F462249

General Info

Members Datasets Scaffolds Average Seq Length
548 255 548 131

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0871407|Ga0395899_0871407_25_429
Length 134
Sequence VVRGSCLCGGVQFELAEEPGPLTFCHCTTCKRLSGGVGTANVGVASTAIRILKGRELLRTFQPSEGSAKTFCAACGANLFGGGWPESERASVRVPTLSDFDPRPANHIFVRSVAPWETVPDDGLDRFEIRATKQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
90 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
91 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
168 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
174 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 11.86
Rhizosphere 86.68
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100413920 3300005329 Bacteria 1286
2 Ga0070690_100012298 3300005330 Bacteria 5036
3 Ga0070690_100282658 3300005330 Bacteria 1184
4 Ga0070670_100315881 3300005331 Bacteria 1368
5 Ga0070677_10327779 3300005333 Unclassified 786
6 Ga0070680_100046651 3300005336 Bacteria 3526
7 Ga0070680_101151428 3300005336 Bacteria 670
8 Ga0070682_100199779 3300005337 Unclassified 1409
9 Ga0070682_100739146 3300005337 Bacteria 793
10 Ga0068868_100018282 3300005338 Bacteria 5237
11 Ga0068868_100184602 3300005338 Bacteria 1732
12 Ga0070660_100089541 3300005339 Bacteria 2425
13 Ga0070691_10003705 3300005341 Bacteria 6903
14 Ga0070687_100439087 3300005343 Unclassified 865
15 Ga0070692_10004824 3300005345 Bacteria 5671
16 Ga0070668_100046665 3300005347 Bacteria 3328
17 Ga0070669_100172363 3300005353 Bacteria 1688
18 Ga0070669_101409272 3300005353 Bacteria 605
19 Ga0070675_101299133 3300005354 Bacteria 670
20 Ga0070671_100203984 3300005355 Bacteria 1677
21 Ga0070674_100048128 3300005356 Bacteria 2925
22 Ga0070674_100213908 3300005356 Bacteria 1496
23 Ga0070673_100343614 3300005364 Bacteria 1323
24 Ga0070673_100590679 3300005364 Bacteria 1012
25 Ga0070688_101385737 3300005365 Bacteria 569
26 Ga0070709_10066396 3300005434 Bacteria 2313
27 Ga0070709_11618907 3300005434 Unclassified 527
28 Ga0070714_100018010 3300005435 Bacteria 5729
29 Ga0070714_101517872 3300005435 Bacteria 654
30 Ga0070713_100635922 3300005436 Unclassified 1015
31 Ga0070713_100740386 3300005436 Bacteria 940
32 Ga0070710_10011446 3300005437 Bacteria 4382
33 Ga0070701_10098522 3300005438 Bacteria 1615
34 Ga0070701_10549728 3300005438 Bacteria 757
35 Ga0070701_10864346 3300005438 Unclassified 622
36 Ga0070711_100133350 3300005439 Bacteria 1853
37 Ga0070711_100227349 3300005439 Bacteria 1453
38 Ga0070711_100475332 3300005439 Unclassified 1026
39 Ga0070705_100006207 3300005440 Bacteria 5851
40 Ga0070705_100012596 3300005440 Bacteria 4302
41 Ga0070700_100012297 3300005441 Bacteria 4770
42 Ga0070700_100226047 3300005441 Bacteria 1329
43 Ga0070694_100005836 3300005444 Bacteria 7470
44 Ga0070708_100248337 3300005445 Bacteria 1671
45 Ga0070663_100554981 3300005455 Bacteria 961
46 Ga0070678_100061133 3300005456 Bacteria 2775
47 Ga0070662_100086978 3300005457 Bacteria 2339
48 Ga0068867_100474000 3300005459 Bacteria 1071
49 Ga0070706_100435345 3300005467 Bacteria 1220
50 Ga0070698_100015275 3300005471 Bacteria 8119
51 Ga0070698_100682642 3300005471 Bacteria 969
52 Ga0070698_101863955 3300005471 Unclassified 554
53 Ga0070699_100057743 3300005518 Bacteria 3361
54 Ga0070679_100181908 3300005530 Bacteria 2074
55 Ga0070697_100115722 3300005536 Bacteria 2239
56 Ga0070697_100533743 3300005536 Bacteria 1028
57 Ga0070697_101113198 3300005536 Unclassified 703
58 Ga0070672_100646850 3300005543 Bacteria 923
59 Ga0070672_101608488 3300005543 Unclassified 583
60 Ga0070686_100009062 3300005544 Bacteria 5582
61 Ga0070686_100496549 3300005544 Bacteria 946
62 Ga0070695_100125320 3300005545 Bacteria 1763
63 Ga0070696_100005650 3300005546 Bacteria 8356
64 Ga0070696_100065183 3300005546 Bacteria 2553
65 Ga0070696_100217580 3300005546 Bacteria 1432
66 Ga0070693_100010651 3300005547 Bacteria 4610
67 Ga0070693_100022440 3300005547 Bacteria 3357
68 Ga0070665_101239583 3300005548 Bacteria 756
69 Ga0070704_100038004 3300005549 Bacteria 3293
70 Ga0070704_100088356 3300005549 Bacteria 2302
71 Ga0068855_100048908 3300005563 Bacteria 4989
72 Ga0068856_100517491 3300005614 Bacteria 1214
73 Ga0068856_100750853 3300005614 Bacteria 996
74 Ga0070702_100012892 3300005615 Bacteria 4209
75 Ga0070702_100191463 3300005615 Bacteria 1346
76 Ga0068852_100226072 3300005616 Unclassified 1782
77 Ga0068859_100871358 3300005617 Unclassified 986
78 Ga0068864_100037567 3300005618 Bacteria 4133
79 Ga0068861_100008499 3300005719 Bacteria 7069
80 Ga0068863_100892114 3300005841 Bacteria 889
81 Ga0068858_101261018 3300005842 Unclassified 727
82 Ga0068860_100034743 3300005843 Bacteria 4837
83 Ga0068860_102467786 3300005843 Bacteria 540
84 Ga0068862_100055214 3300005844 Bacteria 3402
85 Ga0081455_10043709 3300005937 Bacteria 3916
86 Ga0070717_10127628 3300006028 Bacteria 2185
87 Ga0070717_10245637 3300006028 Bacteria 1580
88 Ga0070717_10352010 3300006028 Unclassified 1317
89 Ga0075365_10082483 3300006038 Bacteria 2180
90 Ga0075432_10013011 3300006058 Bacteria 2828
91 Ga0075432_10034708 3300006058 Bacteria 1753
92 Ga0075432_10070883 3300006058 Bacteria 1252
93 Ga0070715_10261900 3300006163 Bacteria 908
94 Ga0070716_100117591 3300006173 Bacteria 1658
95 Ga0070712_100128720 3300006175 Bacteria 1916
96 Ga0070712_101060612 3300006175 Bacteria 702
97 Ga0075367_10419495 3300006178 Bacteria 847
98 Ga0075367_11037065 3300006178 Bacteria 524
99 Ga0075427_10088061 3300006194 Unclassified 567
100 Ga0097621_100017668 3300006237 Bacteria 5424
101 Ga0068871_100317649 3300006358 Bacteria 1371
102 Ga0075428_100021782 3300006844 Bacteria 7096
103 Ga0075428_100142839 3300006844 Bacteria 2602
104 Ga0075428_100178294 3300006844 Bacteria 2301
105 Ga0075430_100044310 3300006846 Bacteria 3763
106 Ga0075430_100230011 3300006846 Bacteria 1537
107 Ga0075430_100277825 3300006846 Bacteria 1386
108 Ga0075431_100078992 3300006847 Bacteria 3397
109 Ga0075431_100138237 3300006847 Bacteria 2511
110 Ga0075431_100277915 3300006847 Bacteria 1696
111 Ga0075431_100531004 3300006847 Unclassified 1165
112 Ga0075433_10052020 3300006852 Bacteria 3568
113 Ga0075433_11810392 3300006852 Bacteria 525
114 Ga0075434_100072971 3300006871 Bacteria 3424
115 Ga0075434_100423163 3300006871 Bacteria 1353
116 Ga0075434_100431524 3300006871 Bacteria 1339
117 Ga0075429_100010729 3300006880 Bacteria 7922
118 Ga0075429_100452650 3300006880 Bacteria 1125
119 Ga0075429_101391882 3300006880 Bacteria 611
120 Ga0068865_100045592 3300006881 Bacteria 3005
121 Ga0068865_100383970 3300006881 Bacteria 1146
122 Ga0075436_100025241 3300006914 Bacteria 4088
123 Ga0075436_100686750 3300006914 Unclassified 758
124 Ga0075436_101301627 3300006914 Unclassified 550
125 Ga0097620_100871278 3300006931 Unclassified 986
126 Ga0075435_100037341 3300007076 Bacteria 3867
127 Ga0075435_100046816 3300007076 Bacteria 3471
128 Ga0075435_100194491 3300007076 Bacteria 1717
129 Ga0105240_11315103 3300009093 Unclassified 762
130 Ga0105240_11445854 3300009093 Unclassified 722
131 Ga0111539_10045158 3300009094 Bacteria 5275
132 Ga0111539_10048461 3300009094 Bacteria 5072
133 Ga0111539_10139464 3300009094 Bacteria 2839
134 Ga0111539_10701702 3300009094 Bacteria 1178
135 Ga0105245_10019550 3300009098 Bacteria 5933
136 Ga0105245_10034650 3300009098 Bacteria 4478
137 Ga0105245_10053387 3300009098 Bacteria 3627
138 Ga0105245_10238295 3300009098 Bacteria 1762
139 Ga0105245_10685343 3300009098 Bacteria 1057
140 Ga0105245_10747344 3300009098 Bacteria 1014
141 Ga0114129_10059641 3300009147 Bacteria 5334
142 Ga0114129_10137036 3300009147 Bacteria 3358
143 Ga0114129_10172265 3300009147 Unclassified 2950
144 Ga0114129_10180652 3300009147 Bacteria 2871
145 Ga0114129_10207190 3300009147 Bacteria 2653
146 Ga0114129_10481182 3300009147 Bacteria 1624
147 Ga0114129_11384631 3300009147 Unclassified 868
148 Ga0114129_11418455 3300009147 Bacteria 856
149 Ga0114129_11671851 3300009147 Unclassified 778
150 Ga0114129_13060268 3300009147 Unclassified 548
151 Ga0114129_13219045 3300009147 Unclassified 530
152 Ga0105243_10196798 3300009148 Bacteria 1765
153 Ga0105243_10202435 3300009148 Unclassified 1742
154 Ga0105243_10309703 3300009148 Bacteria 1434
155 Ga0105243_10400740 3300009148 Bacteria 1274
156 Ga0105243_10491090 3300009148 Bacteria 1161
157 Ga0105243_11455954 3300009148 Bacteria 707
158 Ga0105241_10331955 3300009174 Bacteria 1315
159 Ga0105242_10065272 3300009176 Bacteria 3003
160 Ga0105242_10525110 3300009176 Bacteria 1130
161 Ga0105248_10177650 3300009177 Bacteria 2399
162 Ga0105248_10233358 3300009177 Bacteria 2071
163 Ga0105237_10173958 3300009545 Bacteria 2153
164 Ga0105238_10227731 3300009551 Bacteria 1841
165 Ga0105249_10038733 3300009553 Bacteria 4325
166 Ga0105249_10128773 3300009553 Bacteria 2414
167 Ga0105249_11274603 3300009553 Bacteria 806
168 Ga0105239_10033043 3300010375 Bacteria 5682
169 Ga0105239_10417992 3300010375 Bacteria 1519
170 Ga0157341_1036176 3300012494 Unclassified 554
171 Ga0157315_1070020 3300012508 Unclassified 514
172 Ga0157316_1003600 3300012510 Bacteria 1127
173 Ga0157371_10884831 3300013102 Unclassified 677
174 Ga0157371_11535341 3300013102 Bacteria 520
175 Ga0157374_10066011 3300013296 Bacteria 3400
176 Ga0157378_10112297 3300013297 Bacteria 2500
177 Ga0163162_10174147 3300013306 Bacteria 2277
178 Ga0157372_10065653 3300013307 Bacteria 4075
179 Ga0157372_11401001 3300013307 Bacteria 806
180 Ga0157375_10028599 3300013308 Bacteria 5228
181 Ga0157380_10024437 3300014326 Bacteria 4574
182 Ga0182008_10073955 3300014497 Bacteria 1677
183 Ga0157377_10153962 3300014745 Bacteria 1424
184 Ga0157377_10668021 3300014745 Unclassified 750
185 Ga0157376_10044974 3300014969 Bacteria 3632
186 Ga0157376_10472990 3300014969 Bacteria 1227
187 Ga0163161_10016355 3300017792 Bacteria 5177
188 Ga0207642_10083440 3300025899 Bacteria 1558
189 Ga0207642_10454475 3300025899 Bacteria 777
190 Ga0207685_10033233 3300025905 Bacteria 1863
191 Ga0207699_10034222 3300025906 Bacteria 2879
192 Ga0207693_10009234 3300025915 Bacteria 8051
193 Ga0207663_10028315 3300025916 Bacteria 3278
194 Ga0207663_10474309 3300025916 Unclassified 968
195 Ga0207660_10351480 3300025917 Bacteria 1181
196 Ga0207657_10022820 3300025919 Bacteria 5843
197 Ga0207681_10267030 3300025923 Bacteria 1342
198 Ga0207659_10145854 3300025926 Bacteria 1843
199 Ga0207659_10678659 3300025926 Bacteria 881
200 Ga0207659_11007836 3300025926 Bacteria 717
201 Ga0207687_10062716 3300025927 Bacteria 2630
202 Ga0207687_10372403 3300025927 Bacteria 1168
203 Ga0207687_11131568 3300025927 Unclassified 673
204 Ga0207700_10379718 3300025928 Bacteria 1235
205 Ga0207664_10017862 3300025929 Bacteria 5211
206 Ga0207644_10235952 3300025931 Bacteria 1455
207 Ga0207690_10012597 3300025932 Bacteria 5063
208 Ga0207706_10014118 3300025933 Bacteria 7243
209 Ga0207706_11238461 3300025933 Bacteria 619
210 Ga0207686_10069425 3300025934 Bacteria 2260
211 Ga0207709_10409337 3300025935 Bacteria 1039
212 Ga0207709_11674454 3300025935 Bacteria 529
213 Ga0207669_10254287 3300025937 Unclassified 1310
214 Ga0207704_10389972 3300025938 Bacteria 1096
215 Ga0207704_11145616 3300025938 Bacteria 662
216 Ga0207665_10002725 3300025939 Bacteria 11850
217 Ga0207691_10401241 3300025940 Bacteria 1169
218 Ga0207691_11017674 3300025940 Bacteria 691
219 Ga0207711_10146726 3300025941 Bacteria 2126
220 Ga0207661_10259993 3300025944 Bacteria 1546
221 Ga0207667_10314291 3300025949 Bacteria 1600
222 Ga0207651_10263330 3300025960 Bacteria 1417
223 Ga0207651_11429217 3300025960 Unclassified 623
224 Ga0207712_10089849 3300025961 Bacteria 2259
225 Ga0207712_10664683 3300025961 Unclassified 907
226 Ga0207668_10471026 3300025972 Bacteria 1076
227 Ga0207668_10796449 3300025972 Bacteria 836
228 Ga0207668_10823052 3300025972 Unclassified 823
229 Ga0207640_10041914 3300025981 Bacteria 2915
230 Ga0207658_10576940 3300025986 Bacteria 1009
231 Ga0207677_10015924 3300026023 Bacteria 4439
232 Ga0207677_10253086 3300026023 Bacteria 1431
233 Ga0207677_11821314 3300026023 Unclassified 565
234 Ga0207703_10912819 3300026035 Bacteria 841
235 Ga0207678_10091196 3300026067 Bacteria 2604
236 Ga0207708_10091945 3300026075 Bacteria 2340
237 Ga0207708_10101424 3300026075 Bacteria 2228
238 Ga0207702_10165412 3300026078 Bacteria 2023
239 Ga0207641_10223659 3300026088 Bacteria 1747
240 Ga0207648_10003852 3300026089 Bacteria 15674
241 Ga0207648_10070333 3300026089 Bacteria 3051
242 Ga0207676_10341636 3300026095 Bacteria 1381
243 Ga0207675_100020206 3300026118 Bacteria 6209
244 Ga0207675_100025473 3300026118 Bacteria 5506
245 Ga0207683_10019406 3300026121 Bacteria 5805
246 Ga0207683_10077992 3300026121 Bacteria 2935
247 Ga0209966_1003854 3300027695 Bacteria 2531
248 Ga0207428_10002045 3300027907 Bacteria 20377
249 Ga0207428_10002288 3300027907 Bacteria 19226
250 Ga0207428_10192095 3300027907 Bacteria 1539
251 Ga0268265_10233472 3300028380 Bacteria 1618
252 Ga0307408_102061756 3300031548 Unclassified 549
253 Ga0307410_10849839 3300031852 Unclassified 779
254 Ga0307409_100032243 3300031995 Bacteria 3796
255 Ga0307409_100276042 3300031995 Bacteria 1551
256 Ga0307415_101111981 3300032126 Unclassified 740
257 Ga0373948_0013626 3300034817 Bacteria 1471
258 Ga0373959_0054627 3300034820 Bacteria 870
259 Ga0373938_0249312 3300034957 Viruses 507
260 Ga0373940_0285544 3300035088 Bacteria 565
261 Ga0373939_0222776 3300035114 Bacteria 723
262 Ga0373960_0185122 3300035121 Unclassified 729
263 Ga0373943_0912711 3300035170 Unclassified 525
264 Ga0373946_0031397 3300035171 Bacteria 2127
265 Ga0373961_0006539 3300035241 Bacteria 2801
266 Ga0373962_0022260 3300035242 Unclassified 1679
267 Ga0373931_0395552 3300035691 Unclassified 874
268 Ga0373935_0640657 3300035692 Bacteria 779
269 Ga0395899_0011110 3300037312 Bacteria 6897
270 Ga0395899_0029409 3300037312 Bacteria 4132
271 Ga0395899_0051369 3300037312 Bacteria 3060
272 Ga0395899_0092770 3300037312 Bacteria 2186
273 Ga0395899_0154773 3300037312 Bacteria 1623
274 Ga0395899_0457652 3300037312 Bacteria 834
275 Ga0395899_0811122 3300037312 Bacteria 577
276 Ga0395899_0871407 3300037312 Unclassified 551
277 Ga0395900_0004582 3300037418 Bacteria 14585
278 Ga0395900_0008009 3300037418 Bacteria 10874
279 Ga0395900_0010714 3300037418 Bacteria 9377
280 Ga0395900_0016921 3300037418 Bacteria 7442
281 Ga0395900_0059143 3300037418 Bacteria 3945
282 Ga0395900_0293418 3300037418 Bacteria 1614
283 Ga0395900_0445083 3300037418 Unclassified 1252
284 Ga0395900_0462337 3300037418 Unclassified 1223
285 Ga0395900_0480168 3300037418 Bacteria 1195
286 Ga0395900_0487831 3300037418 Unclassified 1184
287 Ga0395900_0786845 3300037418 Bacteria 880
288 Ga0395900_1219892 3300037418 Unclassified 667
289 Ga0395898_0003528 3300037466 Bacteria 17440
290 Ga0395898_0007785 3300037466 Bacteria 11371
291 Ga0395898_0008049 3300037466 Bacteria 11172
292 Ga0395898_0016545 3300037466 Bacteria 7542
293 Ga0395898_0075559 3300037466 Bacteria 3254
294 Ga0395898_0096032 3300037466 Unclassified 2847
295 Ga0395898_0202519 3300037466 Bacteria 1894
296 Ga0395898_0220332 3300037466 Bacteria 1810
297 Ga0395898_0360232 3300037466 Bacteria 1387
298 Ga0395898_0610809 3300037466 Bacteria 1033
299 Ga0395898_1111485 3300037466 Bacteria 723
300 Ga0395898_1184773 3300037466 Bacteria 695
301 Ga0395905_0002818 3300037471 Bacteria 19056
302 Ga0395905_0014081 3300037471 Bacteria 7646
303 Ga0395905_0014945 3300037471 Bacteria 7405
304 Ga0395905_0022616 3300037471 Bacteria 5943
305 Ga0395905_0036372 3300037471 Bacteria 4624
306 Ga0395905_0087844 3300037471 Bacteria 2914
307 Ga0395905_0171773 3300037471 Bacteria 2036
308 Ga0395905_0315691 3300037471 Bacteria 1452
309 Ga0395905_0460177 3300037471 Bacteria 1170
310 Ga0395905_0568628 3300037471 Bacteria 1035
311 Ga0395901_0012915 3300038443 Bacteria 8471
312 Ga0395901_0019084 3300038443 Bacteria 7011
313 Ga0395901_0021294 3300038443 Bacteria 6640
314 Ga0395901_0026742 3300038443 Bacteria 5923
315 Ga0395901_0061062 3300038443 Bacteria 3922
316 Ga0395901_0105377 3300038443 Bacteria 2959
317 Ga0395901_0139586 3300038443 Bacteria 2547
318 Ga0395901_0169235 3300038443 Bacteria 2293
319 Ga0395901_0176251 3300038443 Bacteria 2243
320 Ga0395901_0179445 3300038443 Bacteria 2221
321 Ga0395901_0435477 3300038443 Bacteria 1343
322 Ga0395901_0696002 3300038443 Bacteria 1014
323 Ga0395901_0989570 3300038443 Bacteria 817
324 Ga0395901_1058039 3300038443 Unclassified 784
325 Ga0395901_1697948 3300038443 Unclassified 583
326 Ga0451802_1118619 3300041460 Unclassified 552
327 Ga0451804_0467396 3300041463 Bacteria 1159
328 Ga0451839_0752305 3300041496 Bacteria 940
329 Ga0451841_1118202 3300041498 Bacteria 700
330 Ga0451845_0548414 3300041501 Bacteria 781
331 Ga0451853_3109224 3300041512 Bacteria 1977
332 Ga0439448_0055193 3300042005 Bacteria 1306
333 Ga0450920_028675 3300042122 Bacteria 1091
334 Ga0450907_005644 3300042146 Unclassified 2107
335 Ga0450907_029451 3300042146 Bacteria 932
336 Ga0450918_014956 3300042531 Bacteria 1349
337 Ga0495580_0325231 3300046472 Bacteria 1045
338 Ga0495582_0313355 3300046473 Bacteria 902
339 Ga0495584_0035195 3300046491 Bacteria 2532
340 Ga0495594_0467813 3300046499 Bacteria 717
341 Ga0495596_0072137 3300046500 Bacteria 1341
342 Ga0495607_0294519 3300046501 Bacteria 766
343 Ga0495631_0253139 3300046518 Bacteria 751
344 Ga0495644_0146195 3300046523 Bacteria 904
345 Ga0495644_0209182 3300046523 Unclassified 753
346 Ga0495663_0144598 3300046525 Bacteria 809
347 Ga0495663_0228472 3300046525 Bacteria 656
348 Ga0495598_0325544 3300046537 Unclassified 587
349 Ga0495656_0343155 3300046615 Bacteria 773
350 Ga0495656_0486374 3300046615 Bacteria 653
351 Ga0495656_0742068 3300046615 Bacteria 529
352 Ga0495668_0257819 3300046616 Bacteria 955
353 Ga0495611_0132974 3300046648 Unclassified 1161
354 Ga0495659_0011573 3300046664 Bacteria 2843
355 Ga0495661_0258071 3300046665 Bacteria 887
356 Ga0495588_0409027 3300046674 Bacteria 712
357 Ga0495670_0272908 3300046691 Bacteria 904
358 Ga0495671_0423196 3300046692 Unclassified 637
359 Ga0495671_0456958 3300046692 Unclassified 610
360 Ga0496100_0111075 3300048903 Bacteria 1904
361 Ga0496100_0133604 3300048903 Bacteria 1750
362 Ga0496100_0303799 3300048903 Bacteria 1195
363 Ga0496100_0725202 3300048903 Bacteria 776
364 Ga0496100_1368861 3300048903 Unclassified 558
365 Ga0496101_0214531 3300048904 Bacteria 1492
366 Ga0496101_0214703 3300048904 Bacteria 1491
367 Ga0496101_0246859 3300048904 Unclassified 1390
368 Ga0496101_0609361 3300048904 Bacteria 863
369 Ga0496101_0739096 3300048904 Unclassified 776
370 Ga0496102_0094765 3300048905 Bacteria 2766
371 Ga0496102_0122035 3300048905 Bacteria 2434
372 Ga0496102_0272879 3300048905 Bacteria 1594
373 Ga0496102_0703976 3300048905 Bacteria 933
374 Ga0496103_0110830 3300048906 Bacteria 1743
375 Ga0496103_0961847 3300048906 Unclassified 533
376 Ga0496104_0001925 3300048907 Bacteria 17988
377 Ga0496104_0003031 3300048907 Bacteria 14474
378 Ga0496104_0143623 3300048907 Bacteria 2292
379 Ga0496105_0001301 3300048908 Bacteria 17470
380 Ga0496105_0075861 3300048908 Bacteria 2776
381 Ga0496105_0156040 3300048908 Bacteria 1874
382 Ga0496106_0181803 3300048909 Bacteria 1669
383 Ga0496106_0201742 3300048909 Bacteria 1583
384 Ga0496106_0351358 3300048909 Bacteria 1184
385 Ga0496106_0796835 3300048909 Bacteria 749
386 Ga0496107_0185392 3300048910 Bacteria 1545
387 Ga0496107_0768290 3300048910 Bacteria 706
388 Ga0496108_0001139 3300048911 Bacteria 20752
389 Ga0496108_0054623 3300048911 Bacteria 3352
390 Ga0496108_0058145 3300048911 Bacteria 3249
391 Ga0496108_0063168 3300048911 Bacteria 3118
392 Ga0496108_1169897 3300048911 Unclassified 651
393 Ga0496108_1461819 3300048911 Unclassified 570
394 Ga0496109_0007510 3300048912 Bacteria 9234
395 Ga0496109_0009410 3300048912 Bacteria 8327
396 Ga0496109_0152391 3300048912 Bacteria 2164
397 Ga0496110_0021230 3300048913 Bacteria 5493
398 Ga0496110_0044493 3300048913 Bacteria 3877
399 Ga0496110_0056468 3300048913 Bacteria 3455
400 Ga0496110_0106356 3300048913 Bacteria 2517
401 Ga0496110_0143267 3300048913 Bacteria 2161
402 Ga0496111_0000183 3300048914 Bacteria 28637
403 Ga0496111_0008644 3300048914 Bacteria 6752
404 Ga0496111_0060091 3300048914 Bacteria 2754
405 Ga0496111_0132646 3300048914 Bacteria 1844
406 Ga0496111_0588537 3300048914 Bacteria 815
407 Ga0496112_0003540 3300048915 Bacteria 12965
408 Ga0496112_0038728 3300048915 Bacteria 4656
409 Ga0496112_0152147 3300048915 Bacteria 2281
410 Ga0496112_0228387 3300048915 Bacteria 1816
411 Ga0496112_0333721 3300048915 Bacteria 1460
412 Ga0496112_1012962 3300048915 Bacteria 750
413 Ga0496113_0309493 3300048916 Unclassified 1265
414 Ga0496114_0025271 3300048917 Bacteria 4854
415 Ga0496114_0163546 3300048917 Unclassified 1936
416 Ga0496114_0576274 3300048917 Unclassified 993
417 Ga0496114_1443730 3300048917 Unclassified 575
418 Ga0496115_0014681 3300048918 Bacteria 5932
419 Ga0496115_0366627 3300048918 Bacteria 1173
420 Ga0496115_0977160 3300048918 Unclassified 648
421 Ga0496115_1170490 3300048918 Bacteria 579
422 Ga0496115_1270785 3300048918 Unclassified 550
423 Ga0501031_0001976 3300049568 Bacteria 12947
424 Ga0501031_0091348 3300049568 Bacteria 1986
425 Ga0501032_0006726 3300049569 Bacteria 8438
426 Ga0501033_0004305 3300049570 Bacteria 11427
427 Ga0501034_0005985 3300049571 Bacteria 13159
428 Ga0501036_0066566 3300049572 Bacteria 3048
429 Ga0501037_0007726 3300049573 Bacteria 7872
430 Ga0501037_0068373 3300049573 Bacteria 2586
431 Ga0501038_0003559 3300049574 Bacteria 14496
432 Ga0501038_0181466 3300049574 Bacteria 1698
433 Ga0501039_0019537 3300049575 Bacteria 5194
434 Ga0501039_0189210 3300049575 Bacteria 1619
435 Ga0501039_0200161 3300049575 Bacteria 1570
436 Ga0501039_0403282 3300049575 Bacteria 1074
437 Ga0501039_1043227 3300049575 Bacteria 634
438 Ga0501040_0081988 3300049576 Bacteria 2235
439 Ga0501040_0212222 3300049576 Bacteria 1376
440 Ga0501041_0204396 3300049577 Bacteria 1238
441 Ga0501042_0034503 3300049578 Bacteria 3588
442 Ga0501042_0166500 3300049578 Unclassified 1590
443 Ga0501042_0571433 3300049578 Bacteria 822
444 Ga0501043_0039536 3300049579 Bacteria 3706
445 Ga0501046_0016777 3300049580 Bacteria 6122
446 Ga0501046_0155213 3300049580 Unclassified 1725
447 Ga0501047_0182249 3300049581 Bacteria 1966
448 Ga0501048_0008231 3300049582 Bacteria 7888
449 Ga0501048_0161990 3300049582 Bacteria 1583
450 Ga0501067_0007819 3300049583 Bacteria 5946
451 Ga0501068_0006523 3300049584 Bacteria 6437
452 Ga0501069_0002815 3300049585 Bacteria 8898
453 Ga0501069_0046413 3300049585 Bacteria 2409
454 Ga0501069_0666461 3300049585 Bacteria 626
455 Ga0501070_0005213 3300049586 Bacteria 11078
456 Ga0501070_0181144 3300049586 Bacteria 1734
457 Ga0501071_0074500 3300049587 Bacteria 2477
458 Ga0501071_0143690 3300049587 Bacteria 1778
459 Ga0501071_0183229 3300049587 Bacteria 1569
460 Ga0501071_0733443 3300049587 Unclassified 761
461 Ga0501071_1577023 3300049587 Bacteria 507
462 Ga0501072_0029638 3300049588 Bacteria 4276
463 Ga0501072_0110584 3300049588 Bacteria 2187
464 Ga0501072_0345999 3300049588 Bacteria 1180
465 Ga0501072_0442361 3300049588 Unclassified 1030
466 Ga0501072_0522096 3300049588 Bacteria 939
467 Ga0501072_0732798 3300049588 Bacteria 776
468 Ga0501072_0886250 3300049588 Bacteria 697
469 Ga0501073_0007092 3300049589 Bacteria 8347
470 Ga0501073_0186419 3300049589 Bacteria 1436
471 Ga0501073_0371965 3300049589 Bacteria 987
472 Ga0501074_0020522 3300049590 Bacteria 4801
473 Ga0501074_0171989 3300049590 Bacteria 1546
474 Ga0501074_0259012 3300049590 Bacteria 1237
475 Ga0501074_0400265 3300049590 Bacteria 974
476 Ga0501074_0606189 3300049590 Bacteria 774
477 Ga0501074_0821237 3300049590 Bacteria 655
478 Ga0501074_0957127 3300049590 Unclassified 602
479 Ga0501075_0035592 3300049591 Bacteria 3714
480 Ga0501075_0084057 3300049591 Bacteria 2410
481 Ga0501075_0234184 3300049591 Bacteria 1400
482 Ga0501076_0110212 3300049592 Bacteria 2225
483 Ga0501076_0148896 3300049592 Bacteria 1903
484 Ga0501076_0164120 3300049592 Bacteria 1810
485 Ga0501077_0060239 3300049593 Bacteria 2409
486 Ga0501077_0163922 3300049593 Bacteria 1411
487 Ga0501077_0227341 3300049593 Bacteria 1186
488 Ga0501079_0036694 3300049741 Bacteria 3775
489 Ga0501079_0061352 3300049741 Bacteria 2900
490 Ga0501079_0184862 3300049741 Bacteria 1627
491 Ga0501079_0470813 3300049741 Unclassified 987
492 Ga0501079_0508745 3300049741 Unclassified 947
493 Ga0501080_0034259 3300049742 Bacteria 4739
494 Ga0501080_0317766 3300049742 Bacteria 1410
495 Ga0501081_0112665 3300049743 Bacteria 1931
496 Ga0501081_0406623 3300049743 Bacteria 1008
497 Ga0501081_1540952 3300049743 Unclassified 505
498 Ga0501083_0003927 3300049744 Bacteria 10441
499 Ga0501083_0415853 3300049744 Unclassified 875
500 Ga0501035_0028764 3300049822 Bacteria 5071
501 Ga0501035_0692904 3300049822 Bacteria 822
502 Ga0501044_0028326 3300049823 Bacteria 5913
503 Ga0501044_0216427 3300049823 Bacteria 1868
504 Ga0501045_0019948 3300049824 Bacteria 4784
505 Ga0501045_0371053 3300049824 Bacteria 1065
506 nmdc:mga06z11_949844_c1 3300050494 Bacteria 524
507 nmdc:mga05p37_123991_c1 3300050507 Bacteria 3174
508 nmdc:mga05p37_1295403_c1 3300050507 Bacteria 743
509 nmdc:mga05p37_42629_c1 3300050507 Bacteria 5577
510 nmdc:mga05p37_631085_c1 3300050507 Bacteria 1204
511 nmdc:mga09592_112631_c1 3300050508 Bacteria 2334
512 nmdc:mga09592_131004_c1 3300050508 Bacteria 2157
513 nmdc:mga09592_26880_c1 3300050508 Bacteria 4771
514 nmdc:mga09592_655182_c1 3300050508 Bacteria 896
515 nmdc:mga0qj67_42413_c1 3300050509 Unclassified 3581
516 nmdc:mga0qj67_458654_c1 3300050509 Bacteria 1026
517 nmdc:mga0qj67_6844_c1 3300050509 Bacteria 8381
518 nmdc:mga06r32_30826_c1 3300050510 Bacteria 5033
519 nmdc:mga06r32_396769_c1 3300050510 Bacteria 1362
520 nmdc:mga06r32_603516_c1 3300050510 Unclassified 1068
521 nmdc:mga08y16_28182_c1 3300050511 Bacteria 5920
522 nmdc:mga08y16_43502_c1 3300050511 Bacteria 4707
523 nmdc:mga08y16_597634_c1 3300050511 Bacteria 1112
524 nmdc:mga08y16_7052_c1 3300050511 Bacteria 11795
525 nmdc:mga0n895_10995_c1 3300050512 Bacteria 8045
526 nmdc:mga0n895_1704423_c1 3300050512 Bacteria 593
527 nmdc:mga0n895_211131_c1 3300050512 Bacteria 1971
528 nmdc:mga0n895_437505_c1 3300050512 Bacteria 1321
529 nmdc:mga0rr50_146907_c1 3300050513 Bacteria 1902
530 nmdc:mga0rr50_17517_c1 3300050513 Bacteria 4786
531 nmdc:mga0rr50_497274_c1 3300050513 Bacteria 1037
532 nmdc:mga0rr50_59584_c1 3300050513 Bacteria 2867
533 nmdc:mga08x19_1086063_c1 3300050514 Bacteria 568
534 nmdc:mga0a205_143257_c1 3300050515 Bacteria 2290
535 nmdc:mga0a205_18699_c1 3300050515 Bacteria 6521
536 nmdc:mga0a205_279475_c1 3300050515 Bacteria 1545
537 nmdc:mga0a205_412161_c1 3300050515 Bacteria 1214
538 nmdc:mga0a205_75592_c1 3300050515 Bacteria 3255
539 Ga0501084_0067247 3300054114 Bacteria 2999
540 Ga0501084_0109424 3300054114 Unclassified 2322
541 Ga0501084_0356458 3300054114 Bacteria 1236
542 Ga0501084_0508895 3300054114 Bacteria 1018
543 Ga0501084_1121499 3300054114 Unclassified 660
544 Ga0501082_0167183 3300060353 Bacteria 1911
545 Ga0501082_0367469 3300060353 Bacteria 1255
546 Ga0530510_0038731 3300061734 Bacteria 3442
547 Ga0530510_0043873 3300061734 Bacteria 3231
548 Ga0530510_0609482 3300061734 Bacteria 830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0313355 Ga0495582_0313355_409_750 112
2 3300046499 Ga0495594_0467813 Ga0495594_0467813_223_564 112
3 3300049741 Ga0501079_0508745 Ga0501079_0508745_365_721 117
4 3300054114 Ga0501084_0508895 Ga0501084_0508895_194_550 117
5 3300005437 Ga0070710_10011446 Ga0070710_100114462 118
6 3300005614 Ga0068856_100517491 Ga0068856_1005174913 118
7 3300006175 Ga0070712_100128720 Ga0070712_1001287202 118
8 3300009177 Ga0105248_10177650 Ga0105248_101776502 118
9 3300013102 Ga0157371_11535341 Ga0157371_115353411 118
10 3300014745 Ga0157377_10153962 Ga0157377_101539622 118
11 3300025906 Ga0207699_10034222 Ga0207699_100342221 118
12 3300025915 Ga0207693_10009234 Ga0207693_100092341 118
13 3300025916 Ga0207663_10028315 Ga0207663_100283151 118
14 3300025929 Ga0207664_10017862 Ga0207664_100178622 118
15 3300026088 Ga0207641_10223659 Ga0207641_102236593 118
16 3300026089 Ga0207648_10070333 Ga0207648_100703332 118
17 3300035088 Ga0373940_0285544 Ga0373940_0285544_68_424 118
18 3300035114 Ga0373939_0222776 Ga0373939_0222776_243_599 118
19 3300035691 Ga0373931_0395552 Ga0373931_0395552_80_436 118
20 3300048904 Ga0496101_0246859 Ga0496101_0246859_723_1079 118
21 3300048907 Ga0496104_0003031 Ga0496104_0003031_4557_4913 118
22 3300048908 Ga0496105_0001301 Ga0496105_0001301_12686_13042 118
23 3300048911 Ga0496108_0001139 Ga0496108_0001139_9883_10239 118
24 3300048912 Ga0496109_0007510 Ga0496109_0007510_8045_8401 118
25 3300048913 Ga0496110_0021230 Ga0496110_0021230_4006_4362 118
26 3300048913 Ga0496110_0056468 Ga0496110_0056468_2232_2588 118
27 3300048914 Ga0496111_0000183 Ga0496111_0000183_13824_14180 118
28 3300048915 Ga0496112_0038728 Ga0496112_0038728_3168_3524 118
29 3300048916 Ga0496113_0309493 Ga0496113_0309493_491_847 118
30 3300048917 Ga0496114_0025271 Ga0496114_0025271_3440_3796 118
31 3300048918 Ga0496115_0014681 Ga0496115_0014681_1074_1430 118
32 3300048918 Ga0496115_0366627 Ga0496115_0366627_574_930 118
33 3300048918 Ga0496115_1170490 Ga0496115_1170490_112_468 118
34 3300009093 Ga0105240_11445854 Ga0105240_114458541 122
35 3300009098 Ga0105245_10053387 Ga0105245_100533872 122
36 3300009098 Ga0105245_10747344 Ga0105245_107473442 122
37 3300009148 Ga0105243_10400740 Ga0105243_104007402 122
38 3300009176 Ga0105242_10525110 Ga0105242_105251101 122
39 3300009553 Ga0105249_11274603 Ga0105249_112746032 122
40 3300010375 Ga0105239_10417992 Ga0105239_104179922 122
41 3300013306 Ga0163162_10174147 Ga0163162_101741472 122
42 3300013307 Ga0157372_11401001 Ga0157372_114010012 122
43 3300037312 Ga0395899_0092770 Ga0395899_0092770_180_551 122
44 3300037312 Ga0395899_0811122 Ga0395899_0811122_89_460 122
45 3300037418 Ga0395900_0004582 Ga0395900_0004582_10260_10631 122
46 3300037418 Ga0395900_0462337 Ga0395900_0462337_103_474 122
47 3300037418 Ga0395900_0480168 Ga0395900_0480168_52_423 122
48 3300037466 Ga0395898_0007785 Ga0395898_0007785_4722_5093 122
49 3300037466 Ga0395898_1184773 Ga0395898_1184773_95_466 122
50 3300037471 Ga0395905_0014945 Ga0395905_0014945_286_657 122
51 3300037471 Ga0395905_0171773 Ga0395905_0171773_1256_1627 122
52 3300037471 Ga0395905_0460177 Ga0395905_0460177_176_547 122
53 3300038443 Ga0395901_0061062 Ga0395901_0061062_107_478 122
54 3300038443 Ga0395901_0139586 Ga0395901_0139586_1934_2305 122
55 3300038443 Ga0395901_0696002 Ga0395901_0696002_232_603 122
56 3300038443 Ga0395901_1697948 Ga0395901_1697948_53_427 122
57 3300041501 Ga0451845_0548414 Ga0451845_0548414_248_616 122
58 3300046491 Ga0495584_0035195 Ga0495584_0035195_952_1323 122
59 3300046500 Ga0495596_0072137 Ga0495596_0072137_883_1251 122
60 3300046501 Ga0495607_0294519 Ga0495607_0294519_19_387 122
61 3300046518 Ga0495631_0253139 Ga0495631_0253139_224_592 122
62 3300046523 Ga0495644_0209182 Ga0495644_0209182_345_716 122
63 3300046525 Ga0495663_0144598 Ga0495663_0144598_143_514 122
64 3300046525 Ga0495663_0228472 Ga0495663_0228472_237_605 122
65 3300046537 Ga0495598_0325544 Ga0495598_0325544_198_566 122
66 3300046615 Ga0495656_0486374 Ga0495656_0486374_133_501 122
67 3300046615 Ga0495656_0742068 Ga0495656_0742068_43_414 122
68 3300046616 Ga0495668_0257819 Ga0495668_0257819_56_427 122
69 3300046664 Ga0495659_0011573 Ga0495659_0011573_1127_1498 122
70 3300046665 Ga0495661_0258071 Ga0495661_0258071_341_709 122
71 3300046691 Ga0495670_0272908 Ga0495670_0272908_143_511 122
72 3300048903 Ga0496100_0111075 Ga0496100_0111075_730_1098 122
73 3300048904 Ga0496101_0214703 Ga0496101_0214703_435_803 122
74 3300048905 Ga0496102_0094765 Ga0496102_0094765_2113_2481 122
75 3300048907 Ga0496104_0001925 Ga0496104_0001925_1402_1770 122
76 3300048908 Ga0496105_0075861 Ga0496105_0075861_2153_2521 122
77 3300048909 Ga0496106_0181803 Ga0496106_0181803_975_1343 122
78 3300048911 Ga0496108_0063168 Ga0496108_0063168_2220_2588 122
79 3300048912 Ga0496109_0152391 Ga0496109_0152391_645_1013 122
80 3300048913 Ga0496110_0106356 Ga0496110_0106356_1420_1788 122
81 3300048914 Ga0496111_0060091 Ga0496111_0060091_1647_2015 122
82 3300048915 Ga0496112_0003540 Ga0496112_0003540_713_1081 122
83 3300049578 Ga0501042_0571433 Ga0501042_0571433_355_726 122
84 3300049587 Ga0501071_0733443 Ga0501071_0733443_331_702 122
85 3300049587 Ga0501071_1577023 Ga0501071_1577023_54_425 122
86 3300049588 Ga0501072_0110584 Ga0501072_0110584_1720_2091 122
87 3300049588 Ga0501072_0442361 Ga0501072_0442361_164_532 122
88 3300049590 Ga0501074_0400265 Ga0501074_0400265_120_491 122
89 3300049590 Ga0501074_0957127 Ga0501074_0957127_201_572 122
90 3300049741 Ga0501079_0184862 Ga0501079_0184862_644_1015 122
91 3300049743 Ga0501081_0406623 Ga0501081_0406623_531_902 122
92 3300049743 Ga0501081_1540952 Ga0501081_1540952_115_486 122
93 3300050507 nmdc:mga05p37_1295403_c1 nmdc:mga05p37_1295403_c1_42_410 122
94 3300050512 nmdc:mga0n895_1704423_c1 nmdc:mga0n895_1704423_c1_185_553 122
95 3300050515 nmdc:mga0a205_412161_c1 nmdc:mga0a205_412161_c1_688_1056 122
96 3300060353 Ga0501082_0367469 Ga0501082_0367469_814_1185 122
97 3300061734 Ga0530510_0609482 Ga0530510_0609482_338_709 122
98 3300041496 Ga0451839_0752305 Ga0451839_0752305_498_884 128
99 3300041512 Ga0451853_3109224 Ga0451853_3109224_843_1229 128
100 3300005467 Ga0070706_100435345 Ga0070706_1004353452 130
101 3300005471 Ga0070698_100015275 Ga0070698_1000152755 130
102 3300005518 Ga0070699_100057743 Ga0070699_1000577432 130
103 3300005536 Ga0070697_100115722 Ga0070697_1001157222 130
104 3300005545 Ga0070695_100125320 Ga0070695_1001253202 130
105 3300005546 Ga0070696_100217580 Ga0070696_1002175803 130
106 3300007076 Ga0075435_100046816 Ga0075435_1000468163 130
107 3300050513 nmdc:mga0rr50_146907_c1 nmdc:mga0rr50_146907_c1_1036_1428 130
108 3300050515 nmdc:mga0a205_279475_c1 nmdc:mga0a205_279475_c1_365_757 130
109 3300005343 Ga0070687_100439087 Ga0070687_1004390872 131
110 3300005544 Ga0070686_100496549 Ga0070686_1004965492 131
111 3300006846 Ga0075430_100230011 Ga0075430_1002300113 131
112 3300006847 Ga0075431_100531004 Ga0075431_1005310042 131
113 3300009147 Ga0114129_10059641 Ga0114129_100596417 131
114 3300009147 Ga0114129_11671851 Ga0114129_116718513 131
115 3300014497 Ga0182008_10073955 Ga0182008_100739552 131
116 3300035171 Ga0373946_0031397 Ga0373946_0031397_528_926 131
117 3300035241 Ga0373961_0006539 Ga0373961_0006539_1155_1550 131
118 3300037312 Ga0395899_0051369 Ga0395899_0051369_2109_2510 131
119 3300037312 Ga0395899_0154773 Ga0395899_0154773_1084_1479 131
120 3300037312 Ga0395899_0871407 Ga0395899_0871407_25_429 131
121 3300037418 Ga0395900_0008009 Ga0395900_0008009_381_782 131
122 3300037418 Ga0395900_0293418 Ga0395900_0293418_1132_1527 131
123 3300037418 Ga0395900_1219892 Ga0395900_1219892_246_641 131
124 3300037466 Ga0395898_0008049 Ga0395898_0008049_7877_8278 131
125 3300037466 Ga0395898_0360232 Ga0395898_0360232_28_423 131
126 3300037466 Ga0395898_0610809 Ga0395898_0610809_260_664 131
127 3300037466 Ga0395898_1111485 Ga0395898_1111485_125_520 131
128 3300037471 Ga0395905_0014081 Ga0395905_0014081_1114_1515 131
129 3300037471 Ga0395905_0315691 Ga0395905_0315691_293_688 131
130 3300037471 Ga0395905_0568628 Ga0395905_0568628_254_649 131
131 3300038443 Ga0395901_0019084 Ga0395901_0019084_1445_1846 131
132 3300038443 Ga0395901_0176251 Ga0395901_0176251_170_565 131
133 3300038443 Ga0395901_1058039 Ga0395901_1058039_174_572 131
134 3300041460 Ga0451802_1118619 Ga0451802_1118619_126_524 131
135 3300046615 Ga0495656_0343155 Ga0495656_0343155_365_763 131
136 3300046692 Ga0495671_0456958 Ga0495671_0456958_83_481 131
137 3300048903 Ga0496100_1368861 Ga0496100_1368861_146_541 131
138 3300048906 Ga0496103_0961847 Ga0496103_0961847_126_521 131
139 3300048913 Ga0496110_0143267 Ga0496110_0143267_26_421 131
140 3300048914 Ga0496111_0132646 Ga0496111_0132646_1340_1735 131
141 3300048915 Ga0496112_1012962 Ga0496112_1012962_24_419 131
142 3300049568 Ga0501031_0091348 Ga0501031_0091348_1286_1681 131
143 3300049572 Ga0501036_0066566 Ga0501036_0066566_317_712 131
144 3300049573 Ga0501037_0068373 Ga0501037_0068373_1018_1413 131
145 3300049575 Ga0501039_0200161 Ga0501039_0200161_1069_1464 131
146 3300049576 Ga0501040_0212222 Ga0501040_0212222_401_796 131
147 3300049577 Ga0501041_0204396 Ga0501041_0204396_442_837 131
148 3300049578 Ga0501042_0166500 Ga0501042_0166500_1128_1523 131
149 3300049580 Ga0501046_0155213 Ga0501046_0155213_182_577 131
150 3300049582 Ga0501048_0161990 Ga0501048_0161990_560_955 131
151 3300049583 Ga0501067_0007819 Ga0501067_0007819_4208_4603 131
152 3300049585 Ga0501069_0046413 Ga0501069_0046413_1124_1519 131
153 3300049585 Ga0501069_0666461 Ga0501069_0666461_202_597 131
154 3300049586 Ga0501070_0181144 Ga0501070_0181144_443_838 131
155 3300049587 Ga0501071_0074500 Ga0501071_0074500_1148_1543 131
156 3300049588 Ga0501072_0029638 Ga0501072_0029638_202_597 131
157 3300049589 Ga0501073_0186419 Ga0501073_0186419_515_910 131
158 3300049589 Ga0501073_0371965 Ga0501073_0371965_34_432 131
159 3300049590 Ga0501074_0171989 Ga0501074_0171989_879_1274 131
160 3300049590 Ga0501074_0821237 Ga0501074_0821237_32_427 131
161 3300049591 Ga0501075_0234184 Ga0501075_0234184_377_772 131
162 3300049592 Ga0501076_0164120 Ga0501076_0164120_1201_1596 131
163 3300049593 Ga0501077_0060239 Ga0501077_0060239_962_1357 131
164 3300049741 Ga0501079_0061352 Ga0501079_0061352_308_703 131
165 3300049742 Ga0501080_0317766 Ga0501080_0317766_215_610 131
166 3300049743 Ga0501081_0112665 Ga0501081_0112665_717_1112 131
167 3300049744 Ga0501083_0415853 Ga0501083_0415853_401_796 131
168 3300049823 Ga0501044_0216427 Ga0501044_0216427_515_910 131
169 3300049824 Ga0501045_0019948 Ga0501045_0019948_3994_4389 131
170 3300050507 nmdc:mga05p37_42629_c1 nmdc:mga05p37_42629_c1_3593_3997 131
171 3300050508 nmdc:mga09592_131004_c1 nmdc:mga09592_131004_c1_1563_1967 131
172 3300050509 nmdc:mga0qj67_42413_c1 nmdc:mga0qj67_42413_c1_1533_1937 131
173 3300050510 nmdc:mga06r32_603516_c1 nmdc:mga06r32_603516_c1_434_838 131
174 3300054114 Ga0501084_0067247 Ga0501084_0067247_1370_1765 131
175 3300060353 Ga0501082_0167183 Ga0501082_0167183_401_796 131
176 3300061734 Ga0530510_0043873 Ga0530510_0043873_933_1328 131
177 3300005354 Ga0070675_101299133 Ga0070675_1012991331 132
178 3300005355 Ga0070671_100203984 Ga0070671_1002039842 132
179 3300005365 Ga0070688_101385737 Ga0070688_1013857371 132
180 3300005440 Ga0070705_100012596 Ga0070705_1000125965 132
181 3300005445 Ga0070708_100248337 Ga0070708_1002483372 132
182 3300005543 Ga0070672_100646850 Ga0070672_1006468501 132
183 3300005548 Ga0070665_101239583 Ga0070665_1012395832 132
184 3300005615 Ga0070702_100191463 Ga0070702_1001914631 132
185 3300005841 Ga0068863_100892114 Ga0068863_1008921142 132
186 3300006038 Ga0075365_10082483 Ga0075365_100824832 132
187 3300006058 Ga0075432_10070883 Ga0075432_100708832 132
188 3300006852 Ga0075433_11810392 Ga0075433_118103921 132
189 3300006871 Ga0075434_100423163 Ga0075434_1004231632 132
190 3300006881 Ga0068865_100383970 Ga0068865_1003839702 132
191 3300009094 Ga0111539_10045158 Ga0111539_100451581 132
192 3300009098 Ga0105245_10019550 Ga0105245_100195504 132
193 3300009147 Ga0114129_10481182 Ga0114129_104811822 132
194 3300009147 Ga0114129_11418455 Ga0114129_114184552 132
195 3300009177 Ga0105248_10233358 Ga0105248_102333583 132
196 3300012494 Ga0157341_1036176 Ga0157341_10361761 132
197 3300012508 Ga0157315_1070020 Ga0157315_10700201 132
198 3300012510 Ga0157316_1003600 Ga0157316_10036002 132
199 3300013296 Ga0157374_10066011 Ga0157374_100660114 132
200 3300025926 Ga0207659_11007836 Ga0207659_110078362 132
201 3300025931 Ga0207644_10235952 Ga0207644_102359522 132
202 3300025938 Ga0207704_10389972 Ga0207704_103899721 132
203 3300025940 Ga0207691_10401241 Ga0207691_104012411 132
204 3300025941 Ga0207711_10146726 Ga0207711_101467262 132
205 3300026023 Ga0207677_10253086 Ga0207677_102530862 132
206 3300027907 Ga0207428_10192095 Ga0207428_101920952 132
207 3300037418 Ga0395900_0786845 Ga0395900_0786845_268_666 132
208 3300037466 Ga0395898_0220332 Ga0395898_0220332_146_544 132
209 3300048903 Ga0496100_0303799 Ga0496100_0303799_25_426 132
210 3300048905 Ga0496102_0703976 Ga0496102_0703976_253_654 132
211 3300048909 Ga0496106_0351358 Ga0496106_0351358_164_565 132
212 3300048911 Ga0496108_0054623 Ga0496108_0054623_2403_2804 132
213 3300048912 Ga0496109_0009410 Ga0496109_0009410_1652_2053 132
214 3300048913 Ga0496110_0044493 Ga0496110_0044493_3231_3632 132
215 3300048914 Ga0496111_0008644 Ga0496111_0008644_3230_3631 132
216 3300048915 Ga0496112_0152147 Ga0496112_0152147_814_1215 132
217 3300050511 nmdc:mga08y16_28182_c1 nmdc:mga08y16_28182_c1_331_729 132
218 3300050511 nmdc:mga08y16_597634_c1 nmdc:mga08y16_597634_c1_330_728 132
219 3300005330 Ga0070690_100012298 Ga0070690_1000122983 133
220 3300005330 Ga0070690_100282658 Ga0070690_1002826581 133
221 3300005333 Ga0070677_10327779 Ga0070677_103277791 133
222 3300005336 Ga0070680_100046651 Ga0070680_1000466515 133
223 3300005336 Ga0070680_101151428 Ga0070680_1011514282 133
224 3300005337 Ga0070682_100199779 Ga0070682_1001997791 133
225 3300005338 Ga0068868_100018282 Ga0068868_1000182823 133
226 3300005339 Ga0070660_100089541 Ga0070660_1000895413 133
227 3300005341 Ga0070691_10003705 Ga0070691_100037058 133
228 3300005345 Ga0070692_10004824 Ga0070692_100048245 133
229 3300005347 Ga0070668_100046665 Ga0070668_1000466654 133
230 3300005353 Ga0070669_100172363 Ga0070669_1001723632 133
231 3300005364 Ga0070673_100343614 Ga0070673_1003436141 133
232 3300005364 Ga0070673_100590679 Ga0070673_1005906792 133
233 3300005434 Ga0070709_10066396 Ga0070709_100663962 133
234 3300005434 Ga0070709_11618907 Ga0070709_116189071 133
235 3300005435 Ga0070714_100018010 Ga0070714_1000180102 133
236 3300005435 Ga0070714_101517872 Ga0070714_1015178721 133
237 3300005436 Ga0070713_100635922 Ga0070713_1006359222 133
238 3300005438 Ga0070701_10098522 Ga0070701_100985222 133
239 3300005439 Ga0070711_100133350 Ga0070711_1001333502 133
240 3300005439 Ga0070711_100227349 Ga0070711_1002273492 133
241 3300005439 Ga0070711_100475332 Ga0070711_1004753321 133
242 3300005440 Ga0070705_100006207 Ga0070705_1000062075 133
243 3300005441 Ga0070700_100012297 Ga0070700_1000122973 133
244 3300005444 Ga0070694_100005836 Ga0070694_1000058367 133
245 3300005455 Ga0070663_100554981 Ga0070663_1005549812 133
246 3300005456 Ga0070678_100061133 Ga0070678_1000611333 133
247 3300005471 Ga0070698_101863955 Ga0070698_1018639551 133
248 3300005530 Ga0070679_100181908 Ga0070679_1001819082 133
249 3300005543 Ga0070672_101608488 Ga0070672_1016084882 133
250 3300005544 Ga0070686_100009062 Ga0070686_1000090623 133
251 3300005546 Ga0070696_100005650 Ga0070696_1000056508 133
252 3300005546 Ga0070696_100065183 Ga0070696_1000651832 133
253 3300005547 Ga0070693_100010651 Ga0070693_1000106514 133
254 3300005547 Ga0070693_100022440 Ga0070693_1000224402 133
255 3300005549 Ga0070704_100038004 Ga0070704_1000380043 133
256 3300005563 Ga0068855_100048908 Ga0068855_1000489085 133
257 3300005614 Ga0068856_100750853 Ga0068856_1007508532 133
258 3300005615 Ga0070702_100012892 Ga0070702_1000128924 133
259 3300005616 Ga0068852_100226072 Ga0068852_1002260723 133
260 3300005617 Ga0068859_100871358 Ga0068859_1008713582 133
261 3300005719 Ga0068861_100008499 Ga0068861_1000084993 133
262 3300005842 Ga0068858_101261018 Ga0068858_1012610182 133
263 3300005843 Ga0068860_100034743 Ga0068860_1000347433 133
264 3300005844 Ga0068862_100055214 Ga0068862_1000552143 133
265 3300005937 Ga0081455_10043709 Ga0081455_100437093 133
266 3300006028 Ga0070717_10127628 Ga0070717_101276283 133
267 3300006058 Ga0075432_10013011 Ga0075432_100130113 133
268 3300006163 Ga0070715_10261900 Ga0070715_102619001 133
269 3300006173 Ga0070716_100117591 Ga0070716_1001175912 133
270 3300006175 Ga0070712_101060612 Ga0070712_1010606122 133
271 3300006178 Ga0075367_11037065 Ga0075367_110370651 133
272 3300006237 Ga0097621_100017668 Ga0097621_1000176683 133
273 3300006358 Ga0068871_100317649 Ga0068871_1003176491 133
274 3300006844 Ga0075428_100142839 Ga0075428_1001428392 133
275 3300006847 Ga0075431_100138237 Ga0075431_1001382372 133
276 3300006852 Ga0075433_10052020 Ga0075433_100520203 133
277 3300006871 Ga0075434_100072971 Ga0075434_1000729713 133
278 3300006871 Ga0075434_100431524 Ga0075434_1004315242 133
279 3300006880 Ga0075429_101391882 Ga0075429_1013918822 133
280 3300006881 Ga0068865_100045592 Ga0068865_1000455923 133
281 3300006914 Ga0075436_100025241 Ga0075436_1000252415 133
282 3300006914 Ga0075436_100686750 Ga0075436_1006867502 133
283 3300006914 Ga0075436_101301627 Ga0075436_1013016271 133
284 3300006931 Ga0097620_100871278 Ga0097620_1008712782 133
285 3300007076 Ga0075435_100037341 Ga0075435_1000373414 133
286 3300007076 Ga0075435_100194491 Ga0075435_1001944912 133
287 3300009093 Ga0105240_11315103 Ga0105240_113151031 133
288 3300009094 Ga0111539_10139464 Ga0111539_101394642 133
289 3300009094 Ga0111539_10701702 Ga0111539_107017022 133
290 3300009098 Ga0105245_10034650 Ga0105245_100346503 133
291 3300009098 Ga0105245_10238295 Ga0105245_102382952 133
292 3300009147 Ga0114129_13060268 Ga0114129_130602681 133
293 3300009147 Ga0114129_13219045 Ga0114129_132190451 133
294 3300009148 Ga0105243_10202435 Ga0105243_102024352 133
295 3300009174 Ga0105241_10331955 Ga0105241_103319552 133
296 3300009176 Ga0105242_10065272 Ga0105242_100652723 133
297 3300009545 Ga0105237_10173958 Ga0105237_101739582 133
298 3300009551 Ga0105238_10227731 Ga0105238_102277312 133
299 3300009553 Ga0105249_10038733 Ga0105249_100387334 133
300 3300009553 Ga0105249_10128773 Ga0105249_101287733 133
301 3300010375 Ga0105239_10033043 Ga0105239_100330435 133
302 3300013102 Ga0157371_10884831 Ga0157371_108848312 133
303 3300013297 Ga0157378_10112297 Ga0157378_101122973 133
304 3300013307 Ga0157372_10065653 Ga0157372_100656535 133
305 3300013308 Ga0157375_10028599 Ga0157375_100285993 133
306 3300014326 Ga0157380_10024437 Ga0157380_100244373 133
307 3300014969 Ga0157376_10044974 Ga0157376_100449742 133
308 3300014969 Ga0157376_10472990 Ga0157376_104729902 133
309 3300017792 Ga0163161_10016355 Ga0163161_100163552 133
310 3300025899 Ga0207642_10083440 Ga0207642_100834401 133
311 3300025905 Ga0207685_10033233 Ga0207685_100332332 133
312 3300025916 Ga0207663_10474309 Ga0207663_104743092 133
313 3300025917 Ga0207660_10351480 Ga0207660_103514802 133
314 3300025919 Ga0207657_10022820 Ga0207657_100228202 133
315 3300025923 Ga0207681_10267030 Ga0207681_102670301 133
316 3300025927 Ga0207687_10372403 Ga0207687_103724032 133
317 3300025927 Ga0207687_11131568 Ga0207687_111315681 133
318 3300025928 Ga0207700_10379718 Ga0207700_103797182 133
319 3300025932 Ga0207690_10012597 Ga0207690_100125973 133
320 3300025933 Ga0207706_10014118 Ga0207706_100141188 133
321 3300025934 Ga0207686_10069425 Ga0207686_100694253 133
322 3300025937 Ga0207669_10254287 Ga0207669_102542872 133
323 3300025939 Ga0207665_10002725 Ga0207665_100027252 133
324 3300025940 Ga0207691_11017674 Ga0207691_110176741 133
325 3300025960 Ga0207651_10263330 Ga0207651_102633302 133
326 3300025961 Ga0207712_10664683 Ga0207712_106646832 133
327 3300025972 Ga0207668_10471026 Ga0207668_104710262 133
328 3300025972 Ga0207668_10823052 Ga0207668_108230522 133
329 3300025981 Ga0207640_10041914 Ga0207640_100419142 133
330 3300025986 Ga0207658_10576940 Ga0207658_105769402 133
331 3300026023 Ga0207677_10015924 Ga0207677_100159243 133
332 3300026035 Ga0207703_10912819 Ga0207703_109128192 133
333 3300026067 Ga0207678_10091196 Ga0207678_100911962 133
334 3300026075 Ga0207708_10101424 Ga0207708_101014243 133
335 3300026078 Ga0207702_10165412 Ga0207702_101654122 133
336 3300026089 Ga0207648_10003852 Ga0207648_100038528 133
337 3300026118 Ga0207675_100025473 Ga0207675_1000254737 133
338 3300026121 Ga0207683_10019406 Ga0207683_100194068 133
339 3300026121 Ga0207683_10077992 Ga0207683_100779922 133
340 3300027695 Ga0209966_1003854 Ga0209966_10038543 133
341 3300027907 Ga0207428_10002288 Ga0207428_100022883 133
342 3300028380 Ga0268265_10233472 Ga0268265_102334721 133
343 3300031548 Ga0307408_102061756 Ga0307408_1020617561 133
344 3300031852 Ga0307410_10849839 Ga0307410_108498392 133
345 3300031995 Ga0307409_100032243 Ga0307409_1000322432 133
346 3300031995 Ga0307409_100276042 Ga0307409_1002760422 133
347 3300032126 Ga0307415_101111981 Ga0307415_1011119811 133
348 3300034817 Ga0373948_0013626 Ga0373948_0013626_741_1142 133
349 3300034820 Ga0373959_0054627 Ga0373959_0054627_50_451 133
350 3300035121 Ga0373960_0185122 Ga0373960_0185122_124_525 133
351 3300035170 Ga0373943_0912711 Ga0373943_0912711_96_497 133
352 3300035242 Ga0373962_0022260 Ga0373962_0022260_594_995 133
353 3300035692 Ga0373935_0640657 Ga0373935_0640657_11_412 133
354 3300037312 Ga0395899_0011110 Ga0395899_0011110_2451_2852 133
355 3300037312 Ga0395899_0029409 Ga0395899_0029409_2783_3184 133
356 3300037418 Ga0395900_0016921 Ga0395900_0016921_5381_5782 133
357 3300037418 Ga0395900_0059143 Ga0395900_0059143_2660_3061 133
358 3300037466 Ga0395898_0016545 Ga0395898_0016545_6672_7073 133
359 3300037466 Ga0395898_0075559 Ga0395898_0075559_1193_1594 133
360 3300037471 Ga0395905_0022616 Ga0395905_0022616_4838_5239 133
361 3300037471 Ga0395905_0036372 Ga0395905_0036372_3248_3649 133
362 3300038443 Ga0395901_0021294 Ga0395901_0021294_2499_2900 133
363 3300038443 Ga0395901_0105377 Ga0395901_0105377_1022_1423 133
364 3300042005 Ga0439448_0055193 Ga0439448_0055193_224_625 133
365 3300046472 Ga0495580_0325231 Ga0495580_0325231_614_1015 133
366 3300048903 Ga0496100_0133604 Ga0496100_0133604_643_1044 133
367 3300048903 Ga0496100_0725202 Ga0496100_0725202_119_520 133
368 3300048904 Ga0496101_0214531 Ga0496101_0214531_107_508 133
369 3300048904 Ga0496101_0739096 Ga0496101_0739096_76_477 133
370 3300048905 Ga0496102_0122035 Ga0496102_0122035_1854_2255 133
371 3300048905 Ga0496102_0272879 Ga0496102_0272879_1129_1530 133
372 3300048906 Ga0496103_0110830 Ga0496103_0110830_1290_1691 133
373 3300048907 Ga0496104_0143623 Ga0496104_0143623_481_882 133
374 3300048908 Ga0496105_0156040 Ga0496105_0156040_706_1107 133
375 3300048909 Ga0496106_0796835 Ga0496106_0796835_187_588 133
376 3300048910 Ga0496107_0185392 Ga0496107_0185392_41_442 133
377 3300048910 Ga0496107_0768290 Ga0496107_0768290_140_541 133
378 3300048911 Ga0496108_1169897 Ga0496108_1169897_48_449 133
379 3300048915 Ga0496112_0228387 Ga0496112_0228387_641_1042 133
380 3300048915 Ga0496112_0333721 Ga0496112_0333721_330_731 133
381 3300048917 Ga0496114_0163546 Ga0496114_0163546_615_1016 133
382 3300048917 Ga0496114_1443730 Ga0496114_1443730_48_449 133
383 3300048918 Ga0496115_0977160 Ga0496115_0977160_86_487 133
384 3300048918 Ga0496115_1270785 Ga0496115_1270785_73_474 133
385 3300049587 Ga0501071_0143690 Ga0501071_0143690_806_1210 133
386 3300049588 Ga0501072_0732798 Ga0501072_0732798_57_461 133
387 3300049741 Ga0501079_0470813 Ga0501079_0470813_60_464 133
388 3300050494 nmdc:mga06z11_949844_c1 nmdc:mga06z11_949844_c1_100_501 133
389 3300050508 nmdc:mga09592_655182_c1 nmdc:mga09592_655182_c1_91_492 133
390 3300050510 nmdc:mga06r32_396769_c1 nmdc:mga06r32_396769_c1_253_654 133
391 3300050511 nmdc:mga08y16_7052_c1 nmdc:mga08y16_7052_c1_5840_6241 133
392 3300050512 nmdc:mga0n895_10995_c1 nmdc:mga0n895_10995_c1_5406_5807 133
393 3300050512 nmdc:mga0n895_211131_c1 nmdc:mga0n895_211131_c1_889_1290 133
394 3300050513 nmdc:mga0rr50_17517_c1 nmdc:mga0rr50_17517_c1_2125_2526 133
395 3300050513 nmdc:mga0rr50_497274_c1 nmdc:mga0rr50_497274_c1_171_572 133
396 3300050513 nmdc:mga0rr50_59584_c1 nmdc:mga0rr50_59584_c1_855_1256 133
397 3300050514 nmdc:mga08x19_1086063_c1 nmdc:mga08x19_1086063_c1_130_531 133
398 3300050515 nmdc:mga0a205_18699_c1 nmdc:mga0a205_18699_c1_3713_4114 133
399 3300050515 nmdc:mga0a205_75592_c1 nmdc:mga0a205_75592_c1_2560_2961 133
400 3300054114 Ga0501084_0356458 Ga0501084_0356458_728_1132 133
401 3300005337 Ga0070682_100739146 Ga0070682_1007391462 134
402 3300005338 Ga0068868_100184602 Ga0068868_1001846022 134
403 3300005353 Ga0070669_101409272 Ga0070669_1014092721 134
404 3300005356 Ga0070674_100213908 Ga0070674_1002139082 134
405 3300005438 Ga0070701_10549728 Ga0070701_105497281 134
406 3300005438 Ga0070701_10864346 Ga0070701_108643461 134
407 3300005441 Ga0070700_100226047 Ga0070700_1002260472 134
408 3300005457 Ga0070662_100086978 Ga0070662_1000869782 134
409 3300005459 Ga0068867_100474000 Ga0068867_1004740001 134
410 3300005471 Ga0070698_100682642 Ga0070698_1006826422 134
411 3300005536 Ga0070697_100533743 Ga0070697_1005337432 134
412 3300005536 Ga0070697_101113198 Ga0070697_1011131981 134
413 3300005549 Ga0070704_100088356 Ga0070704_1000883563 134
414 3300005843 Ga0068860_102467786 Ga0068860_1024677861 134
415 3300006058 Ga0075432_10034708 Ga0075432_100347082 134
416 3300006178 Ga0075367_10419495 Ga0075367_104194952 134
417 3300006194 Ga0075427_10088061 Ga0075427_100880611 134
418 3300006844 Ga0075428_100021782 Ga0075428_1000217822 134
419 3300006846 Ga0075430_100044310 Ga0075430_1000443104 134
420 3300006847 Ga0075431_100078992 Ga0075431_1000789924 134
421 3300006880 Ga0075429_100010729 Ga0075429_10001072910 134
422 3300009094 Ga0111539_10048461 Ga0111539_100484614 134
423 3300009098 Ga0105245_10685343 Ga0105245_106853432 134
424 3300009147 Ga0114129_10137036 Ga0114129_101370362 134
425 3300009147 Ga0114129_10172265 Ga0114129_101722652 134
426 3300009147 Ga0114129_10207190 Ga0114129_102071903 134
427 3300009147 Ga0114129_11384631 Ga0114129_113846312 134
428 3300009148 Ga0105243_10196798 Ga0105243_101967982 134
429 3300009148 Ga0105243_10309703 Ga0105243_103097033 134
430 3300014745 Ga0157377_10668021 Ga0157377_106680212 134
431 3300025926 Ga0207659_10145854 Ga0207659_101458542 134
432 3300025926 Ga0207659_10678659 Ga0207659_106786592 134
433 3300025927 Ga0207687_10062716 Ga0207687_100627162 134
434 3300025933 Ga0207706_11238461 Ga0207706_112384611 134
435 3300025935 Ga0207709_10409337 Ga0207709_104093372 134
436 3300025938 Ga0207704_11145616 Ga0207704_111456161 134
437 3300025949 Ga0207667_10314291 Ga0207667_103142912 134
438 3300025960 Ga0207651_11429217 Ga0207651_114292171 134
439 3300025961 Ga0207712_10089849 Ga0207712_100898491 134
440 3300025972 Ga0207668_10796449 Ga0207668_107964492 134
441 3300026023 Ga0207677_11821314 Ga0207677_118213142 134
442 3300026075 Ga0207708_10091945 Ga0207708_100919453 134
443 3300026118 Ga0207675_100020206 Ga0207675_1000202064 134
444 3300027907 Ga0207428_10002045 Ga0207428_100020452 134
445 3300034957 Ga0373938_0249312 Ga0373938_0249312_53_460 134
446 3300037312 Ga0395899_0457652 Ga0395899_0457652_200_607 134
447 3300037418 Ga0395900_0010714 Ga0395900_0010714_5157_5561 134
448 3300037418 Ga0395900_0487831 Ga0395900_0487831_700_1107 134
449 3300037466 Ga0395898_0003528 Ga0395898_0003528_1337_1741 134
450 3300037466 Ga0395898_0096032 Ga0395898_0096032_607_1014 134
451 3300037471 Ga0395905_0002818 Ga0395905_0002818_13611_14015 134
452 3300037471 Ga0395905_0087844 Ga0395905_0087844_2350_2757 134
453 3300038443 Ga0395901_0012915 Ga0395901_0012915_1398_1802 134
454 3300038443 Ga0395901_0026742 Ga0395901_0026742_5068_5475 134
455 3300038443 Ga0395901_0179445 Ga0395901_0179445_1633_2040 134
456 3300041463 Ga0451804_0467396 Ga0451804_0467396_417_824 134
457 3300041498 Ga0451841_1118202 Ga0451841_1118202_165_572 134
458 3300042122 Ga0450920_028675 Ga0450920_028675_595_1002 134
459 3300042146 Ga0450907_029451 Ga0450907_029451_100_507 134
460 3300042531 Ga0450918_014956 Ga0450918_014956_928_1335 134
461 3300046523 Ga0495644_0146195 Ga0495644_0146195_306_710 134
462 3300046648 Ga0495611_0132974 Ga0495611_0132974_430_837 134
463 3300046674 Ga0495588_0409027 Ga0495588_0409027_96_503 134
464 3300046692 Ga0495671_0423196 Ga0495671_0423196_210_617 134
465 3300048911 Ga0496108_0058145 Ga0496108_0058145_481_888 134
466 3300049568 Ga0501031_0001976 Ga0501031_0001976_4594_5001 134
467 3300049569 Ga0501032_0006726 Ga0501032_0006726_6987_7394 134
468 3300049570 Ga0501033_0004305 Ga0501033_0004305_7987_8394 134
469 3300049571 Ga0501034_0005985 Ga0501034_0005985_5356_5763 134
470 3300049573 Ga0501037_0007726 Ga0501037_0007726_1246_1653 134
471 3300049574 Ga0501038_0003559 Ga0501038_0003559_3034_3441 134
472 3300049574 Ga0501038_0181466 Ga0501038_0181466_737_1144 134
473 3300049575 Ga0501039_0019537 Ga0501039_0019537_3162_3569 134
474 3300049575 Ga0501039_0189210 Ga0501039_0189210_571_978 134
475 3300049575 Ga0501039_1043227 Ga0501039_1043227_81_488 134
476 3300049576 Ga0501040_0081988 Ga0501040_0081988_1714_2121 134
477 3300049578 Ga0501042_0034503 Ga0501042_0034503_666_1073 134
478 3300049579 Ga0501043_0039536 Ga0501043_0039536_345_752 134
479 3300049580 Ga0501046_0016777 Ga0501046_0016777_957_1364 134
480 3300049581 Ga0501047_0182249 Ga0501047_0182249_416_823 134
481 3300049582 Ga0501048_0008231 Ga0501048_0008231_1724_2131 134
482 3300049584 Ga0501068_0006523 Ga0501068_0006523_5639_6046 134
483 3300049585 Ga0501069_0002815 Ga0501069_0002815_7245_7652 134
484 3300049586 Ga0501070_0005213 Ga0501070_0005213_9530_9937 134
485 3300049587 Ga0501071_0183229 Ga0501071_0183229_336_743 134
486 3300049588 Ga0501072_0345999 Ga0501072_0345999_623_1030 134
487 3300049588 Ga0501072_0522096 Ga0501072_0522096_73_480 134
488 3300049588 Ga0501072_0886250 Ga0501072_0886250_198_605 134
489 3300049589 Ga0501073_0007092 Ga0501073_0007092_6717_7124 134
490 3300049590 Ga0501074_0020522 Ga0501074_0020522_3438_3845 134
491 3300049590 Ga0501074_0606189 Ga0501074_0606189_161_568 134
492 3300049591 Ga0501075_0035592 Ga0501075_0035592_675_1082 134
493 3300049591 Ga0501075_0084057 Ga0501075_0084057_48_455 134
494 3300049592 Ga0501076_0110212 Ga0501076_0110212_828_1235 134
495 3300049592 Ga0501076_0148896 Ga0501076_0148896_874_1281 134
496 3300049593 Ga0501077_0163922 Ga0501077_0163922_48_455 134
497 3300049593 Ga0501077_0227341 Ga0501077_0227341_433_840 134
498 3300049741 Ga0501079_0036694 Ga0501079_0036694_853_1260 134
499 3300049742 Ga0501080_0034259 Ga0501080_0034259_392_799 134
500 3300049744 Ga0501083_0003927 Ga0501083_0003927_6753_7160 134
501 3300049822 Ga0501035_0028764 Ga0501035_0028764_724_1131 134
502 3300049822 Ga0501035_0692904 Ga0501035_0692904_382_789 134
503 3300049823 Ga0501044_0028326 Ga0501044_0028326_4363_4770 134
504 3300049824 Ga0501045_0371053 Ga0501045_0371053_588_995 134
505 3300050507 nmdc:mga05p37_123991_c1 nmdc:mga05p37_123991_c1_980_1387 134
506 3300050507 nmdc:mga05p37_631085_c1 nmdc:mga05p37_631085_c1_110_517 134
507 3300050508 nmdc:mga09592_26880_c1 nmdc:mga09592_26880_c1_2067_2474 134
508 3300050509 nmdc:mga0qj67_6844_c1 nmdc:mga0qj67_6844_c1_6768_7175 134
509 3300050510 nmdc:mga06r32_30826_c1 nmdc:mga06r32_30826_c1_4438_4845 134
510 3300050511 nmdc:mga08y16_43502_c1 nmdc:mga08y16_43502_c1_1247_1654 134
511 3300050512 nmdc:mga0n895_437505_c1 nmdc:mga0n895_437505_c1_378_785 134
512 3300061734 Ga0530510_0038731 Ga0530510_0038731_392_799 134
513 3300006028 Ga0070717_10352010 Ga0070717_103520102 135
514 3300006844 Ga0075428_100178294 Ga0075428_1001782942 135
515 3300006846 Ga0075430_100277825 Ga0075430_1002778253 135
516 3300006847 Ga0075431_100277915 Ga0075431_1002779152 135
517 3300006880 Ga0075429_100452650 Ga0075429_1004526502 135
518 3300009147 Ga0114129_10180652 Ga0114129_101806525 135
519 3300038443 Ga0395901_0169235 Ga0395901_0169235_929_1336 135
520 3300048904 Ga0496101_0609361 Ga0496101_0609361_240_650 135
521 3300048909 Ga0496106_0201742 Ga0496106_0201742_887_1297 135
522 3300048911 Ga0496108_1461819 Ga0496108_1461819_89_499 135
523 3300048914 Ga0496111_0588537 Ga0496111_0588537_181_591 135
524 3300048917 Ga0496114_0576274 Ga0496114_0576274_363_773 135
525 3300050508 nmdc:mga09592_112631_c1 nmdc:mga09592_112631_c1_1622_2032 135
526 3300050509 nmdc:mga0qj67_458654_c1 nmdc:mga0qj67_458654_c1_220_630 135
527 3300050515 nmdc:mga0a205_143257_c1 nmdc:mga0a205_143257_c1_1113_1523 135
528 3300054114 Ga0501084_1121499 Ga0501084_1121499_175_585 135
529 3300038443 Ga0395901_0435477 Ga0395901_0435477_558_971 136
530 3300049575 Ga0501039_0403282 Ga0501039_0403282_50_463 136
531 3300005329 Ga0070683_100413920 Ga0070683_1004139202 140
532 3300005331 Ga0070670_100315881 Ga0070670_1003158812 140
533 3300005356 Ga0070674_100048128 Ga0070674_1000481282 140
534 3300005436 Ga0070713_100740386 Ga0070713_1007403861 140
535 3300005618 Ga0068864_100037567 Ga0068864_1000375674 140
536 3300006028 Ga0070717_10245637 Ga0070717_102456372 140
537 3300009148 Ga0105243_10491090 Ga0105243_104910902 140
538 3300009148 Ga0105243_11455954 Ga0105243_114559542 140
539 3300025899 Ga0207642_10454475 Ga0207642_104544752 140
540 3300025935 Ga0207709_11674454 Ga0207709_116744541 140
541 3300025944 Ga0207661_10259993 Ga0207661_102599932 140
542 3300026095 Ga0207676_10341636 Ga0207676_103416362 140
543 3300037418 Ga0395900_0445083 Ga0395900_0445083_405_863 140
544 3300037466 Ga0395898_0202519 Ga0395898_0202519_629_1087 140
545 3300038443 Ga0395901_0989570 Ga0395901_0989570_364_804 140
546 3300042146 Ga0450907_005644 Ga0450907_005644_824_1258 140
547 3300049590 Ga0501074_0259012 Ga0501074_0259012_620_1057 140
548 3300054114 Ga0501084_0109424 Ga0501084_0109424_568_1005 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

23

112

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8751 7 136
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8152 10 108
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.777 7 136
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7391 10 108
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7353 2 140
ID Description Score Start End Superfamily
af_P9WJB9_9_114_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8943 9 24 3.30.1310.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8515 8 136 3.90.1590.10
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8231 10 108 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8091 12 108 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8051 8 136 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A538F450-F1-model_v4 GFA family protein 0.9595 1 137 GO:0016846
GO:0046872
AF-A0A7W0SRB2-F1-model_v4 GFA family protein 0.9523 27 140 GO:0016846
GO:0046872
AF-A0A7W0S348-F1-model_v4 GFA family protein 0.9446 8 140 GO:0016846
GO:0046872
AF-A0A3C1ADG1-F1-model_v4 deleted 0.9384 7 87
AF-A0A524JSN6-F1-model_v4 GFA family protein 0.9377 5 87 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.78 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map