F462195

General Info

Members Datasets Scaffolds Average Seq Length
548 246 546 271

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10000005|Ga0070703_10000005126
Length 294
Sequence VSTLTQDTSIPSAKDLAPVPRDRRRRWTYYTLPVYSSAFFLYLLIPITFMVVYSFNQSHSALPQVTSKWQGFTTQWYRQWNGVPGLGPAFFLSIKLALIATVLSAILGTLLALALVRYRFRGKGTTEQVLFANIAAPEIVLGASLLGFFITLNLDRGFNTLLIAHVMFCVAYVTITVRARLSGFDPMLEQAAQDLGANPWVTFWKVTLPLIFPGILAGALLAFALSIDDFVTSNFVAGPSVTFPLWVYGAVKVGIPPQVFVLGTVIFSAGVVLAVTALVFQGRAKKARPEPEEG

Samples

Sample ID Description Type Environment
1 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
117 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 1.09
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.93
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10045555 3300005327 Bacteria 3547
2 Ga0070683_100254723 3300005329 Bacteria 1669
3 Ga0070683_100318991 3300005329 Bacteria 1479
4 Ga0068868_100067704 3300005338 Bacteria 2842
5 Ga0070691_10052938 3300005341 Bacteria 1941
6 Ga0070674_100014459 3300005356 Bacteria 4906
7 Ga0070674_100033173 3300005356 Bacteria 3435
8 Ga0070673_100133941 3300005364 Bacteria 2083
9 Ga0070703_10000005 3300005406 Bacteria 127348
10 Ga0070703_10002773 3300005406 Bacteria 5024
11 Ga0070709_10001294 3300005434 Bacteria 13650
12 Ga0070709_10005059 3300005434 Bacteria 7128
13 Ga0070709_10098020 3300005434 Bacteria 1947
14 Ga0070709_10104743 3300005434 Bacteria 1891
15 Ga0070709_10145724 3300005434 Bacteria 1631
16 Ga0070714_100003066 3300005435 Bacteria 12395
17 Ga0070714_100012135 3300005435 Bacteria 6864
18 Ga0070714_100026498 3300005435 Bacteria 4792
19 Ga0070714_100055710 3300005435 Bacteria 3380
20 Ga0070714_100087135 3300005435 Bacteria 2730
21 Ga0070714_100088188 3300005435 Bacteria 2714
22 Ga0070713_100002626 3300005436 Bacteria 11725
23 Ga0070713_100023894 3300005436 Bacteria 4752
24 Ga0070713_100079162 3300005436 Bacteria 2799
25 Ga0070713_100097768 3300005436 Bacteria 2537
26 Ga0070713_100425878 3300005436 Bacteria 1243
27 Ga0070713_100657225 3300005436 Bacteria 999
28 Ga0070710_10000175 3300005437 Bacteria 29456
29 Ga0070710_10015349 3300005437 Bacteria 3875
30 Ga0070710_10035167 3300005437 Bacteria 2730
31 Ga0070710_10225266 3300005437 Bacteria 1195
32 Ga0070701_10030104 3300005438 Bacteria 2683
33 Ga0070711_100003307 3300005439 Bacteria 9381
34 Ga0070711_100340796 3300005439 Bacteria 1203
35 Ga0070705_100000536 3300005440 Bacteria 21950
36 Ga0070705_100025623 3300005440 Bacteria 3199
37 Ga0070705_100199712 3300005440 Unclassified 1370
38 Ga0070700_100083013 3300005441 Unclassified 2073
39 Ga0070708_100001931 3300005445 Bacteria 15986
40 Ga0070708_100003025 3300005445 Bacteria 13051
41 Ga0070708_100008734 3300005445 Bacteria 8143
42 Ga0070708_100017274 3300005445 Bacteria 6012
43 Ga0070708_100096965 3300005445 Bacteria 2694
44 Ga0070708_100139627 3300005445 Bacteria 2246
45 Ga0070708_100210706 3300005445 Bacteria 1821
46 Ga0070681_10083757 3300005458 Bacteria 3142
47 Ga0070706_100000177 3300005467 Bacteria 80762
48 Ga0070706_100000438 3300005467 Bacteria 50097
49 Ga0070706_100004578 3300005467 Bacteria 13279
50 Ga0070706_100008447 3300005467 Bacteria 9591
51 Ga0070706_100148468 3300005467 Bacteria 2189
52 Ga0070706_100192791 3300005467 Bacteria 1904
53 Ga0070706_100200403 3300005467 Bacteria 1864
54 Ga0070707_100000225 3300005468 Bacteria 56340
55 Ga0070707_100002427 3300005468 Bacteria 17764
56 Ga0070707_100005549 3300005468 Bacteria 11787
57 Ga0070707_100027434 3300005468 Bacteria 5419
58 Ga0070707_100033495 3300005468 Bacteria 4899
59 Ga0070707_100034278 3300005468 Bacteria 4841
60 Ga0070707_100129267 3300005468 Bacteria 2455
61 Ga0070707_100229825 3300005468 Bacteria 1806
62 Ga0070707_100257355 3300005468 Unclassified 1698
63 Ga0070698_100000718 3300005471 Bacteria 35574
64 Ga0070698_100007677 3300005471 Bacteria 11665
65 Ga0070698_100008689 3300005471 Bacteria 10941
66 Ga0070698_100013962 3300005471 Bacteria 8495
67 Ga0070698_100050069 3300005471 Bacteria 4261
68 Ga0070698_100055999 3300005471 Bacteria 3996
69 Ga0070698_100087494 3300005471 Bacteria 3101
70 Ga0070698_100117090 3300005471 Bacteria 2627
71 Ga0070698_100188566 3300005471 Bacteria 2000
72 Ga0070699_100000184 3300005518 Bacteria 60897
73 Ga0070699_100273217 3300005518 Bacteria 1513
74 Ga0070679_100179337 3300005530 Bacteria 2091
75 Ga0070697_100138606 3300005536 Bacteria 2044
76 Ga0070697_100178464 3300005536 Bacteria 1799
77 Ga0070696_100004267 3300005546 Bacteria 9528
78 Ga0070696_100040691 3300005546 Bacteria 3209
79 Ga0070693_100114999 3300005547 Bacteria 1661
80 Ga0070665_100595869 3300005548 Bacteria 1118
81 Ga0070704_100041000 3300005549 Bacteria 3192
82 Ga0070704_100049595 3300005549 Bacteria 2946
83 Ga0070704_100260765 3300005549 Bacteria 1428
84 Ga0068855_100077845 3300005563 Bacteria 3848
85 Ga0068855_100578170 3300005563 Bacteria 1213
86 Ga0068854_100042511 3300005578 Unclassified 3217
87 Ga0068856_100075857 3300005614 Bacteria 3331
88 Ga0070702_100008505 3300005615 Bacteria 4975
89 Ga0070702_100050060 3300005615 Bacteria 2385
90 Ga0068866_10093359 3300005718 Bacteria 1644
91 Ga0068861_100282353 3300005719 Bacteria 1430
92 Ga0068861_100324244 3300005719 Bacteria 1342
93 Ga0068863_100201056 3300005841 Bacteria 1917
94 Ga0081455_10033987 3300005937 Bacteria 4574
95 Ga0081540_1000799 3300005983 Bacteria 28903
96 Ga0070717_10001448 3300006028 Bacteria 16367
97 Ga0070717_10103067 3300006028 Bacteria 2425
98 Ga0070717_10119487 3300006028 Bacteria 2256
99 Ga0070717_10160103 3300006028 Bacteria 1952
100 Ga0070717_10674372 3300006028 Bacteria 939
101 Ga0075432_10028786 3300006058 Bacteria 1917
102 Ga0070715_10002015 3300006163 Bacteria 6128
103 Ga0070715_10008129 3300006163 Bacteria 3646
104 Ga0070716_100000032 3300006173 Bacteria 58094
105 Ga0070716_100013771 3300006173 Bacteria 4129
106 Ga0070716_100053888 3300006173 Bacteria 2295
107 Ga0070712_100000709 3300006175 Bacteria 19641
108 Ga0070712_100015232 3300006175 Bacteria 4946
109 Ga0070712_100147814 3300006175 Bacteria 1800
110 Ga0070712_100389416 3300006175 Bacteria 1149
111 Ga0070712_100441165 3300006175 Bacteria 1082
112 Ga0097621_100079527 3300006237 Bacteria 2726
113 Ga0075433_10002433 3300006852 Bacteria 14168
114 Ga0075433_10027459 3300006852 Bacteria 4828
115 Ga0075434_100000676 3300006871 Bacteria 26498
116 Ga0075434_100013030 3300006871 Bacteria 7896
117 Ga0068865_100122847 3300006881 Bacteria 1934
118 Ga0068865_100144748 3300006881 Unclassified 1796
119 Ga0075436_100013450 3300006914 Bacteria 5602
120 Ga0075436_100040670 3300006914 Bacteria 3207
121 Ga0075435_100011163 3300007076 Bacteria 6590
122 Ga0075435_100016701 3300007076 Bacteria 5537
123 Ga0075435_100149534 3300007076 Bacteria 1962
124 Ga0075435_100233570 3300007076 Bacteria 1563
125 Ga0111539_10100754 3300009094 Bacteria 3391
126 Ga0105245_10130117 3300009098 Bacteria 2360
127 Ga0105245_10295057 3300009098 Bacteria 1589
128 Ga0105247_10081065 3300009101 Bacteria 2045
129 Ga0114129_10032268 3300009147 Bacteria 7401
130 Ga0114129_10112615 3300009147 Bacteria 3752
131 Ga0114129_10240614 3300009147 Bacteria 2433
132 Ga0105243_10004378 3300009148 Bacteria 11171
133 Ga0105241_10380129 3300009174 Bacteria 1234
134 Ga0105242_10002244 3300009176 Bacteria 15243
135 Ga0105242_10018547 3300009176 Bacteria 5443
136 Ga0105238_10182927 3300009551 Bacteria 2072
137 Ga0099796_10102796 3300010159 Bacteria 1077
138 Ga0105239_10581120 3300010375 Bacteria 1277
139 Ga0105246_10019100 3300011119 Bacteria 4374
140 Ga0157369_10241911 3300013105 Bacteria 1885
141 Ga0157369_10688921 3300013105 Bacteria 1053
142 Ga0157369_10819674 3300013105 Bacteria 956
143 Ga0157378_10003343 3300013297 Bacteria 14269
144 Ga0157378_10379346 3300013297 Bacteria 1388
145 Ga0163162_10133038 3300013306 Bacteria 2597
146 Ga0157372_10153631 3300013307 Bacteria 2658
147 Ga0157379_10245756 3300014968 Unclassified 1623
148 Ga0206351_10500795 3300020077 Bacteria 1005
149 Ga0206352_10332958 3300020078 Bacteria 968
150 Ga0206354_11315905 3300020081 Bacteria 1519
151 Ga0206353_10430970 3300020082 Bacteria 1970
152 Ga0206353_11671110 3300020082 Bacteria 1038
153 Ga0224712_10068735 3300022467 Bacteria 1432
154 Ga0207653_10000002 3300025885 Bacteria 270513
155 Ga0207692_10001537 3300025898 Bacteria 8667
156 Ga0207692_10003405 3300025898 Bacteria 6212
157 Ga0207692_10005080 3300025898 Bacteria 5244
158 Ga0207692_10182849 3300025898 Bacteria 1222
159 Ga0207685_10003103 3300025905 Bacteria 3970
160 Ga0207685_10069417 3300025905 Bacteria 1423
161 Ga0207699_10001560 3300025906 Bacteria 10861
162 Ga0207699_10002669 3300025906 Bacteria 8429
163 Ga0207699_10033846 3300025906 Bacteria 2893
164 Ga0207705_10149457 3300025909 Bacteria 1750
165 Ga0207684_10000010 3300025910 Bacteria 552805
166 Ga0207684_10000123 3300025910 Bacteria 142518
167 Ga0207684_10001589 3300025910 Bacteria 24160
168 Ga0207684_10012696 3300025910 Bacteria 7314
169 Ga0207684_10162045 3300025910 Bacteria 1926
170 Ga0207684_10224286 3300025910 Bacteria 1622
171 Ga0207684_10261217 3300025910 Bacteria 1494
172 Ga0207693_10003266 3300025915 Bacteria 13884
173 Ga0207693_10397906 3300025915 Bacteria 1077
174 Ga0207663_10010386 3300025916 Bacteria 4956
175 Ga0207663_10010800 3300025916 Bacteria 4875
176 Ga0207663_10012447 3300025916 Bacteria 4601
177 Ga0207663_10062312 3300025916 Bacteria 2370
178 Ga0207663_10258175 3300025916 Bacteria 1286
179 Ga0207663_10397753 3300025916 Unclassified 1053
180 Ga0207660_10327811 3300025917 Bacteria 1224
181 Ga0207662_10141586 3300025918 Unclassified 1524
182 Ga0207646_10001144 3300025922 Bacteria 33793
183 Ga0207646_10001735 3300025922 Bacteria 26515
184 Ga0207646_10006607 3300025922 Bacteria 11971
185 Ga0207646_10016475 3300025922 Bacteria 6934
186 Ga0207646_10020082 3300025922 Bacteria 6196
187 Ga0207646_10340510 3300025922 Unclassified 1355
188 Ga0207687_10070193 3300025927 Bacteria 2500
189 Ga0207700_10000154 3300025928 Bacteria 40709
190 Ga0207700_10008708 3300025928 Bacteria 6301
191 Ga0207700_10053294 3300025928 Bacteria 3030
192 Ga0207700_10071088 3300025928 Bacteria 2678
193 Ga0207700_10091334 3300025928 Bacteria 2405
194 Ga0207700_10261897 3300025928 Bacteria 1481
195 Ga0207664_10000211 3300025929 Bacteria 44314
196 Ga0207664_10039633 3300025929 Bacteria 3658
197 Ga0207664_10061483 3300025929 Bacteria 2996
198 Ga0207664_10072406 3300025929 Bacteria 2778
199 Ga0207664_10085441 3300025929 Bacteria 2575
200 Ga0207664_10097443 3300025929 Bacteria 2423
201 Ga0207664_10287545 3300025929 Bacteria 1444
202 Ga0207690_10035683 3300025932 Bacteria 3215
203 Ga0207690_10046287 3300025932 Bacteria 2880
204 Ga0207706_10247636 3300025933 Bacteria 1557
205 Ga0207686_10006122 3300025934 Bacteria 6462
206 Ga0207709_10005662 3300025935 Bacteria 7062
207 Ga0207669_10019949 3300025937 Bacteria 3503
208 Ga0207704_10014925 3300025938 Bacteria 3942
209 Ga0207665_10000331 3300025939 Bacteria 32656
210 Ga0207665_10002741 3300025939 Bacteria 11815
211 Ga0207661_10227850 3300025944 Bacteria 1649
212 Ga0207661_10356171 3300025944 Bacteria 1321
213 Ga0207667_10101307 3300025949 Bacteria 2971
214 Ga0207667_10210903 3300025949 Bacteria 1991
215 Ga0207651_10221594 3300025960 Unclassified 1529
216 Ga0207712_10172255 3300025961 Bacteria 1693
217 Ga0207640_10038572 3300025981 Bacteria 3016
218 Ga0207678_10266992 3300026067 Bacteria 1467
219 Ga0207708_10038988 3300026075 Bacteria 3619
220 Ga0207702_10115423 3300026078 Unclassified 2395
221 Ga0207648_10255980 3300026089 Bacteria 1561
222 Ga0207676_10342554 3300026095 Unclassified 1380
223 Ga0207675_100045091 3300026118 Bacteria 4120
224 Ga0207675_100180571 3300026118 Bacteria 2021
225 Ga0207428_10193667 3300027907 Bacteria 1532
226 Ga0268266_10533527 3300028379 Bacteria 1123
227 Ga0268264_10139987 3300028381 Bacteria 2157
228 Ga0265338_10014545 3300028800 Bacteria 8744
229 Ga0265340_10085842 3300031247 Bacteria 1476
230 Ga0265314_10065656 3300031711 Bacteria 2450
231 Ga0307413_10004860 3300031824 Bacteria 5907
232 Ga0307410_10027937 3300031852 Bacteria 3572
233 Ga0326468_10002009 3300031889 Bacteria 1700
234 Ga0307409_100171542 3300031995 Bacteria 1910
235 Ga0373938_0007491 3300034957 Bacteria 1922
236 Ga0373929_0002577 3300035085 Bacteria 3328
237 Ga0373934_0000109 3300035086 Bacteria 29409
238 Ga0373934_0006301 3300035086 Bacteria 4397
239 Ga0373934_0023722 3300035086 Bacteria 2371
240 Ga0373940_0053588 3300035088 Bacteria 1139
241 Ga0373951_0013113 3300035091 Bacteria 1863
242 Ga0373952_0001586 3300035092 Bacteria 4150
243 Ga0373932_0011515 3300035112 Bacteria 2162
244 Ga0373945_0087301 3300035116 Bacteria 1203
245 Ga0373953_0000026 3300035117 Bacteria 40030
246 Ga0373953_0063136 3300035117 Unclassified 1517
247 Ga0373953_0109163 3300035117 Bacteria 1169
248 Ga0373954_0054420 3300035118 Unclassified 1882
249 Ga0373956_0003083 3300035119 Bacteria 6745
250 Ga0373956_0053311 3300035119 Unclassified 1821
251 Ga0373956_0065191 3300035119 Bacteria 1654
252 Ga0373957_0000038 3300035120 Bacteria 34200
253 Ga0373957_0004648 3300035120 Bacteria 4194
254 Ga0373957_0008303 3300035120 Bacteria 3357
255 Ga0373957_0024889 3300035120 Bacteria 2153
256 Ga0373946_0028266 3300035171 Bacteria 2224
257 Ga0373946_0054654 3300035171 Bacteria 1681
258 Ga0373946_0118456 3300035171 Bacteria 1206
259 Ga0373955_0033263 3300035172 Bacteria 2714
260 Ga0373961_0070711 3300035241 Bacteria 1078
261 Ga0373962_0025175 3300035242 Bacteria 1597
262 Ga0373924_0011930 3300035410 Bacteria 3237
263 Ga0373924_0136603 3300035410 Bacteria 1068
264 Ga0373935_0024505 3300035692 Bacteria 3714
265 Ga0373935_0125463 3300035692 Bacteria 1719
266 Ga0373935_0301023 3300035692 Bacteria 1133
267 Ga0373927_0260368 3300035695 Bacteria 1141
268 Ga0373933_0000188 3300035724 Bacteria 40947
269 Ga0373933_0006208 3300035724 Bacteria 6501
270 Ga0373933_0048697 3300035724 Bacteria 2524
271 Ga0373947_0005352 3300035725 Bacteria 7493
272 Ga0373937_0000138 3300036401 Bacteria 70068
273 Ga0373937_0001415 3300036401 Bacteria 20043
274 Ga0373937_0014112 3300036401 Bacteria 7046
275 Ga0373937_0309755 3300036401 Bacteria 1493
276 Ga0373937_0518674 3300036401 Bacteria 1132
277 Ga0373925_0007127 3300037068 Bacteria 8169
278 Ga0373925_0007744 3300037068 Bacteria 7819
279 Ga0373925_0012824 3300037068 Bacteria 6072
280 Ga0373925_0060056 3300037068 Bacteria 2854
281 Ga0373925_0289113 3300037068 Bacteria 1321
282 Ga0373925_0335621 3300037068 Bacteria 1225
283 Ga0395899_0023969 3300037312 Bacteria 4617
284 Ga0395899_0391333 3300037312 Bacteria 922
285 Ga0395900_0131891 3300037418 Bacteria 2560
286 Ga0395898_0053921 3300037466 Bacteria 3925
287 Ga0395905_0538781 3300037471 Bacteria 1068
288 Ga0395901_0007269 3300038443 Bacteria 11177
289 Ga0436363_0310934 3300039450 Bacteria 3367
290 Ga0466969_0089690 3300044656 Bacteria 1458
291 Ga0466972_0026675 3300044658 Bacteria 2862
292 Ga0466972_0046181 3300044658 Bacteria 2109
293 Ga0466972_0049388 3300044658 Bacteria 2032
294 Ga0466965_0003711 3300044683 Bacteria 6741
295 Ga0466965_0039794 3300044683 Bacteria 2312
296 Ga0466965_0129912 3300044683 Bacteria 1306
297 Ga0466966_0002685 3300044684 Bacteria 11651
298 Ga0466966_0015128 3300044684 Bacteria 5104
299 Ga0466966_0104489 3300044684 Bacteria 1750
300 Ga0466961_0001059 3300044693 Bacteria 16934
301 Ga0466961_0029220 3300044693 Bacteria 3544
302 Ga0466961_0186811 3300044693 Bacteria 1285
303 Ga0466963_0019467 3300044694 Bacteria 4258
304 Ga0466963_0020369 3300044694 Bacteria 4170
305 Ga0466963_0040335 3300044694 Bacteria 3060
306 Ga0466963_0104483 3300044694 Bacteria 1941
307 Ga0466963_0106485 3300044694 Bacteria 1923
308 Ga0466963_0116697 3300044694 Bacteria 1835
309 Ga0466964_0003249 3300044706 Bacteria 5911
310 Ga0466971_0003586 3300044719 Bacteria 6632
311 Ga0466971_0009957 3300044719 Bacteria 4153
312 Ga0466971_0071866 3300044719 Bacteria 1571
313 Ga0466970_0028958 3300044765 Bacteria 2913
314 Ga0466970_0042113 3300044765 Bacteria 2428
315 Ga0466957_0003253 3300044842 Bacteria 8890
316 Ga0466957_0036383 3300044842 Bacteria 2959
317 Ga0466957_0045134 3300044842 Bacteria 2672
318 Ga0466957_0083485 3300044842 Bacteria 1993
319 Ga0466957_0101844 3300044842 Bacteria 1811
320 Ga0466957_0133103 3300044842 Bacteria 1595
321 Ga0466960_0048180 3300044901 Bacteria 2047
322 Ga0466959_0005959 3300045049 Bacteria 8407
323 Ga0466959_0021486 3300045049 Bacteria 4760
324 Ga0466959_0108176 3300045049 Bacteria 1986
325 Ga0466959_0109311 3300045049 Bacteria 1974
326 Ga0466959_0115079 3300045049 Bacteria 1916
327 Ga0466958_0001388 3300045836 Bacteria 11460
328 Ga0466958_0025763 3300045836 Bacteria 3470
329 Ga0466958_0040868 3300045836 Bacteria 2788
330 Ga0466958_0056368 3300045836 Bacteria 2387
331 Ga0466958_0142317 3300045836 Bacteria 1510
332 Ga0466958_0159741 3300045836 Bacteria 1423
333 Ga0466958_0162959 3300045836 Bacteria 1409
334 Ga0466967_0097118 3300045976 Bacteria 2689
335 Ga0466967_0103855 3300045976 Bacteria 2601
336 Ga0466967_0189122 3300045976 Bacteria 1945
337 Ga0466967_0218621 3300045976 Bacteria 1809
338 Ga0466967_0552237 3300045976 Bacteria 1134
339 Ga0495592_0000041 3300046454 Bacteria 123431
340 Ga0495592_0019019 3300046454 Bacteria 5227
341 Ga0495592_0065236 3300046454 Bacteria 2666
342 Ga0495603_0119533 3300046455 Bacteria 1536
343 Ga0495629_0005227 3300046459 Bacteria 9711
344 Ga0495629_0014993 3300046459 Bacteria 5569
345 Ga0495641_0030431 3300046461 Bacteria 2589
346 Ga0495651_0000018 3300046462 Bacteria 123195
347 Ga0495651_0015947 3300046462 Bacteria 5819
348 Ga0495651_0066990 3300046462 Bacteria 2739
349 Ga0495653_0034072 3300046463 Bacteria 4031
350 Ga0495653_0036350 3300046463 Bacteria 3879
351 Ga0495653_0041274 3300046463 Bacteria 3602
352 Ga0495653_0108250 3300046463 Bacteria 2002
353 Ga0495653_0291348 3300046463 Unclassified 1067
354 Ga0495580_0038110 3300046472 Bacteria 3445
355 Ga0495582_0000075 3300046473 Bacteria 49940
356 Ga0495582_0028453 3300046473 Bacteria 3067
357 Ga0495582_0075457 3300046473 Unclassified 1867
358 Ga0495639_0023533 3300046475 Bacteria 2709
359 Ga0495662_0006801 3300046476 Bacteria 5691
360 Ga0495662_0056423 3300046476 Bacteria 1897
361 Ga0495664_0026987 3300046477 Bacteria 3346
362 Ga0495664_0072538 3300046477 Bacteria 2057
363 Ga0495664_0286704 3300046477 Bacteria 994
364 Ga0495594_0245340 3300046499 Bacteria 1021
365 Ga0495607_0016202 3300046501 Bacteria 4814
366 Ga0495608_0000039 3300046511 Bacteria 123195
367 Ga0495608_0014731 3300046511 Bacteria 5427
368 Ga0495608_0119128 3300046511 Bacteria 1693
369 Ga0495608_0244877 3300046511 Bacteria 1119
370 Ga0495618_0030980 3300046514 Bacteria 3343
371 Ga0495628_0000219 3300046516 Bacteria 50121
372 Ga0495628_0030209 3300046516 Bacteria 4388
373 Ga0495628_0140145 3300046516 Bacteria 1846
374 Ga0495630_0014840 3300046517 Bacteria 5681
375 Ga0495666_0064306 3300046526 Bacteria 1751
376 Ga0495666_0146518 3300046526 Bacteria 1099
377 Ga0495642_0021627 3300046528 Bacteria 2531
378 Ga0495652_0004358 3300046529 Bacteria 13543
379 Ga0495652_0035299 3300046529 Bacteria 4353
380 Ga0495652_0093406 3300046529 Bacteria 2456
381 Ga0495652_0132447 3300046529 Bacteria 1971
382 Ga0495665_0023455 3300046531 Bacteria 3314
383 Ga0495665_0073180 3300046531 Bacteria 1805
384 Ga0495586_0009423 3300046535 Bacteria 5196
385 Ga0495586_0051510 3300046535 Bacteria 2228
386 Ga0495587_0000034 3300046536 Bacteria 123432
387 Ga0495587_0007313 3300046536 Bacteria 7156
388 Ga0495587_0024962 3300046536 Bacteria 3658
389 Ga0495645_0028451 3300046543 Bacteria 4061
390 Ga0495645_0032425 3300046543 Bacteria 3810
391 Ga0495645_0117792 3300046543 Bacteria 1873
392 Ga0495667_0000150 3300046559 Bacteria 47612
393 Ga0495667_0089394 3300046559 Bacteria 1996
394 Ga0495667_0124935 3300046559 Unclassified 1660
395 Ga0495656_0036552 3300046615 Bacteria 2023
396 Ga0495634_0014300 3300046642 Bacteria 5726
397 Ga0495634_0054841 3300046642 Bacteria 2666
398 Ga0495634_0104656 3300046642 Unclassified 1825
399 Ga0495635_0038373 3300046663 Bacteria 3316
400 Ga0495635_0092212 3300046663 Bacteria 2071
401 Ga0495657_0000247 3300046675 Bacteria 49117
402 Ga0495657_0025872 3300046675 Bacteria 4163
403 Ga0495657_0193720 3300046675 Bacteria 1241
404 Ga0495657_0213138 3300046675 Bacteria 1173
405 Ga0495599_0000108 3300046678 Bacteria 56078
406 Ga0495599_0021292 3300046678 Bacteria 4043
407 Ga0495599_0211130 3300046678 Bacteria 1190
408 Ga0495623_0000607 3300046679 Bacteria 23888
409 Ga0495623_0037320 3300046679 Bacteria 3110
410 Ga0495623_0062597 3300046679 Bacteria 2331
411 Ga0495623_0083272 3300046679 Bacteria 1976
412 Ga0495646_0005081 3300046680 Bacteria 8291
413 Ga0495646_0026563 3300046680 Bacteria 3634
414 Ga0495646_0042810 3300046680 Unclassified 2777
415 Ga0495658_0013354 3300046683 Bacteria 4179
416 Ga0495658_0015437 3300046683 Bacteria 3918
417 Ga0495658_0041625 3300046683 Bacteria 2560
418 Ga0495658_0157870 3300046683 Bacteria 1397
419 Ga0495613_0001013 3300046689 Bacteria 21355
420 Ga0495613_0045797 3300046689 Bacteria 3234
421 Ga0495613_0054380 3300046689 Bacteria 2943
422 Ga0495624_0004932 3300046690 Bacteria 9677
423 Ga0495624_0104345 3300046690 Bacteria 1744
424 Ga0495624_0118318 3300046690 Bacteria 1628
425 Ga0495624_0144134 3300046690 Unclassified 1458
426 Ga0495600_0013980 3300046809 Bacteria 5058
427 Ga0495600_0018344 3300046809 Bacteria 4459
428 Ga0495581_0019512 3300047315 Bacteria 3935
429 Ga0495581_0107787 3300047315 Unclassified 1619
430 Ga0495604_0000039 3300047317 Bacteria 123431
431 Ga0495604_0028076 3300047317 Bacteria 4476
432 Ga0495604_0468756 3300047317 Bacteria 821
433 Ga0495674_0005568 3300047319 Bacteria 12078
434 Ga0495674_0022401 3300047319 Bacteria 5826
435 Ga0495674_0098228 3300047319 Bacteria 2493
436 Ga0495674_0205489 3300047319 Bacteria 1633
437 Ga0495676_0044718 3300047321 Bacteria 3612
438 Ga0495676_0057002 3300047321 Bacteria 3085
439 Ga0495680_0000028 3300047322 Bacteria 112865
440 Ga0495680_0021492 3300047322 Bacteria 5400
441 Ga0495680_0075077 3300047322 Bacteria 2565
442 Ga0495680_0087301 3300047322 Bacteria 2346
443 Ga0495680_0187061 3300047322 Bacteria 1491
444 Ga0495675_0001550 3300047444 Bacteria 13881
445 Ga0495675_0163580 3300047444 Unclassified 1369
446 Ga0495684_0041265 3300047471 Bacteria 3536
447 Ga0495684_0056243 3300047471 Bacteria 2999
448 Ga0495684_0081877 3300047471 Bacteria 2449
449 Ga0495684_0141003 3300047471 Bacteria 1807
450 Ga0495684_0366383 3300047471 Bacteria 1019
451 Ga0495593_0053464 3300047673 Bacteria 2131
452 Ga0495602_0000043 3300048088 Bacteria 123431
453 Ga0495602_0051489 3300048088 Bacteria 3666
454 Ga0495602_0053349 3300048088 Bacteria 3582
455 Ga0495614_0050026 3300048089 Bacteria 1791
456 Ga0496100_0028955 3300048903 Unclassified 3421
457 Ga0496100_0068711 3300048903 Bacteria 2357
458 Ga0496101_0074363 3300048904 Bacteria 2499
459 Ga0496102_0311566 3300048905 Bacteria 1483
460 Ga0496102_0604232 3300048905 Bacteria 1020
461 Ga0496102_0732755 3300048905 Bacteria 911
462 Ga0496104_0038289 3300048907 Bacteria 4486
463 Ga0496104_0671994 3300048907 Bacteria 944
464 Ga0496105_0000720 3300048908 Bacteria 22402
465 Ga0496105_0268734 3300048908 Bacteria 1377
466 Ga0496106_0049171 3300048909 Bacteria 3176
467 Ga0496106_0080227 3300048909 Bacteria 2506
468 Ga0496106_0227322 3300048909 Bacteria 1489
469 Ga0496107_0169998 3300048910 Bacteria 1617
470 Ga0496108_0035472 3300048911 Bacteria 4146
471 Ga0496109_0029911 3300048912 Bacteria 4881
472 Ga0496109_0042459 3300048912 Bacteria 4119
473 Ga0496109_0136148 3300048912 Bacteria 2295
474 Ga0496110_0636281 3300048913 Bacteria 966
475 Ga0496112_0003460 3300048915 Bacteria 13048
476 Ga0496112_0332366 3300048915 Bacteria 1463
477 Ga0496113_0012826 3300048916 Bacteria 5649
478 Ga0496113_0107855 3300048916 Bacteria 2164
479 Ga0496114_0211868 3300048917 Bacteria 1700
480 Ga0496114_0921714 3300048917 Bacteria 755
481 Ga0496115_0008739 3300048918 Bacteria 7509
482 Ga0496115_0070852 3300048918 Bacteria 2827
483 Ga0496126_0141766 3300048929 Bacteria 2068
484 Ga0501031_0034345 3300049568 Bacteria 3309
485 Ga0501031_0037922 3300049568 Bacteria 3146
486 Ga0501032_0004640 3300049569 Bacteria 10331
487 Ga0501032_0040950 3300049569 Bacteria 3147
488 Ga0501033_0002141 3300049570 Bacteria 17087
489 Ga0501033_0041003 3300049570 Bacteria 3455
490 Ga0501033_0143092 3300049570 Bacteria 1729
491 Ga0501033_0206535 3300049570 Bacteria 1402
492 Ga0501034_0000339 3300049571 Bacteria 81769
493 Ga0501034_0010360 3300049571 Bacteria 9714
494 Ga0501034_0075303 3300049571 Bacteria 3383
495 Ga0501034_0088414 3300049571 Bacteria 3096
496 Ga0501036_0002677 3300049572 Bacteria 14053
497 Ga0501036_0008346 3300049572 Bacteria 8487
498 Ga0501037_0000997 3300049573 Bacteria 20998
499 Ga0501038_0006939 3300049574 Bacteria 10453
500 Ga0501038_0010005 3300049574 Bacteria 8684
501 Ga0501038_0010143 3300049574 Bacteria 8623
502 Ga0501042_0010731 3300049578 Bacteria 6157
503 Ga0501043_0023356 3300049579 Bacteria 4850
504 Ga0501047_0003445 3300049581 Bacteria 14963
505 Ga0501047_0021502 3300049581 Bacteria 6196
506 Ga0501048_0000032 3300049582 Bacteria 65543
507 Ga0501048_0038844 3300049582 Bacteria 3416
508 Ga0501067_0015216 3300049583 Bacteria 4259
509 Ga0501070_0014326 3300049586 Bacteria 6674
510 Ga0501070_0023260 3300049586 Bacteria 5190
511 Ga0501070_0045983 3300049586 Bacteria 3630
512 Ga0501072_0010523 3300049588 Bacteria 7042
513 Ga0501074_0117543 3300049590 Bacteria 1902
514 Ga0501074_0129639 3300049590 Bacteria 1805
515 Ga0501076_0048546 3300049592 Bacteria 3355
516 Ga0501081_0008923 3300049743 Bacteria 6516
517 Ga0501081_0011009 3300049743 Bacteria 5914
518 Ga0501035_0044875 3300049822 Bacteria 3978
519 Ga0501035_0096772 3300049822 Bacteria 2593
520 Ga0501044_0004924 3300049823 Bacteria 14930
521 Ga0501045_0004797 3300049824 Bacteria 9340
522 nmdc:mga08y16_83557_c1 3300050511 Bacteria 3328
523 nmdc:mga0n895_166357_c1 3300050512 Bacteria 2237
524 nmdc:mga0n895_170297_c1 3300050512 Bacteria 2210
525 nmdc:mga0n895_3044_c1 3300050512 Bacteria 13347
526 nmdc:mga0rr50_24621_c1 3300050513 Bacteria 4172
527 nmdc:mga0rr50_509810_c1 3300050513 Unclassified 1023
528 nmdc:mga0rr50_604_c1 3300050513 Bacteria 19276
529 nmdc:mga0a205_31147_c1 3300050515 Bacteria 5109
530 nmdc:mga0a205_42915_c1 3300050515 Bacteria 4359
531 nmdc:mga0a205_473_c2 3300050515 Bacteria 25667
532 Ga0495601_0022490 3300053077 Bacteria 3871
533 Ga0495601_0026089 3300053077 Bacteria 3605
534 Ga0495601_0177194 3300053077 Bacteria 1394
535 Ga0495601_0185974 3300053077 Bacteria 1358
536 Ga0495612_0005704 3300053078 Bacteria 5142
537 Ga0495595_0002947 3300053084 Bacteria 6719
538 Ga0495595_0003772 3300053084 Bacteria 6029
539 Ga0495595_0053551 3300053084 Bacteria 1875
540 Ga0495595_0101151 3300053084 Unclassified 1391
541 Ga0495619_0033598 3300053085 Bacteria 3331
542 Ga0495619_0185610 3300053085 Bacteria 1439
543 Ga0501084_0036703 3300054114 Bacteria 4094
544 Ga0466962_0002006 3300061719 Bacteria 9620
545 Ga0466962_0013337 3300061719 Bacteria 3956
546 Ga0466962_0052415 3300061719 Bacteria 1950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0301023 Ga0373935_0301023_401_1120 198
2 3300035086 Ga0373934_0023722 Ga0373934_0023722_1637_2359 199
3 3300047317 Ga0495604_0468756 Ga0495604_0468756_17_739 199
4 3300048917 Ga0496114_0921714 Ga0496114_0921714_12_716 199
5 3300036401 Ga0373937_0518674 Ga0373937_0518674_42_815 201
6 3300005364 Ga0070673_100133941 Ga0070673_1001339413 203
7 3300005435 Ga0070714_100026498 Ga0070714_1000264983 203
8 3300005615 Ga0070702_100008505 Ga0070702_1000085054 203
9 3300009551 Ga0105238_10182927 Ga0105238_101829272 203
10 3300013307 Ga0157372_10153631 Ga0157372_101536313 203
11 3300025929 Ga0207664_10061483 Ga0207664_100614831 203
12 3300025932 Ga0207690_10046287 Ga0207690_100462874 203
13 3300025960 Ga0207651_10221594 Ga0207651_102215942 203
14 3300026078 Ga0207702_10115423 Ga0207702_101154232 203
15 3300005578 Ga0068854_100042511 Ga0068854_1000425113 204
16 3300013105 Ga0157369_10819674 Ga0157369_108196741 204
17 3300025981 Ga0207640_10038572 Ga0207640_100385724 204
18 3300005440 Ga0070705_100199712 Ga0070705_1001997122 205
19 3300044842 Ga0466957_0083485 Ga0466957_0083485_856_1683 205
20 3300048905 Ga0496102_0732755 Ga0496102_0732755_56_892 205
21 3300005436 Ga0070713_100425878 Ga0070713_1004258782 209
22 3300037312 Ga0395899_0391333 Ga0395899_0391333_21_761 210
23 3300046473 Ga0495582_0075457 Ga0495582_0075457_1097_1855 211
24 3300046675 Ga0495657_0213138 Ga0495657_0213138_367_1125 211
25 3300046683 Ga0495658_0041625 Ga0495658_0041625_1760_2518 211
26 3300048088 Ga0495602_0053349 Ga0495602_0053349_72_830 211
27 3300049572 Ga0501036_0008346 Ga0501036_0008346_4110_4958 211
28 3300046472 Ga0495580_0038110 Ga0495580_0038110_2252_3172 213
29 3300047321 Ga0495676_0044718 Ga0495676_0044718_2079_2999 213
30 3300037418 Ga0395900_0131891 Ga0395900_0131891_12_776 214
31 3300046683 Ga0495658_0157870 Ga0495658_0157870_472_1344 214
32 3300013105 Ga0157369_10241911 Ga0157369_102419112 217
33 3300037068 Ga0373925_0012824 Ga0373925_0012824_1137_2003 217
34 3300037471 Ga0395905_0538781 Ga0395905_0538781_256_1029 217
35 3300044765 Ga0466970_0028958 Ga0466970_0028958_1118_1879 217
36 3300044901 Ga0466960_0048180 Ga0466960_0048180_791_1552 217
37 3300031889 Ga0326468_10002009 Ga0326468_100020092 218
38 3300044719 Ga0466971_0009957 Ga0466971_0009957_1117_1911 218
39 3300045049 Ga0466959_0115079 Ga0466959_0115079_634_1428 218
40 3300045836 Ga0466958_0159741 Ga0466958_0159741_544_1338 218
41 3300049592 Ga0501076_0048546 Ga0501076_0048546_1832_2689 218
42 3300035171 Ga0373946_0054654 Ga0373946_0054654_805_1665 219
43 3300035725 Ga0373947_0005352 Ga0373947_0005352_5057_5917 219
44 3300037068 Ga0373925_0060056 Ga0373925_0060056_1071_1931 219
45 3300046459 Ga0495629_0005227 Ga0495629_0005227_239_1099 219
46 3300046473 Ga0495582_0000075 Ga0495582_0000075_11472_12332 219
47 3300046526 Ga0495666_0064306 Ga0495666_0064306_316_1176 219
48 3300046683 Ga0495658_0013354 Ga0495658_0013354_1304_2164 219
49 3300046689 Ga0495613_0001013 Ga0495613_0001013_14383_15243 219
50 3300005445 Ga0070708_100003025 Ga0070708_1000030257 221
51 3300005530 Ga0070679_100179337 Ga0070679_1001793372 221
52 3300009147 Ga0114129_10240614 Ga0114129_102406143 221
53 3300020078 Ga0206352_10332958 Ga0206352_103329581 221
54 3300022467 Ga0224712_10068735 Ga0224712_100687351 221
55 3300025932 Ga0207690_10035683 Ga0207690_100356832 221
56 3300035119 Ga0373956_0065191 Ga0373956_0065191_569_1435 221
57 3300035120 Ga0373957_0008303 Ga0373957_0008303_1234_2100 221
58 3300035171 Ga0373946_0028266 Ga0373946_0028266_1031_1897 221
59 3300035692 Ga0373935_0024505 Ga0373935_0024505_884_1750 221
60 3300035695 Ga0373927_0260368 Ga0373927_0260368_217_1083 221
61 3300046454 Ga0495592_0065236 Ga0495592_0065236_1581_2447 221
62 3300046459 Ga0495629_0014993 Ga0495629_0014993_3829_4695 221
63 3300046462 Ga0495651_0066990 Ga0495651_0066990_1234_2100 221
64 3300046463 Ga0495653_0036350 Ga0495653_0036350_897_1763 221
65 3300046475 Ga0495639_0023533 Ga0495639_0023533_1777_2643 221
66 3300046476 Ga0495662_0006801 Ga0495662_0006801_850_1716 221
67 3300046477 Ga0495664_0026987 Ga0495664_0026987_1581_2447 221
68 3300046511 Ga0495608_0119128 Ga0495608_0119128_60_926 221
69 3300046514 Ga0495618_0030980 Ga0495618_0030980_897_1763 221
70 3300046516 Ga0495628_0030209 Ga0495628_0030209_897_1763 221
71 3300046526 Ga0495666_0146518 Ga0495666_0146518_27_893 221
72 3300046529 Ga0495652_0132447 Ga0495652_0132447_897_1763 221
73 3300046531 Ga0495665_0023455 Ga0495665_0023455_1580_2446 221
74 3300046535 Ga0495586_0009423 Ga0495586_0009423_3617_4483 221
75 3300046543 Ga0495645_0032425 Ga0495645_0032425_1234_2100 221
76 3300046642 Ga0495634_0014300 Ga0495634_0014300_57_923 221
77 3300046663 Ga0495635_0038373 Ga0495635_0038373_870_1736 221
78 3300046675 Ga0495657_0025872 Ga0495657_0025872_2425_3291 221
79 3300046678 Ga0495599_0021292 Ga0495599_0021292_2278_3144 221
80 3300046679 Ga0495623_0062597 Ga0495623_0062597_569_1435 221
81 3300046680 Ga0495646_0026563 Ga0495646_0026563_897_1763 221
82 3300046683 Ga0495658_0015437 Ga0495658_0015437_279_1145 221
83 3300046689 Ga0495613_0054380 Ga0495613_0054380_1234_2100 221
84 3300046690 Ga0495624_0004932 Ga0495624_0004932_6399_7265 221
85 3300047315 Ga0495581_0019512 Ga0495581_0019512_2259_3125 221
86 3300047322 Ga0495680_0187061 Ga0495680_0187061_569_1435 221
87 3300047471 Ga0495684_0056243 Ga0495684_0056243_1366_2232 221
88 3300053077 Ga0495601_0026089 Ga0495601_0026089_2553_3419 221
89 3300053078 Ga0495612_0005704 Ga0495612_0005704_4171_5037 221
90 3300053084 Ga0495595_0003772 Ga0495595_0003772_3386_4252 221
91 3300053085 Ga0495619_0033598 Ga0495619_0033598_885_1751 221
92 3300005546 Ga0070696_100004267 Ga0070696_1000042673 222
93 3300005549 Ga0070704_100041000 Ga0070704_1000410003 222
94 3300005719 Ga0068861_100282353 Ga0068861_1002823532 222
95 3300013297 Ga0157378_10379346 Ga0157378_103793462 222
96 3300044683 Ga0466965_0039794 Ga0466965_0039794_1083_1940 222
97 3300044684 Ga0466966_0015128 Ga0466966_0015128_1489_2346 222
98 3300044693 Ga0466961_0029220 Ga0466961_0029220_1506_2363 222
99 3300045049 Ga0466959_0108176 Ga0466959_0108176_290_1147 222
100 3300048909 Ga0496106_0227322 Ga0496106_0227322_52_981 222
101 3300049570 Ga0501033_0041003 Ga0501033_0041003_797_1645 222
102 3300037068 Ga0373925_0335621 Ga0373925_0335621_229_1095 223
103 3300046476 Ga0495662_0056423 Ga0495662_0056423_123_989 223
104 3300046477 Ga0495664_0072538 Ga0495664_0072538_728_1594 223
105 3300046535 Ga0495586_0051510 Ga0495586_0051510_909_1775 223
106 3300046543 Ga0495645_0117792 Ga0495645_0117792_219_1085 223
107 3300046678 Ga0495599_0211130 Ga0495599_0211130_211_1077 223
108 3300047319 Ga0495674_0005568 Ga0495674_0005568_7004_7870 223
109 3300049569 Ga0501032_0004640 Ga0501032_0004640_4041_4835 223
110 3300049570 Ga0501033_0143092 Ga0501033_0143092_410_1204 223
111 3300049571 Ga0501034_0088414 Ga0501034_0088414_1973_2767 223
112 3300049573 Ga0501037_0000997 Ga0501037_0000997_2029_2823 223
113 3300049574 Ga0501038_0010143 Ga0501038_0010143_4170_4964 223
114 3300049581 Ga0501047_0021502 Ga0501047_0021502_4999_5793 223
115 3300049586 Ga0501070_0014326 Ga0501070_0014326_1710_2504 223
116 3300049588 Ga0501072_0010523 Ga0501072_0010523_4234_5031 223
117 3300049590 Ga0501074_0117543 Ga0501074_0117543_185_979 223
118 3300049590 Ga0501074_0129639 Ga0501074_0129639_339_1136 223
119 3300049823 Ga0501044_0004924 Ga0501044_0004924_4063_4857 223
120 3300053077 Ga0495601_0185974 Ga0495601_0185974_110_976 223
121 3300005434 Ga0070709_10005059 Ga0070709_100050593 224
122 3300005435 Ga0070714_100055710 Ga0070714_1000557102 224
123 3300005435 Ga0070714_100088188 Ga0070714_1000881882 224
124 3300005436 Ga0070713_100023894 Ga0070713_1000238943 224
125 3300005436 Ga0070713_100079162 Ga0070713_1000791622 224
126 3300005437 Ga0070710_10015349 Ga0070710_100153493 224
127 3300005445 Ga0070708_100096965 Ga0070708_1000969652 224
128 3300005468 Ga0070707_100129267 Ga0070707_1001292672 224
129 3300005536 Ga0070697_100178464 Ga0070697_1001784641 224
130 3300006173 Ga0070716_100013771 Ga0070716_1000137713 224
131 3300006175 Ga0070712_100015232 Ga0070712_1000152323 224
132 3300007076 Ga0075435_100233570 Ga0075435_1002335701 224
133 3300025898 Ga0207692_10003405 Ga0207692_100034053 224
134 3300025906 Ga0207699_10033846 Ga0207699_100338463 224
135 3300025916 Ga0207663_10062312 Ga0207663_100623122 224
136 3300025922 Ga0207646_10020082 Ga0207646_100200822 224
137 3300025928 Ga0207700_10053294 Ga0207700_100532943 224
138 3300025928 Ga0207700_10071088 Ga0207700_100710882 224
139 3300025929 Ga0207664_10039633 Ga0207664_100396332 224
140 3300025929 Ga0207664_10085441 Ga0207664_100854413 224
141 3300028800 Ga0265338_10014545 Ga0265338_100145456 224
142 3300031247 Ga0265340_10085842 Ga0265340_100858422 224
143 3300031711 Ga0265314_10065656 Ga0265314_100656563 224
144 3300044683 Ga0466965_0129912 Ga0466965_0129912_145_990 224
145 3300045976 Ga0466967_0097118 Ga0466967_0097118_614_1408 224
146 3300046463 Ga0495653_0291348 Ga0495653_0291348_132_998 224
147 3300005436 Ga0070713_100097768 Ga0070713_1000977683 225
148 3300005467 Ga0070706_100004578 Ga0070706_10000457813 225
149 3300005468 Ga0070707_100000225 Ga0070707_10000022558 225
150 3300005471 Ga0070698_100007677 Ga0070698_10000767714 225
151 3300006028 Ga0070717_10119487 Ga0070717_101194873 225
152 3300006175 Ga0070712_100147814 Ga0070712_1001478142 225
153 3300025910 Ga0207684_10001589 Ga0207684_100015892 225
154 3300025922 Ga0207646_10001144 Ga0207646_100011442 225
155 3300025928 Ga0207700_10091334 Ga0207700_100913342 225
156 3300044694 Ga0466963_0040335 Ga0466963_0040335_621_1478 225
157 3300044842 Ga0466957_0036383 Ga0466957_0036383_2028_2885 225
158 3300045836 Ga0466958_0001388 Ga0466958_0001388_2008_2865 225
159 3300045836 Ga0466958_0056368 Ga0466958_0056368_1310_2167 225
160 3300005341 Ga0070691_10052938 Ga0070691_100529382 226
161 3300005445 Ga0070708_100139627 Ga0070708_1001396272 226
162 3300037312 Ga0395899_0023969 Ga0395899_0023969_1028_1861 226
163 3300038443 Ga0395901_0007269 Ga0395901_0007269_1338_2171 226
164 3300039450 Ga0436363_0310934 Ga0436363_0310934_1445_2311 226
165 3300049571 Ga0501034_0010360 Ga0501034_0010360_8805_9644 226
166 3300005329 Ga0070683_100254723 Ga0070683_1002547232 227
167 3300005434 Ga0070709_10098020 Ga0070709_100980202 227
168 3300005435 Ga0070714_100087135 Ga0070714_1000871352 227
169 3300005437 Ga0070710_10035167 Ga0070710_100351672 227
170 3300006028 Ga0070717_10160103 Ga0070717_101601032 227
171 3300006163 Ga0070715_10002015 Ga0070715_100020154 227
172 3300006173 Ga0070716_100053888 Ga0070716_1000538882 227
173 3300006914 Ga0075436_100040670 Ga0075436_1000406702 227
174 3300009098 Ga0105245_10295057 Ga0105245_102950572 227
175 3300025898 Ga0207692_10005080 Ga0207692_100050803 227
176 3300025905 Ga0207685_10003103 Ga0207685_100031033 227
177 3300025906 Ga0207699_10001560 Ga0207699_100015606 227
178 3300025916 Ga0207663_10010386 Ga0207663_100103864 227
179 3300025939 Ga0207665_10002741 Ga0207665_100027415 227
180 3300025944 Ga0207661_10356171 Ga0207661_103561712 227
181 3300035086 Ga0373934_0006301 Ga0373934_0006301_3031_3885 227
182 3300044694 Ga0466963_0106485 Ga0466963_0106485_971_1777 227
183 3300044842 Ga0466957_0133103 Ga0466957_0133103_573_1379 227
184 3300045836 Ga0466958_0025763 Ga0466958_0025763_1621_2427 227
185 3300048904 Ga0496101_0074363 Ga0496101_0074363_901_1767 227
186 3300048905 Ga0496102_0311566 Ga0496102_0311566_576_1442 227
187 3300048907 Ga0496104_0038289 Ga0496104_0038289_2306_3172 227
188 3300048908 Ga0496105_0000720 Ga0496105_0000720_1304_2170 227
189 3300048909 Ga0496106_0080227 Ga0496106_0080227_353_1219 227
190 3300048910 Ga0496107_0169998 Ga0496107_0169998_496_1362 227
191 3300048911 Ga0496108_0035472 Ga0496108_0035472_2092_2958 227
192 3300048912 Ga0496109_0029911 Ga0496109_0029911_1079_1945 227
193 3300048915 Ga0496112_0003460 Ga0496112_0003460_4739_5605 227
194 3300048916 Ga0496113_0012826 Ga0496113_0012826_3140_4006 227
195 3300048917 Ga0496114_0211868 Ga0496114_0211868_272_1138 227
196 3300048918 Ga0496115_0008739 Ga0496115_0008739_2272_3138 227
197 3300049583 Ga0501067_0015216 Ga0501067_0015216_552_1352 227
198 3300050515 nmdc:mga0a205_42915_c1 nmdc:mga0a205_42915_c1_2292_3155 227
199 3300037466 Ga0395898_0053921 Ga0395898_0053921_176_985 228
200 3300045976 Ga0466967_0189122 Ga0466967_0189122_14_823 228
201 3300048907 Ga0496104_0671994 Ga0496104_0671994_43_843 228
202 3300049571 Ga0501034_0000339 Ga0501034_0000339_43865_44710 228
203 3300005563 Ga0068855_100077845 Ga0068855_1000778452 229
204 3300005719 Ga0068861_100324244 Ga0068861_1003242442 229
205 3300006058 Ga0075432_10028786 Ga0075432_100287862 229
206 3300006852 Ga0075433_10027459 Ga0075433_100274594 229
207 3300006914 Ga0075436_100013450 Ga0075436_1000134502 229
208 3300007076 Ga0075435_100016701 Ga0075435_1000167015 229
209 3300009094 Ga0111539_10100754 Ga0111539_101007543 229
210 3300009147 Ga0114129_10032268 Ga0114129_100322686 229
211 3300025949 Ga0207667_10210903 Ga0207667_102109031 229
212 3300025961 Ga0207712_10172255 Ga0207712_101722552 229
213 3300027907 Ga0207428_10193667 Ga0207428_101936671 229
214 3300035116 Ga0373945_0087301 Ga0373945_0087301_178_1053 229
215 3300035171 Ga0373946_0118456 Ga0373946_0118456_163_1038 229
216 3300037068 Ga0373925_0007127 Ga0373925_0007127_5668_6519 229
217 3300046455 Ga0495603_0119533 Ga0495603_0119533_289_1164 229
218 3300046461 Ga0495641_0030431 Ga0495641_0030431_703_1578 229
219 3300046463 Ga0495653_0041274 Ga0495653_0041274_992_1867 229
220 3300046473 Ga0495582_0028453 Ga0495582_0028453_1840_2715 229
221 3300046531 Ga0495665_0073180 Ga0495665_0073180_198_1073 229
222 3300046642 Ga0495634_0054841 Ga0495634_0054841_789_1664 229
223 3300046689 Ga0495613_0045797 Ga0495613_0045797_453_1328 229
224 3300046690 Ga0495624_0104345 Ga0495624_0104345_300_1175 229
225 3300047315 Ga0495581_0107787 Ga0495581_0107787_130_1005 229
226 3300047319 Ga0495674_0098228 Ga0495674_0098228_1069_1944 229
227 3300047321 Ga0495676_0057002 Ga0495676_0057002_116_991 229
228 3300047322 Ga0495680_0075077 Ga0495680_0075077_1081_1956 229
229 3300047471 Ga0495684_0041265 Ga0495684_0041265_1321_2196 229
230 3300047673 Ga0495593_0053464 Ga0495593_0053464_276_1151 229
231 3300050511 nmdc:mga08y16_83557_c1 nmdc:mga08y16_83557_c1_2338_3216 229
232 3300050512 nmdc:mga0n895_170297_c1 nmdc:mga0n895_170297_c1_591_1469 229
233 3300050513 nmdc:mga0rr50_24621_c1 nmdc:mga0rr50_24621_c1_1531_2409 229
234 3300050515 nmdc:mga0a205_31147_c1 nmdc:mga0a205_31147_c1_1764_2642 229
235 3300053085 Ga0495619_0185610 Ga0495619_0185610_253_1128 229
236 3300005445 Ga0070708_100008734 Ga0070708_1000087342 230
237 3300005468 Ga0070707_100257355 Ga0070707_1002573552 230
238 3300006175 Ga0070712_100441165 Ga0070712_1004411652 230
239 3300009174 Ga0105241_10380129 Ga0105241_103801292 230
240 3300025915 Ga0207693_10397906 Ga0207693_103979061 230
241 3300025922 Ga0207646_10340510 Ga0207646_103405101 230
242 3300035117 Ga0373953_0109163 Ga0373953_0109163_214_1068 230
243 3300035120 Ga0373957_0024889 Ga0373957_0024889_795_1649 230
244 3300035172 Ga0373955_0033263 Ga0373955_0033263_718_1572 230
245 3300035410 Ga0373924_0136603 Ga0373924_0136603_17_871 230
246 3300035724 Ga0373933_0048697 Ga0373933_0048697_1522_2376 230
247 3300036401 Ga0373937_0014112 Ga0373937_0014112_3580_4434 230
248 3300044658 Ga0466972_0049388 Ga0466972_0049388_50_877 230
249 3300045049 Ga0466959_0109311 Ga0466959_0109311_874_1734 230
250 3300045976 Ga0466967_0552237 Ga0466967_0552237_91_954 230
251 3300046462 Ga0495651_0015947 Ga0495651_0015947_3979_4833 230
252 3300046463 Ga0495653_0034072 Ga0495653_0034072_2877_3731 230
253 3300046511 Ga0495608_0244877 Ga0495608_0244877_52_906 230
254 3300046529 Ga0495652_0093406 Ga0495652_0093406_165_1019 230
255 3300046536 Ga0495587_0024962 Ga0495587_0024962_197_1051 230
256 3300046559 Ga0495667_0089394 Ga0495667_0089394_706_1560 230
257 3300046679 Ga0495623_0083272 Ga0495623_0083272_674_1528 230
258 3300047322 Ga0495680_0087301 Ga0495680_0087301_1248_2102 230
259 3300047471 Ga0495684_0366383 Ga0495684_0366383_41_895 230
260 3300048088 Ga0495602_0051489 Ga0495602_0051489_2605_3459 230
261 3300053084 Ga0495595_0002947 Ga0495595_0002947_5619_6473 230
262 3300053084 Ga0495595_0053551 Ga0495595_0053551_502_1338 230
263 iso_pu_bacteria 2912723979 2912727619 230
264 iso_pu_bacteria 8008574985 8008581871 230
265 3300005434 Ga0070709_10104743 Ga0070709_101047432 231
266 3300005445 Ga0070708_100017274 Ga0070708_1000172744 231
267 3300005445 Ga0070708_100210706 Ga0070708_1002107062 231
268 3300005467 Ga0070706_100148468 Ga0070706_1001484682 231
269 3300005467 Ga0070706_100192791 Ga0070706_1001927913 231
270 3300005468 Ga0070707_100033495 Ga0070707_1000334952 231
271 3300005471 Ga0070698_100050069 Ga0070698_1000500693 231
272 3300005937 Ga0081455_10033987 Ga0081455_100339873 231
273 3300025910 Ga0207684_10224286 Ga0207684_102242863 231
274 3300025910 Ga0207684_10261217 Ga0207684_102612172 231
275 3300025916 Ga0207663_10397753 Ga0207663_103977532 231
276 3300044656 Ga0466969_0089690 Ga0466969_0089690_141_959 231
277 3300044684 Ga0466966_0002685 Ga0466966_0002685_2197_3015 231
278 3300044693 Ga0466961_0001059 Ga0466961_0001059_7737_8555 231
279 3300044694 Ga0466963_0019467 Ga0466963_0019467_3388_4206 231
280 3300044719 Ga0466971_0071866 Ga0466971_0071866_642_1460 231
281 3300045049 Ga0466959_0005959 Ga0466959_0005959_6959_7777 231
282 3300049568 Ga0501031_0037922 Ga0501031_0037922_711_1565 231
283 3300049572 Ga0501036_0002677 Ga0501036_0002677_565_1419 231
284 3300049574 Ga0501038_0006939 Ga0501038_0006939_1780_2634 231
285 3300049578 Ga0501042_0010731 Ga0501042_0010731_3013_3867 231
286 3300049582 Ga0501048_0038844 Ga0501048_0038844_1459_2313 231
287 3300049743 Ga0501081_0011009 Ga0501081_0011009_3714_4568 231
288 3300049824 Ga0501045_0004797 Ga0501045_0004797_5685_6539 231
289 3300054114 Ga0501084_0036703 Ga0501084_0036703_1010_1864 231
290 3300005434 Ga0070709_10001294 Ga0070709_1000129411 232
291 3300005434 Ga0070709_10145724 Ga0070709_101457241 232
292 3300005435 Ga0070714_100003066 Ga0070714_1000030669 232
293 3300005435 Ga0070714_100012135 Ga0070714_1000121352 232
294 3300005436 Ga0070713_100002626 Ga0070713_1000026264 232
295 3300005436 Ga0070713_100657225 Ga0070713_1006572251 232
296 3300005437 Ga0070710_10000175 Ga0070710_100001751 232
297 3300005437 Ga0070710_10225266 Ga0070710_102252662 232
298 3300005439 Ga0070711_100003307 Ga0070711_1000033071 232
299 3300005439 Ga0070711_100340796 Ga0070711_1003407962 232
300 3300005458 Ga0070681_10083757 Ga0070681_100837573 232
301 3300005467 Ga0070706_100008447 Ga0070706_1000084474 232
302 3300005468 Ga0070707_100002427 Ga0070707_10000242712 232
303 3300005468 Ga0070707_100027434 Ga0070707_1000274342 232
304 3300005468 Ga0070707_100229825 Ga0070707_1002298252 232
305 3300005471 Ga0070698_100000718 Ga0070698_1000007188 232
306 3300005471 Ga0070698_100188566 Ga0070698_1001885662 232
307 3300005547 Ga0070693_100114999 Ga0070693_1001149992 232
308 3300005548 Ga0070665_100595869 Ga0070665_1005958692 232
309 3300005549 Ga0070704_100049595 Ga0070704_1000495953 232
310 3300006028 Ga0070717_10001448 Ga0070717_1000144815 232
311 3300006028 Ga0070717_10103067 Ga0070717_101030672 232
312 3300006028 Ga0070717_10674372 Ga0070717_106743721 232
313 3300006163 Ga0070715_10008129 Ga0070715_100081294 232
314 3300006173 Ga0070716_100000032 Ga0070716_1000000325 232
315 3300006175 Ga0070712_100000709 Ga0070712_10000070910 232
316 3300006175 Ga0070712_100389416 Ga0070712_1003894162 232
317 3300006237 Ga0097621_100079527 Ga0097621_1000795273 232
318 3300006871 Ga0075434_100013030 Ga0075434_1000130302 232
319 3300007076 Ga0075435_100149534 Ga0075435_1001495342 232
320 3300009101 Ga0105247_10081065 Ga0105247_100810652 232
321 3300010159 Ga0099796_10102796 Ga0099796_101027961 232
322 3300025898 Ga0207692_10001537 Ga0207692_1000153710 232
323 3300025898 Ga0207692_10182849 Ga0207692_101828492 232
324 3300025905 Ga0207685_10069417 Ga0207685_100694172 232
325 3300025906 Ga0207699_10002669 Ga0207699_100026695 232
326 3300025910 Ga0207684_10012696 Ga0207684_100126964 232
327 3300025910 Ga0207684_10162045 Ga0207684_101620452 232
328 3300025915 Ga0207693_10003266 Ga0207693_100032665 232
329 3300025916 Ga0207663_10010800 Ga0207663_100108004 232
330 3300025916 Ga0207663_10012447 Ga0207663_100124472 232
331 3300025916 Ga0207663_10258175 Ga0207663_102581751 232
332 3300025917 Ga0207660_10327811 Ga0207660_103278112 232
333 3300025928 Ga0207700_10000154 Ga0207700_100001542 232
334 3300025928 Ga0207700_10008708 Ga0207700_100087083 232
335 3300025928 Ga0207700_10261897 Ga0207700_102618971 232
336 3300025929 Ga0207664_10000211 Ga0207664_1000021138 232
337 3300025929 Ga0207664_10072406 Ga0207664_100724062 232
338 3300025929 Ga0207664_10097443 Ga0207664_100974432 232
339 3300025929 Ga0207664_10287545 Ga0207664_102875452 232
340 3300025939 Ga0207665_10000331 Ga0207665_100003313 232
341 3300028379 Ga0268266_10533527 Ga0268266_105335272 232
342 3300034957 Ga0373938_0007491 Ga0373938_0007491_56_928 232
343 3300035085 Ga0373929_0002577 Ga0373929_0002577_988_1860 232
344 3300035088 Ga0373940_0053588 Ga0373940_0053588_58_933 232
345 3300035091 Ga0373951_0013113 Ga0373951_0013113_520_1392 232
346 3300035092 Ga0373952_0001586 Ga0373952_0001586_3230_4102 232
347 3300035112 Ga0373932_0011515 Ga0373932_0011515_192_1064 232
348 3300035117 Ga0373953_0063136 Ga0373953_0063136_402_1274 232
349 3300035118 Ga0373954_0054420 Ga0373954_0054420_46_918 232
350 3300035119 Ga0373956_0053311 Ga0373956_0053311_266_1138 232
351 3300035120 Ga0373957_0004648 Ga0373957_0004648_582_1454 232
352 3300035241 Ga0373961_0070711 Ga0373961_0070711_32_904 232
353 3300035242 Ga0373962_0025175 Ga0373962_0025175_132_1004 232
354 3300035410 Ga0373924_0011930 Ga0373924_0011930_1929_2801 232
355 3300035692 Ga0373935_0125463 Ga0373935_0125463_814_1686 232
356 3300035724 Ga0373933_0006208 Ga0373933_0006208_3115_3987 232
357 3300036401 Ga0373937_0001415 Ga0373937_0001415_14747_15619 232
358 3300036401 Ga0373937_0309755 Ga0373937_0309755_445_1308 232
359 3300037068 Ga0373925_0007744 Ga0373925_0007744_4090_4953 232
360 3300037068 Ga0373925_0289113 Ga0373925_0289113_188_1051 232
361 3300044694 Ga0466963_0104483 Ga0466963_0104483_571_1410 232
362 3300044842 Ga0466957_0045134 Ga0466957_0045134_966_1805 232
363 3300044842 Ga0466957_0101844 Ga0466957_0101844_890_1729 232
364 3300045836 Ga0466958_0040868 Ga0466958_0040868_1879_2706 232
365 3300045836 Ga0466958_0142317 Ga0466958_0142317_167_1006 232
366 3300046454 Ga0495592_0019019 Ga0495592_0019019_2079_2951 232
367 3300046463 Ga0495653_0108250 Ga0495653_0108250_257_1120 232
368 3300046477 Ga0495664_0286704 Ga0495664_0286704_106_978 232
369 3300046499 Ga0495594_0245340 Ga0495594_0245340_17_889 232
370 3300046501 Ga0495607_0016202 Ga0495607_0016202_3822_4676 232
371 3300046511 Ga0495608_0014731 Ga0495608_0014731_1838_2710 232
372 3300046516 Ga0495628_0140145 Ga0495628_0140145_197_1060 232
373 3300046517 Ga0495630_0014840 Ga0495630_0014840_2384_3256 232
374 3300046529 Ga0495652_0035299 Ga0495652_0035299_2662_3534 232
375 3300046536 Ga0495587_0007313 Ga0495587_0007313_2462_3334 232
376 3300046543 Ga0495645_0028451 Ga0495645_0028451_726_1598 232
377 3300046559 Ga0495667_0124935 Ga0495667_0124935_748_1620 232
378 3300046615 Ga0495656_0036552 Ga0495656_0036552_728_1582 232
379 3300046642 Ga0495634_0104656 Ga0495634_0104656_230_1102 232
380 3300046663 Ga0495635_0092212 Ga0495635_0092212_265_1137 232
381 3300046675 Ga0495657_0193720 Ga0495657_0193720_60_932 232
382 3300046679 Ga0495623_0037320 Ga0495623_0037320_1199_2071 232
383 3300046680 Ga0495646_0042810 Ga0495646_0042810_1305_2177 232
384 3300046690 Ga0495624_0118318 Ga0495624_0118318_71_934 232
385 3300046690 Ga0495624_0144134 Ga0495624_0144134_229_1101 232
386 3300046809 Ga0495600_0013980 Ga0495600_0013980_292_1164 232
387 3300047317 Ga0495604_0028076 Ga0495604_0028076_439_1311 232
388 3300047319 Ga0495674_0022401 Ga0495674_0022401_843_1706 232
389 3300047322 Ga0495680_0021492 Ga0495680_0021492_4487_5359 232
390 3300047444 Ga0495675_0163580 Ga0495675_0163580_16_888 232
391 3300047471 Ga0495684_0081877 Ga0495684_0081877_109_981 232
392 3300047471 Ga0495684_0141003 Ga0495684_0141003_627_1490 232
393 3300048089 Ga0495614_0050026 Ga0495614_0050026_23_892 232
394 3300048903 Ga0496100_0068711 Ga0496100_0068711_838_1710 232
395 3300048908 Ga0496105_0268734 Ga0496105_0268734_81_953 232
396 3300048912 Ga0496109_0042459 Ga0496109_0042459_1754_2608 232
397 3300048912 Ga0496109_0136148 Ga0496109_0136148_1237_2109 232
398 3300048915 Ga0496112_0332366 Ga0496112_0332366_492_1364 232
399 3300048916 Ga0496113_0107855 Ga0496113_0107855_1099_1971 232
400 3300048918 Ga0496115_0070852 Ga0496115_0070852_187_1059 232
401 3300048929 Ga0496126_0141766 Ga0496126_0141766_382_1248 232
402 3300050512 nmdc:mga0n895_166357_c1 nmdc:mga0n895_166357_c1_1187_2059 232
403 3300053077 Ga0495601_0022490 Ga0495601_0022490_2908_3771 232
404 3300053084 Ga0495595_0101151 Ga0495595_0101151_120_992 232
405 3300061719 Ga0466962_0052415 Ga0466962_0052415_437_1276 232
406 3300005467 Ga0070706_100200403 Ga0070706_1002004032 233
407 3300005468 Ga0070707_100005549 Ga0070707_1000055497 233
408 3300005471 Ga0070698_100055999 Ga0070698_1000559994 233
409 3300005471 Ga0070698_100117090 Ga0070698_1001170901 233
410 3300005983 Ga0081540_1000799 Ga0081540_100079921 233
411 3300020077 Ga0206351_10500795 Ga0206351_105007952 233
412 3300025922 Ga0207646_10016475 Ga0207646_100164753 233
413 3300031824 Ga0307413_10004860 Ga0307413_100048604 233
414 3300031852 Ga0307410_10027937 Ga0307410_100279372 233
415 3300031995 Ga0307409_100171542 Ga0307409_1001715422 233
416 3300035086 Ga0373934_0000109 Ga0373934_0000109_26133_27008 233
417 3300035117 Ga0373953_0000026 Ga0373953_0000026_696_1571 233
418 3300035119 Ga0373956_0003083 Ga0373956_0003083_2972_3847 233
419 3300035120 Ga0373957_0000038 Ga0373957_0000038_1832_2707 233
420 3300035724 Ga0373933_0000188 Ga0373933_0000188_20924_21799 233
421 3300036401 Ga0373937_0000138 Ga0373937_0000138_50045_50920 233
422 3300044658 Ga0466972_0026675 Ga0466972_0026675_1428_2273 233
423 3300044684 Ga0466966_0104489 Ga0466966_0104489_198_1037 233
424 3300045976 Ga0466967_0103855 Ga0466967_0103855_789_1640 233
425 3300046454 Ga0495592_0000041 Ga0495592_0000041_103408_104283 233
426 3300046462 Ga0495651_0000018 Ga0495651_0000018_19149_20024 233
427 3300046511 Ga0495608_0000039 Ga0495608_0000039_19149_20024 233
428 3300046516 Ga0495628_0000219 Ga0495628_0000219_720_1595 233
429 3300046529 Ga0495652_0004358 Ga0495652_0004358_5644_6519 233
430 3300046536 Ga0495587_0000034 Ga0495587_0000034_103409_104284 233
431 3300046559 Ga0495667_0000150 Ga0495667_0000150_19149_20024 233
432 3300046675 Ga0495657_0000247 Ga0495657_0000247_19149_20024 233
433 3300046678 Ga0495599_0000108 Ga0495599_0000108_36126_37001 233
434 3300046679 Ga0495623_0000607 Ga0495623_0000607_9680_10555 233
435 3300046680 Ga0495646_0005081 Ga0495646_0005081_1930_2805 233
436 3300046809 Ga0495600_0018344 Ga0495600_0018344_2904_3779 233
437 3300047317 Ga0495604_0000039 Ga0495604_0000039_103408_104283 233
438 3300047322 Ga0495680_0000028 Ga0495680_0000028_8583_9458 233
439 3300047444 Ga0495675_0001550 Ga0495675_0001550_5352_6227 233
440 3300048088 Ga0495602_0000043 Ga0495602_0000043_103408_104283 233
441 3300005406 Ga0070703_10002773 Ga0070703_100027735 234
442 3300005440 Ga0070705_100000536 Ga0070705_10000053617 234
443 3300005467 Ga0070706_100000177 Ga0070706_10000017770 234
444 3300005471 Ga0070698_100008689 Ga0070698_1000086893 234
445 3300005471 Ga0070698_100087494 Ga0070698_1000874942 234
446 3300005518 Ga0070699_100000184 Ga0070699_1000001848 234
447 3300005518 Ga0070699_100273217 Ga0070699_1002732172 234
448 3300005614 Ga0068856_100075857 Ga0068856_1000758572 234
449 3300020082 Ga0206353_11671110 Ga0206353_116711102 234
450 3300025910 Ga0207684_10000010 Ga0207684_10000010188 234
451 3300025922 Ga0207646_10006607 Ga0207646_100066074 234
452 3300044658 Ga0466972_0046181 Ga0466972_0046181_542_1399 234
453 3300044683 Ga0466965_0003711 Ga0466965_0003711_71_928 234
454 3300044693 Ga0466961_0186811 Ga0466961_0186811_329_1186 234
455 3300044694 Ga0466963_0020369 Ga0466963_0020369_771_1628 234
456 3300044706 Ga0466964_0003249 Ga0466964_0003249_4411_5268 234
457 3300044719 Ga0466971_0003586 Ga0466971_0003586_4928_5785 234
458 3300044765 Ga0466970_0042113 Ga0466970_0042113_940_1797 234
459 3300044842 Ga0466957_0003253 Ga0466957_0003253_5210_6067 234
460 3300045049 Ga0466959_0021486 Ga0466959_0021486_99_956 234
461 3300045836 Ga0466958_0162959 Ga0466958_0162959_218_1075 234
462 3300045976 Ga0466967_0218621 Ga0466967_0218621_735_1592 234
463 3300048913 Ga0496110_0636281 Ga0496110_0636281_69_923 234
464 3300049570 Ga0501033_0002141 Ga0501033_0002141_2793_3635 234
465 3300049571 Ga0501034_0075303 Ga0501034_0075303_922_1770 234
466 3300049586 Ga0501070_0045983 Ga0501070_0045983_2569_3417 234
467 3300049822 Ga0501035_0044875 Ga0501035_0044875_784_1626 234
468 3300061719 Ga0466962_0002006 Ga0466962_0002006_4755_5612 234
469 3300061719 Ga0466962_0013337 Ga0466962_0013337_748_1590 234
470 3300006881 Ga0068865_100122847 Ga0068865_1001228471 235
471 3300044694 Ga0466963_0116697 Ga0466963_0116697_220_1068 235
472 3300047319 Ga0495674_0205489 Ga0495674_0205489_30_866 235
473 3300053077 Ga0495601_0177194 Ga0495601_0177194_399_1265 237
474 3300005338 Ga0068868_100067704 Ga0068868_1000677043 239
475 3300005356 Ga0070674_100033173 Ga0070674_1000331734 239
476 3300005406 Ga0070703_10000005 Ga0070703_10000005126 239
477 3300005440 Ga0070705_100025623 Ga0070705_1000256233 239
478 3300005445 Ga0070708_100001931 Ga0070708_10000193111 239
479 3300005467 Ga0070706_100000438 Ga0070706_10000043838 239
480 3300005468 Ga0070707_100034278 Ga0070707_1000342783 239
481 3300005471 Ga0070698_100013962 Ga0070698_1000139623 239
482 3300005536 Ga0070697_100138606 Ga0070697_1001386063 239
483 3300005546 Ga0070696_100040691 Ga0070696_1000406913 239
484 3300005549 Ga0070704_100260765 Ga0070704_1002607651 239
485 3300005718 Ga0068866_10093359 Ga0068866_100933592 239
486 3300006852 Ga0075433_10002433 Ga0075433_100024338 239
487 3300006871 Ga0075434_100000676 Ga0075434_10000067620 239
488 3300007076 Ga0075435_100011163 Ga0075435_1000111634 239
489 3300009098 Ga0105245_10130117 Ga0105245_101301173 239
490 3300009147 Ga0114129_10112615 Ga0114129_101126157 239
491 3300009148 Ga0105243_10004378 Ga0105243_1000437810 239
492 3300009176 Ga0105242_10002244 Ga0105242_1000224415 239
493 3300010375 Ga0105239_10581120 Ga0105239_105811202 239
494 3300013297 Ga0157378_10003343 Ga0157378_1000334315 239
495 3300013306 Ga0163162_10133038 Ga0163162_101330382 239
496 3300025885 Ga0207653_10000002 Ga0207653_10000002258 239
497 3300025910 Ga0207684_10000123 Ga0207684_1000012338 239
498 3300025918 Ga0207662_10141586 Ga0207662_101415863 239
499 3300025922 Ga0207646_10001735 Ga0207646_1000173522 239
500 3300025927 Ga0207687_10070193 Ga0207687_100701933 239
501 3300025934 Ga0207686_10006122 Ga0207686_100061224 239
502 3300025935 Ga0207709_10005662 Ga0207709_100056626 239
503 3300025937 Ga0207669_10019949 Ga0207669_100199494 239
504 3300026095 Ga0207676_10342554 Ga0207676_103425542 239
505 3300026118 Ga0207675_100180571 Ga0207675_1001805713 239
506 3300046528 Ga0495642_0021627 Ga0495642_0021627_1143_2024 239
507 3300048903 Ga0496100_0028955 Ga0496100_0028955_2232_3113 239
508 3300048905 Ga0496102_0604232 Ga0496102_0604232_111_992 239
509 3300048909 Ga0496106_0049171 Ga0496106_0049171_545_1426 239
510 3300049743 Ga0501081_0008923 Ga0501081_0008923_3823_4677 239
511 3300050512 nmdc:mga0n895_3044_c1 nmdc:mga0n895_3044_c1_870_1754 239
512 3300050513 nmdc:mga0rr50_509810_c1 nmdc:mga0rr50_509810_c1_92_976 239
513 3300050513 nmdc:mga0rr50_604_c1 nmdc:mga0rr50_604_c1_16216_17100 239
514 3300050515 nmdc:mga0a205_473_c2 nmdc:mga0a205_473_c2_6601_7485 239
515 3300005356 Ga0070674_100014459 Ga0070674_1000144592 241
516 3300005438 Ga0070701_10030104 Ga0070701_100301041 241
517 3300005441 Ga0070700_100083013 Ga0070700_1000830133 241
518 3300005615 Ga0070702_100050060 Ga0070702_1000500602 241
519 3300005841 Ga0068863_100201056 Ga0068863_1002010562 241
520 3300006881 Ga0068865_100144748 Ga0068865_1001447482 241
521 3300009176 Ga0105242_10018547 Ga0105242_100185478 241
522 3300011119 Ga0105246_10019100 Ga0105246_100191008 241
523 3300014968 Ga0157379_10245756 Ga0157379_102457563 241
524 3300025933 Ga0207706_10247636 Ga0207706_102476362 241
525 3300025938 Ga0207704_10014925 Ga0207704_100149257 241
526 3300026075 Ga0207708_10038988 Ga0207708_100389883 241
527 3300026089 Ga0207648_10255980 Ga0207648_102559803 241
528 3300026118 Ga0207675_100045091 Ga0207675_1000450917 241
529 3300028381 Ga0268264_10139987 Ga0268264_101399872 241
530 3300049568 Ga0501031_0034345 Ga0501031_0034345_1027_1896 241
531 3300049569 Ga0501032_0040950 Ga0501032_0040950_1516_2385 241
532 3300049570 Ga0501033_0206535 Ga0501033_0206535_273_1142 241
533 3300049574 Ga0501038_0010005 Ga0501038_0010005_1381_2250 241
534 3300049579 Ga0501043_0023356 Ga0501043_0023356_3549_4418 241
535 3300049581 Ga0501047_0003445 Ga0501047_0003445_8560_9429 241
536 3300049582 Ga0501048_0000032 Ga0501048_0000032_6505_7374 241
537 3300049586 Ga0501070_0023260 Ga0501070_0023260_43_912 241
538 3300049822 Ga0501035_0096772 Ga0501035_0096772_229_1098 241
539 3300005327 Ga0070658_10045555 Ga0070658_100455552 243
540 3300005329 Ga0070683_100318991 Ga0070683_1003189912 243
541 3300005563 Ga0068855_100578170 Ga0068855_1005781701 243
542 3300013105 Ga0157369_10688921 Ga0157369_106889211 243
543 3300020081 Ga0206354_11315905 Ga0206354_113159052 243
544 3300020082 Ga0206353_10430970 Ga0206353_104309702 243
545 3300025909 Ga0207705_10149457 Ga0207705_101494572 243
546 3300025944 Ga0207661_10227850 Ga0207661_102278502 243
547 3300025949 Ga0207667_10101307 Ga0207667_101013072 243
548 3300026067 Ga0207678_10266992 Ga0207678_102669922 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

284

0.8

Feature Viewer

pLDDT pTM Quality
50.05 0.29 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map