723 2644675869 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

3

177

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ofv-assembly1.cif.gz_C crystal structure of peptidyl-trna hydrolase from escherichia coli, i222 crystal form 0.9361 1 171
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9318 2 175
5imb-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase mutant-n14d from vibrio cholerae 0.9302 1 182
4olj-assembly1.cif.gz_A crystal structure of arg119gln mutant of peptidyl-trna hydrolase from acinetobacter baumannii at 1.49 a resolution 0.9298 1 182
4zxp-assembly3.cif.gz_A crystal structure of peptidyl- trna hydrolase from vibrio cholerae 0.9253 1 182
ID Description Score Start End Superfamily
af_F1M8A9_28_144_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9141 2 107 3.40.50.1470
af_Q10LI6_46_183_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9122 2 131 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9119 1 182 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9098 1 175 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9034 2 175 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A7C1P4V1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9779 1 151 GO:0004045
GO:0005737
GO:0006412
AF-A0A1W9I528-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9775 1 187 GO:0004045
GO:0005737
GO:0006412
AF-A0A2E5L551-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9758 1 186 GO:0004045
GO:0005737
GO:0006412
AF-A0A0Q4FF18-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9744 1 187 GO:0004045
GO:0005737
GO:0006412
AF-A0A1U9KKT1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9742 1 187 GO:0004045
GO:0005737
GO:0006412

Feature Viewer

pLDDT pTM Quality
86.13 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map