F462175

General Info

Members Datasets Scaffolds Average Seq Length
547 300 543 414

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8002060224|8002062780
Length 408
Sequence SQYTPKSGFARWLERRLPIISFMYDSFVAYPTPKNLNYMWTFGAILSFMLVAQIVTGVVLAMHYTGETTLAFDSVEKIMRDVNWGWALRYAHANGASMFFLAVYLHIFRGMYYGSYKEPREVLWILGVLIFMVMMATGFLGYVLPWGQMSFWAATVITNLFSAIPVVGTSITTWLLGGYSVDNPTLNRFFALHYLLPFIIVAIVALHVWALHVTGQNNPTGVEVKDVEKDTVPFTPYATLKDGFAIGAFLVLYAWMMFFVPNYLGHPDNYIEANPLVTPPHIVPEWYFLPFYAILRAIPNKLLGVIALFLSILITMALPWLDTSKVKSGSFRPLFRKFYWVFVAVCVGLGYLGAQPAEGVYLWLARIFSFYYFLHFIVILPWLGKVEKTEPVPESIDAAVATGKTAHA

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
290 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
298 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
299 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
300 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.37
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0.37
Rhizoplane 10.42
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10005587 3300001991 Bacteria 2105
2 JGI24744J21845_10003568 3300002077 Bacteria 3204
3 JGI24742J22300_10001968 3300002244 Bacteria 3274
4 JGI25404J52841_10017804 3300003659 Bacteria 1540
5 Ga0070658_10084403 3300005327 Bacteria 2611
6 Ga0070676_10079079 3300005328 Bacteria 1990
7 Ga0070683_100018759 3300005329 Bacteria 6132
8 Ga0070690_100029551 3300005330 Bacteria 3400
9 Ga0070690_100110980 3300005330 Bacteria 1830
10 Ga0070670_100018796 3300005331 Bacteria 5924
11 Ga0068869_100011719 3300005334 Bacteria 5762
12 Ga0070680_100036181 3300005336 Bacteria 3988
13 Ga0070680_100087683 3300005336 Bacteria 2574
14 Ga0070682_100002926 3300005337 Bacteria 9474
15 Ga0068868_100003444 3300005338 Bacteria 11016
16 Ga0070660_100024271 3300005339 Bacteria 4499
17 Ga0070660_100029661 3300005339 Bacteria 4101
18 Ga0070689_100019008 3300005340 Bacteria 5074
19 Ga0070689_100046232 3300005340 Bacteria 3353
20 Ga0070691_10009143 3300005341 Bacteria 4530
21 Ga0070691_10084011 3300005341 Bacteria 1563
22 Ga0070661_100019314 3300005344 Bacteria 4858
23 Ga0070661_100042144 3300005344 Bacteria 3331
24 Ga0070675_100027856 3300005354 Bacteria 4542
25 Ga0070671_100047340 3300005355 Bacteria 3576
26 Ga0070674_100074332 3300005356 Bacteria 2412
27 Ga0070673_100028130 3300005364 Bacteria 4177
28 Ga0070673_100039440 3300005364 Bacteria 3614
29 Ga0070688_100001644 3300005365 Bacteria 11176
30 Ga0070667_100007711 3300005367 Bacteria 8923
31 Ga0070667_100044956 3300005367 Bacteria 3711
32 Ga0070667_100055501 3300005367 Bacteria 3345
33 Ga0070709_10061333 3300005434 Bacteria 2393
34 Ga0070714_100014321 3300005435 Bacteria 6368
35 Ga0070714_100035612 3300005435 Bacteria 4172
36 Ga0070714_100149488 3300005435 Bacteria 2103
37 Ga0070713_100005212 3300005436 Bacteria 8855
38 Ga0070713_100006459 3300005436 Bacteria 8129
39 Ga0070713_100017355 3300005436 Bacteria 5441
40 Ga0070713_100046367 3300005436 Bacteria 3566
41 Ga0070710_10002248 3300005437 Bacteria 9140
42 Ga0070710_10028267 3300005437 Bacteria 2998
43 Ga0070710_10050836 3300005437 Bacteria 2325
44 Ga0070710_10073263 3300005437 Bacteria 1980
45 Ga0070711_100066360 3300005439 Bacteria 2527
46 Ga0070711_100077494 3300005439 Bacteria 2359
47 Ga0070711_100096139 3300005439 Bacteria 2145
48 Ga0070663_100034853 3300005455 Bacteria 3488
49 Ga0070663_100046367 3300005455 Bacteria 3075
50 Ga0070662_100020307 3300005457 Bacteria 4522
51 Ga0070681_10011624 3300005458 Bacteria 8716
52 Ga0070681_10189413 3300005458 Bacteria 1977
53 Ga0068867_100072228 3300005459 Bacteria 2582
54 Ga0070685_10019724 3300005466 Bacteria 3642
55 Ga0070699_100147036 3300005518 Bacteria 2082
56 Ga0070679_100004048 3300005530 Bacteria 13502
57 Ga0070679_100052885 3300005530 Bacteria 4043
58 Ga0070679_100124521 3300005530 Bacteria 2560
59 Ga0070684_100204539 3300005535 Bacteria 1799
60 Ga0068853_100036354 3300005539 Bacteria 4187
61 Ga0070672_100048185 3300005543 Bacteria 3310
62 Ga0070686_100001797 3300005544 Bacteria 11965
63 Ga0070686_100045875 3300005544 Bacteria 2754
64 Ga0070696_100011191 3300005546 Bacteria 6005
65 Ga0070696_100016750 3300005546 Bacteria 4943
66 Ga0070693_100041471 3300005547 Bacteria 2590
67 Ga0070693_100054700 3300005547 Bacteria 2296
68 Ga0070665_100004366 3300005548 Bacteria 14875
69 Ga0070665_100166436 3300005548 Bacteria 2207
70 Ga0070704_100038056 3300005549 Bacteria 3292
71 Ga0070704_100039134 3300005549 Bacteria 3253
72 Ga0068855_100038780 3300005563 Bacteria 5659
73 Ga0068855_100214351 3300005563 Bacteria 2162
74 Ga0070664_100102314 3300005564 Bacteria 2492
75 Ga0068857_100037039 3300005577 Bacteria 4321
76 Ga0068852_100089344 3300005616 Bacteria 2753
77 Ga0068852_100384538 3300005616 Bacteria 1377
78 Ga0068859_100127718 3300005617 Bacteria 2613
79 Ga0068864_100006237 3300005618 Bacteria 9780
80 Ga0068864_100038779 3300005618 Bacteria 4069
81 Ga0068861_100031847 3300005719 Bacteria 3878
82 Ga0068870_10004317 3300005840 Bacteria 6119
83 Ga0068863_100103754 3300005841 Bacteria 2705
84 Ga0068858_100182848 3300005842 Bacteria 1980
85 Ga0068860_100114683 3300005843 Bacteria 2576
86 Ga0068862_100033512 3300005844 Bacteria 4342
87 Ga0081455_10077031 3300005937 Bacteria 2745
88 Ga0081538_10042459 3300005981 Bacteria 2869
89 Ga0081538_10074143 3300005981 Bacteria 1854
90 Ga0081539_10070433 3300005985 Bacteria 1877
91 Ga0070717_10000485 3300006028 Bacteria 25249
92 Ga0070717_10007633 3300006028 Bacteria 8039
93 Ga0070717_10129106 3300006028 Bacteria 2172
94 Ga0075368_10022912 3300006042 Bacteria 2381
95 Ga0070715_10001137 3300006163 Bacteria 7597
96 Ga0070716_100001791 3300006173 Bacteria 9730
97 Ga0070712_100000210 3300006175 Bacteria 32927
98 Ga0070712_100003511 3300006175 Bacteria 9649
99 Ga0070712_100070328 3300006175 Bacteria 2500
100 Ga0070712_100077942 3300006175 Bacteria 2390
101 Ga0075367_10037533 3300006178 Bacteria 2816
102 Ga0075369_10001820 3300006186 Bacteria 7434
103 Ga0097621_100002618 3300006237 Bacteria 12322
104 Ga0097621_100102092 3300006237 Bacteria 2414
105 Ga0068871_100052848 3300006358 Bacteria 3291
106 Ga0075428_100015591 3300006844 Bacteria 8426
107 Ga0075428_100064479 3300006844 Bacteria 4012
108 Ga0075430_100019122 3300006846 Bacteria 5826
109 Ga0075431_100011101 3300006847 Bacteria 9065
110 Ga0075431_100058205 3300006847 Bacteria 3987
111 Ga0075429_100031662 3300006880 Bacteria 4596
112 Ga0068865_100006295 3300006881 Bacteria 7230
113 Ga0068865_100039589 3300006881 Bacteria 3198
114 Ga0097620_100127725 3300006931 Bacteria 2613
115 Ga0075435_100116863 3300007076 Bacteria 2222
116 Ga0105240_10070722 3300009093 Bacteria 4316
117 Ga0105245_10072617 3300009098 Bacteria 3126
118 Ga0105247_10003270 3300009101 Bacteria 10626
119 Ga0105247_10080763 3300009101 Bacteria 2049
120 Ga0105247_10096410 3300009101 Bacteria 1885
121 Ga0114129_10003714 3300009147 Bacteria 21512
122 Ga0114129_10022018 3300009147 Bacteria 9046
123 Ga0114129_10368765 3300009147 Bacteria 1898
124 Ga0105243_10002400 3300009148 Bacteria 15707
125 Ga0105243_10066168 3300009148 Bacteria 2906
126 Ga0105241_10049529 3300009174 Bacteria 3199
127 Ga0105242_10037751 3300009176 Bacteria 3882
128 Ga0105242_10075694 3300009176 Bacteria 2803
129 Ga0105242_10164879 3300009176 Bacteria 1943
130 Ga0105248_10025905 3300009177 Bacteria 6522
131 Ga0105237_10028210 3300009545 Bacteria 5721
132 Ga0105237_10050923 3300009545 Bacteria 4161
133 Ga0105238_10015699 3300009551 Bacteria 7667
134 Ga0105238_10224064 3300009551 Bacteria 1857
135 Ga0105249_10001791 3300009553 Bacteria 18701
136 Ga0105239_10254329 3300010375 Bacteria 1973
137 Ga0105239_10436077 3300010375 Bacteria 1485
138 Ga0105246_10148431 3300011119 Bacteria 1772
139 Ga0157373_10030403 3300013100 Bacteria 3887
140 Ga0157369_10175662 3300013105 Bacteria 2255
141 Ga0157375_10014879 3300013308 Bacteria 6953
142 Ga0157376_10089892 3300014969 Bacteria 2656
143 Ga0163161_10024166 3300017792 Bacteria 4292
144 Ga0209233_1005808 3300025261 Bacteria 4054
145 Ga0207673_1001874 3300025290 Bacteria 2343
146 Ga0209758_1000125 3300025297 Bacteria 189869
147 Ga0207692_10000282 3300025898 Bacteria 17493
148 Ga0207692_10001001 3300025898 Bacteria 10294
149 Ga0207692_10084992 3300025898 Bacteria 1701
150 Ga0207710_10000382 3300025900 Bacteria 30360
151 Ga0207710_10013007 3300025900 Bacteria 3506
152 Ga0207688_10001072 3300025901 Bacteria 13993
153 Ga0207688_10040179 3300025901 Bacteria 2599
154 Ga0207680_10108155 3300025903 Bacteria 1798
155 Ga0207685_10000553 3300025905 Bacteria 6461
156 Ga0207699_10002836 3300025906 Bacteria 8208
157 Ga0207699_10049073 3300025906 Bacteria 2483
158 Ga0207645_10005025 3300025907 Bacteria 9692
159 Ga0207645_10021816 3300025907 Bacteria 4171
160 Ga0207643_10000532 3300025908 Bacteria 24445
161 Ga0207705_10022789 3300025909 Bacteria 4466
162 Ga0207705_10032515 3300025909 Bacteria 3728
163 Ga0207705_10257027 3300025909 Bacteria 1333
164 Ga0207707_10017073 3300025912 Bacteria 6323
165 Ga0207671_10047853 3300025914 Bacteria 3165
166 Ga0207693_10001038 3300025915 Bacteria 24865
167 Ga0207693_10002870 3300025915 Bacteria 14928
168 Ga0207693_10009669 3300025915 Bacteria 7851
169 Ga0207693_10018607 3300025915 Bacteria 5530
170 Ga0207693_10092949 3300025915 Bacteria 2364
171 Ga0207663_10001206 3300025916 Bacteria 11940
172 Ga0207660_10018800 3300025917 Bacteria 4612
173 Ga0207660_10056057 3300025917 Bacteria 2819
174 Ga0207662_10009678 3300025918 Bacteria 5313
175 Ga0207657_10019049 3300025919 Bacteria 6529
176 Ga0207657_10151507 3300025919 Bacteria 1888
177 Ga0207657_10151590 3300025919 Bacteria 1888
178 Ga0207649_10030680 3300025920 Bacteria 3187
179 Ga0207649_10092658 3300025920 Bacteria 1981
180 Ga0207652_10010940 3300025921 Bacteria 7315
181 Ga0207652_10013318 3300025921 Bacteria 6659
182 Ga0207652_10023345 3300025921 Bacteria 5123
183 Ga0207652_10074771 3300025921 Bacteria 2950
184 Ga0207694_10153349 3300025924 Bacteria 1857
185 Ga0207650_10027646 3300025925 Bacteria 4062
186 Ga0207687_10003333 3300025927 Bacteria 10848
187 Ga0207687_10047883 3300025927 Bacteria 2965
188 Ga0207687_10076123 3300025927 Bacteria 2410
189 Ga0207700_10000848 3300025928 Bacteria 17629
190 Ga0207700_10182925 3300025928 Bacteria 1756
191 Ga0207664_10016622 3300025929 Bacteria 5373
192 Ga0207664_10097444 3300025929 Bacteria 2423
193 Ga0207664_10121845 3300025929 Bacteria 2184
194 Ga0207664_10305949 3300025929 Bacteria 1399
195 Ga0207644_10004451 3300025931 Bacteria 9099
196 Ga0207644_10007818 3300025931 Bacteria 6985
197 Ga0207644_10157990 3300025931 Bacteria 1760
198 Ga0207706_10017396 3300025933 Bacteria 6476
199 Ga0207706_10025352 3300025933 Bacteria 5313
200 Ga0207686_10017724 3300025934 Bacteria 4017
201 Ga0207686_10063530 3300025934 Bacteria 2348
202 Ga0207709_10093252 3300025935 Bacteria 1974
203 Ga0207670_10083083 3300025936 Bacteria 2245
204 Ga0207665_10001067 3300025939 Bacteria 18428
205 Ga0207665_10052160 3300025939 Bacteria 2755
206 Ga0207691_10033565 3300025940 Bacteria 4778
207 Ga0207691_10055128 3300025940 Bacteria 3625
208 Ga0207691_10056243 3300025940 Bacteria 3584
209 Ga0207711_10007738 3300025941 Bacteria 8978
210 Ga0207711_10038083 3300025941 Bacteria 4088
211 Ga0207689_10009477 3300025942 Bacteria 8407
212 Ga0207661_10020016 3300025944 Bacteria 4997
213 Ga0207679_10202443 3300025945 Bacteria 1659
214 Ga0207667_10104307 3300025949 Bacteria 2924
215 Ga0207667_10222832 3300025949 Bacteria 1932
216 Ga0207667_10232569 3300025949 Bacteria 1887
217 Ga0207712_10009741 3300025961 Bacteria 6089
218 Ga0207712_10012784 3300025961 Bacteria 5368
219 Ga0207712_10157337 3300025961 Bacteria 1762
220 Ga0207658_10051684 3300025986 Bacteria 3029
221 Ga0207658_10185221 3300025986 Bacteria 1726
222 Ga0207677_10009973 3300026023 Bacteria 5359
223 Ga0207703_10060233 3300026035 Bacteria 3103
224 Ga0207703_10103730 3300026035 Bacteria 2415
225 Ga0207639_10109903 3300026041 Bacteria 2244
226 Ga0207678_10012502 3300026067 Bacteria 7455
227 Ga0207678_10020636 3300026067 Bacteria 5775
228 Ga0207678_10022685 3300026067 Bacteria 5497
229 Ga0207641_10083300 3300026088 Bacteria 2781
230 Ga0207648_10017715 3300026089 Bacteria 6468
231 Ga0207648_10175651 3300026089 Bacteria 1894
232 Ga0207648_10212812 3300026089 Bacteria 1716
233 Ga0207676_10029909 3300026095 Bacteria 4082
234 Ga0207676_10036592 3300026095 Bacteria 3735
235 Ga0207676_10119170 3300026095 Bacteria 2222
236 Ga0207683_10002044 3300026121 Bacteria 17862
237 Ga0207683_10015976 3300026121 Bacteria 6388
238 Ga0207683_10038330 3300026121 Bacteria 4176
239 Ga0207698_10112075 3300026142 Bacteria 2289
240 Ga0209813_10005167 3300027866 Bacteria 3155
241 Ga0207428_10016365 3300027907 Bacteria 6381
242 Ga0268266_10003041 3300028379 Bacteria 17192
243 Ga0268264_10143937 3300028381 Bacteria 2129
244 Ga0265338_10045366 3300028800 Bacteria 4043
245 Ga0265328_10013276 3300031239 Bacteria 3265
246 Ga0265325_10002557 3300031241 Bacteria 12236
247 Ga0265325_10007571 3300031241 Bacteria 6492
248 Ga0265325_10017995 3300031241 Bacteria 3922
249 Ga0265340_10008097 3300031247 Bacteria 5688
250 Ga0265340_10018636 3300031247 Bacteria 3579
251 Ga0265340_10069458 3300031247 Bacteria 1672
252 Ga0265339_10002691 3300031249 Bacteria 12639
253 Ga0265339_10010435 3300031249 Bacteria 5770
254 Ga0265339_10031384 3300031249 Bacteria 3003
255 Ga0265331_10000007 3300031250 Bacteria 331074
256 Ga0265331_10019203 3300031250 Bacteria 3532
257 Ga0265313_10000024 3300031595 Bacteria 138587
258 Ga0265313_10012737 3300031595 Bacteria 5107
259 Ga0265313_10021608 3300031595 Bacteria 3515
260 Ga0265314_10026356 3300031711 Bacteria 4368
261 Ga0265314_10047644 3300031711 Bacteria 3014
262 Ga0265342_10000308 3300031712 Bacteria 55378
263 Ga0265342_10015560 3300031712 Bacteria 5000
264 Ga0265342_10032199 3300031712 Bacteria 3235
265 Ga0316576_10021856 3300031727 Bacteria 4433
266 Ga0373926_0036465 3300035083 Bacteria 1747
267 Ga0373934_0030633 3300035086 Bacteria 2104
268 Ga0373944_0006095 3300035089 Bacteria 3194
269 Ga0373944_0008802 3300035089 Bacteria 2728
270 Ga0373944_0030517 3300035089 Bacteria 1617
271 Ga0373932_0013891 3300035112 Bacteria 2014
272 Ga0373945_0008779 3300035116 Bacteria 3300
273 Ga0373954_0007702 3300035118 Bacteria 4714
274 Ga0373956_0020289 3300035119 Bacteria 2826
275 Ga0373943_0000094 3300035170 Bacteria 32911
276 Ga0373943_0000755 3300035170 Bacteria 14106
277 Ga0373943_0015446 3300035170 Bacteria 3468
278 Ga0373946_0002372 3300035171 Bacteria 6661
279 Ga0373946_0004314 3300035171 Bacteria 5083
280 Ga0373955_0014577 3300035172 Bacteria 3827
281 Ga0316574_0051165 3300035398 Bacteria 2574
282 Ga0373935_0000839 3300035692 Bacteria 16556
283 Ga0373935_0008117 3300035692 Bacteria 6292
284 Ga0373935_0017748 3300035692 Bacteria 4322
285 Ga0373935_0113625 3300035692 Bacteria 1800
286 Ga0373927_0000113 3300035695 Bacteria 60608
287 Ga0373927_0013337 3300035695 Bacteria 5463
288 Ga0373927_0026560 3300035695 Bacteria 3784
289 Ga0373933_0019753 3300035724 Bacteria 3811
290 Ga0373947_0000225 3300035725 Bacteria 31624
291 Ga0373947_0002417 3300035725 Bacteria 11265
292 Ga0373947_0035669 3300035725 Bacteria 2945
293 Ga0373937_0000655 3300036401 Bacteria 30381
294 Ga0373937_0010077 3300036401 Bacteria 8239
295 Ga0373925_0002349 3300037068 Bacteria 15193
296 Ga0373925_0020265 3300037068 Bacteria 4839
297 Ga0395898_0063839 3300037466 Bacteria 3573
298 Ga0395901_0072385 3300038443 Bacteria 3593
299 Ga0436365_0984369 3300039437 Bacteria 2354
300 Ga0436363_1614455 3300039450 Bacteria 3084
301 Ga0466967_0056493 3300045976 Bacteria 3461
302 Ga0495592_0022676 3300046454 Bacteria 4775
303 Ga0495603_0027048 3300046455 Bacteria 3464
304 Ga0495629_0001465 3300046459 Bacteria 18592
305 Ga0495629_0049761 3300046459 Bacteria 2937
306 Ga0495638_0043638 3300046460 Bacteria 2828
307 Ga0495641_0027508 3300046461 Bacteria 2765
308 Ga0495641_0050403 3300046461 Bacteria 1903
309 Ga0495651_0002003 3300046462 Bacteria 15754
310 Ga0495651_0019031 3300046462 Bacteria 5320
311 Ga0495653_0016626 3300046463 Bacteria 5988
312 Ga0495653_0050830 3300046463 Bacteria 3186
313 Ga0495580_0007886 3300046472 Bacteria 8520
314 Ga0495582_0000570 3300046473 Bacteria 20403
315 Ga0495582_0010583 3300046473 Bacteria 5075
316 Ga0495582_0096640 3300046473 Bacteria 1651
317 Ga0495639_0023630 3300046475 Bacteria 2703
318 Ga0495662_0011404 3300046476 Bacteria 4343
319 Ga0495664_0001903 3300046477 Bacteria 11108
320 Ga0495584_0004635 3300046491 Bacteria 7372
321 Ga0495584_0076237 3300046491 Bacteria 1686
322 Ga0495608_0000428 3300046511 Bacteria 29274
323 Ga0495608_0132505 3300046511 Bacteria 1594
324 Ga0495618_0019088 3300046514 Bacteria 4216
325 Ga0495618_0024226 3300046514 Bacteria 3756
326 Ga0495618_0046862 3300046514 Bacteria 2728
327 Ga0495628_0050036 3300046516 Bacteria 3306
328 Ga0495630_0001809 3300046517 Bacteria 14917
329 Ga0495630_0043185 3300046517 Bacteria 3366
330 Ga0495652_0039202 3300046529 Bacteria 4097
331 Ga0495652_0050357 3300046529 Bacteria 3561
332 Ga0495652_0052790 3300046529 Bacteria 3465
333 Ga0495652_0165897 3300046529 Bacteria 1709
334 Ga0495665_0005525 3300046531 Bacteria 6810
335 Ga0495640_0000544 3300046533 Bacteria 27687
336 Ga0495640_0021118 3300046533 Bacteria 4784
337 Ga0495586_0022733 3300046535 Bacteria 3346
338 Ga0495587_0016789 3300046536 Bacteria 4551
339 Ga0495598_0005675 3300046537 Bacteria 2781
340 Ga0495645_0002211 3300046543 Bacteria 13235
341 Ga0495645_0042138 3300046543 Bacteria 3328
342 Ga0495645_0064173 3300046543 Bacteria 2658
343 Ga0495667_0003621 3300046559 Bacteria 10387
344 Ga0495667_0027524 3300046559 Bacteria 3830
345 Ga0495667_0031716 3300046559 Bacteria 3544
346 Ga0495656_0002309 3300046615 Bacteria 6305
347 Ga0495634_0005346 3300046642 Bacteria 9897
348 Ga0495634_0007670 3300046642 Bacteria 8079
349 Ga0495634_0018772 3300046642 Bacteria 4917
350 Ga0495634_0035163 3300046642 Bacteria 3433
351 Ga0495635_0004288 3300046663 Bacteria 9872
352 Ga0495635_0013102 3300046663 Bacteria 5805
353 Ga0495635_0074352 3300046663 Bacteria 2328
354 Ga0495661_0103213 3300046665 Bacteria 1601
355 Ga0495657_0005238 3300046675 Bacteria 10267
356 Ga0495599_0079646 3300046678 Bacteria 2045
357 Ga0495623_0001886 3300046679 Bacteria 14077
358 Ga0495646_0025341 3300046680 Bacteria 3730
359 Ga0495658_0000237 3300046683 Bacteria 31696
360 Ga0495613_0040596 3300046689 Bacteria 3448
361 Ga0495624_0001669 3300046690 Bacteria 17009
362 Ga0495624_0113906 3300046690 Bacteria 1662
363 Ga0495600_0014425 3300046809 Bacteria 4981
364 Ga0495600_0078742 3300046809 Bacteria 2152
365 Ga0495581_0005953 3300047315 Bacteria 7069
366 Ga0495581_0008178 3300047315 Bacteria 6059
367 Ga0495581_0024707 3300047315 Bacteria 3483
368 Ga0495604_0005688 3300047317 Bacteria 9886
369 Ga0495674_0004754 3300047319 Bacteria 13054
370 Ga0495676_0036451 3300047321 Bacteria 4107
371 Ga0495676_0046516 3300047321 Bacteria 3520
372 Ga0495680_0028094 3300047322 Bacteria 4615
373 Ga0495680_0037561 3300047322 Bacteria 3878
374 Ga0495675_0015295 3300047444 Bacteria 4852
375 Ga0495675_0079174 3300047444 Bacteria 2070
376 Ga0495684_0000845 3300047471 Bacteria 24740
377 Ga0495684_0001394 3300047471 Bacteria 19398
378 Ga0495684_0003192 3300047471 Bacteria 12855
379 Ga0495684_0010217 3300047471 Bacteria 7261
380 Ga0495684_0100731 3300047471 Bacteria 2184
381 Ga0495593_0011906 3300047673 Bacteria 4988
382 Ga0495602_0031564 3300048088 Bacteria 5006
383 Ga0495602_0089232 3300048088 Bacteria 2564
384 Ga0495614_0073058 3300048089 Bacteria 1480
385 Ga0496100_0001216 3300048903 Bacteria 12519
386 Ga0496100_0021655 3300048903 Bacteria 3876
387 Ga0496100_0025187 3300048903 Bacteria 3636
388 Ga0496100_0103975 3300048903 Bacteria 1962
389 Ga0496100_0117936 3300048903 Bacteria 1853
390 Ga0496100_0181938 3300048903 Bacteria 1520
391 Ga0496101_0004012 3300048904 Bacteria 9205
392 Ga0496101_0006778 3300048904 Bacteria 7386
393 Ga0496101_0055005 3300048904 Bacteria 2873
394 Ga0496102_0002614 3300048905 Bacteria 15316
395 Ga0496102_0014685 3300048905 Bacteria 6806
396 Ga0496102_0084329 3300048905 Bacteria 2932
397 Ga0496102_0095094 3300048905 Bacteria 2761
398 Ga0496103_0013950 3300048906 Bacteria 4770
399 Ga0496103_0059443 3300048906 Bacteria 2374
400 Ga0496103_0127970 3300048906 Bacteria 1620
401 Ga0496104_0013150 3300048907 Bacteria 7460
402 Ga0496104_0020052 3300048907 Bacteria 6124
403 Ga0496105_0003019 3300048908 Bacteria 12365
404 Ga0496105_0004200 3300048908 Bacteria 10816
405 Ga0496105_0007082 3300048908 Bacteria 8644
406 Ga0496105_0058186 3300048908 Bacteria 3190
407 Ga0496106_0019804 3300048909 Bacteria 4989
408 Ga0496106_0020054 3300048909 Bacteria 4958
409 Ga0496106_0023744 3300048909 Bacteria 4556
410 Ga0496106_0083459 3300048909 Bacteria 2457
411 Ga0496107_0000684 3300048910 Bacteria 19232
412 Ga0496107_0006620 3300048910 Bacteria 7978
413 Ga0496107_0025948 3300048910 Bacteria 4152
414 Ga0496107_0041675 3300048910 Bacteria 3297
415 Ga0496108_0000951 3300048911 Bacteria 22499
416 Ga0496108_0002201 3300048911 Bacteria 15605
417 Ga0496108_0009284 3300048911 Bacteria 7960
418 Ga0496108_0058555 3300048911 Bacteria 3238
419 Ga0496108_0167991 3300048911 Bacteria 1897
420 Ga0496109_0001009 3300048912 Bacteria 23256
421 Ga0496109_0084442 3300048912 Bacteria 2930
422 Ga0496109_0085264 3300048912 Bacteria 2915
423 Ga0496109_0090637 3300048912 Bacteria 2827
424 Ga0496109_0098100 3300048912 Bacteria 2716
425 Ga0496110_0003093 3300048913 Bacteria 12626
426 Ga0496110_0020044 3300048913 Bacteria 5638
427 Ga0496111_0034287 3300048914 Bacteria 3623
428 Ga0496111_0052146 3300048914 Bacteria 2953
429 Ga0496111_0056107 3300048914 Bacteria 2850
430 Ga0496112_0076740 3300048915 Bacteria 3304
431 Ga0496112_0216524 3300048915 Bacteria 1871
432 Ga0496113_0000043 3300048916 Bacteria 52544
433 Ga0496113_0003867 3300048916 Bacteria 9067
434 Ga0496113_0017064 3300048916 Bacteria 5031
435 Ga0496114_0061734 3300048917 Bacteria 3135
436 Ga0496114_0085439 3300048917 Bacteria 2672
437 Ga0496114_0100059 3300048917 Bacteria 2473
438 Ga0496114_0109895 3300048917 Bacteria 2361
439 Ga0496115_0002647 3300048918 Bacteria 12855
440 Ga0496115_0044829 3300048918 Bacteria 3529
441 Ga0496115_0156986 3300048918 Bacteria 1879
442 Ga0501031_0183274 3300049568 Bacteria 1367
443 Ga0501032_0019495 3300049569 Bacteria 4744
444 Ga0501032_0023041 3300049569 Bacteria 4310
445 Ga0501032_0023660 3300049569 Bacteria 4241
446 Ga0501033_0024781 3300049570 Bacteria 4524
447 Ga0501033_0049607 3300049570 Bacteria 3115
448 Ga0501034_0030962 3300049571 Bacteria 5437
449 Ga0501034_0168174 3300049571 Bacteria 2160
450 Ga0501034_0341086 3300049571 Bacteria 1428
451 Ga0501037_0001926 3300049573 Bacteria 15044
452 Ga0501037_0129631 3300049573 Bacteria 1809
453 Ga0501038_0008341 3300049574 Bacteria 9534
454 Ga0501038_0015163 3300049574 Bacteria 7011
455 Ga0501038_0043600 3300049574 Bacteria 3900
456 Ga0501038_0054502 3300049574 Bacteria 3439
457 Ga0501039_0061278 3300049575 Bacteria 2914
458 Ga0501039_0115703 3300049575 Bacteria 2099
459 Ga0501039_0119878 3300049575 Bacteria 2061
460 Ga0501039_0152031 3300049575 Bacteria 1818
461 Ga0501040_0056944 3300049576 Bacteria 2683
462 Ga0501042_0117893 3300049578 Bacteria 1911
463 Ga0501043_0062378 3300049579 Bacteria 2926
464 Ga0501046_0072281 3300049580 Bacteria 2678
465 Ga0501047_0005812 3300049581 Bacteria 11612
466 Ga0501047_0008309 3300049581 Bacteria 9796
467 Ga0501047_0012173 3300049581 Bacteria 8143
468 Ga0501047_0025783 3300049581 Bacteria 5653
469 Ga0501047_0048363 3300049581 Bacteria 4107
470 Ga0501047_0124762 3300049581 Bacteria 2455
471 Ga0501048_0020472 3300049582 Bacteria 4848
472 Ga0501048_0042917 3300049582 Bacteria 3237
473 Ga0501067_0044033 3300049583 Bacteria 2480
474 Ga0501067_0051420 3300049583 Bacteria 2284
475 Ga0501069_0111838 3300049585 Bacteria 1556
476 Ga0501070_0000711 3300049586 Bacteria 30493
477 Ga0501070_0153785 3300049586 Bacteria 1897
478 Ga0501071_0079291 3300049587 Bacteria 2400
479 Ga0501072_0083503 3300049588 Bacteria 2532
480 Ga0501073_0010479 3300049589 Bacteria 6795
481 Ga0501074_0003367 3300049590 Bacteria 11324
482 Ga0501075_0010328 3300049591 Bacteria 6562
483 Ga0501076_0012077 3300049592 Bacteria 6454
484 Ga0501077_0036486 3300049593 Bacteria 3132
485 Ga0501079_0002511 3300049741 Bacteria 13328
486 Ga0501080_0003552 3300049742 Bacteria 13734
487 Ga0501080_0097341 3300049742 Bacteria 2732
488 Ga0501081_0048155 3300049743 Bacteria 2933
489 Ga0501081_0083382 3300049743 Bacteria 2241
490 Ga0501083_0006722 3300049744 Bacteria 8158
491 Ga0501083_0022562 3300049744 Bacteria 4368
492 Ga0501035_0000703 3300049822 Bacteria 36519
493 Ga0501035_0014587 3300049822 Bacteria 7252
494 Ga0501035_0049523 3300049822 Bacteria 3764
495 Ga0501035_0127957 3300049822 Bacteria 2216
496 Ga0501044_0028947 3300049823 Bacteria 5843
497 Ga0501044_0121715 3300049823 Bacteria 2609
498 Ga0501044_0121965 3300049823 Bacteria 2606
499 nmdc:mga03683_30630_c1 3300050489 Bacteria 2154
500 nmdc:mga03n38_2071_c1 3300050490 Bacteria 6067
501 nmdc:mga00v17_31265_c1 3300050491 Bacteria 3139
502 nmdc:mga07m45_6408_c1 3300050496 Bacteria 5945
503 nmdc:mga07m45_84719_c1 3300050496 Bacteria 1812
504 nmdc:mga05p37_41838_c1 3300050507 Bacteria 5627
505 nmdc:mga05p37_43225_c1 3300050507 Bacteria 5542
506 nmdc:mga09592_18241_c1 3300050508 Bacteria 5755
507 nmdc:mga0qj67_160269_c1 3300050509 Bacteria 1826
508 nmdc:mga06r32_174494_c1 3300050510 Bacteria 2134
509 nmdc:mga06r32_2356_c1 3300050510 Bacteria 16928
510 nmdc:mga08y16_15821_c1 3300050511 Bacteria 7931
511 nmdc:mga0n895_100862_c1 3300050512 Bacteria 2896
512 nmdc:mga0n895_18802_c1 3300050512 Bacteria 6404
513 nmdc:mga0n895_71839_c1 3300050512 Bacteria 3432
514 nmdc:mga0rr50_52293_c1 3300050513 Bacteria 3035
515 nmdc:mga0a205_38544_c1 3300050515 Bacteria 2185
516 nmdc:mga0sz30_8432_c1 3300050516 Bacteria 3893
517 Ga0495601_0001735 3300053077 Bacteria 12053
518 Ga0495601_0002251 3300053077 Bacteria 10878
519 Ga0495601_0005410 3300053077 Bacteria 7433
520 Ga0495601_0038330 3300053077 Bacteria 2997
521 Ga0495612_0001270 3300053078 Bacteria 10413
522 Ga0495612_0001801 3300053078 Bacteria 8769
523 Ga0495612_0017394 3300053078 Bacteria 2879
524 Ga0495612_0021406 3300053078 Bacteria 2594
525 Ga0495655_0020855 3300053083 Bacteria 1475
526 Ga0495595_0000574 3300053084 Bacteria 14080
527 Ga0495595_0000589 3300053084 Bacteria 13861
528 Ga0495595_0009133 3300053084 Bacteria 4095
529 Ga0495619_0000484 3300053085 Bacteria 26647
530 Ga0495619_0011487 3300053085 Bacteria 5582
531 Ga0495619_0019731 3300053085 Bacteria 4289
532 Ga0495619_0021211 3300053085 Bacteria 4145
533 Ga0495619_0055908 3300053085 Bacteria 2615
534 Ga0495619_0069641 3300053085 Bacteria 2352
535 Ga0500651_0001643 3300053093 Bacteria 11381
536 Ga0500555_004279 3300053103 Bacteria 4062
537 Ga0500658_0076590 3300053134 Bacteria 1422
538 Ga0500568_0000004 3300053139 Bacteria 621666
539 Ga0501084_0009761 3300054114 Bacteria 7936
540 Ga0587077_004290 3300059493 Bacteria 1862
541 Ga0587111_0008496 3300060346 Bacteria 1704
542 Ga0501082_0004331 3300060353 Bacteria 12413
543 Ga0530510_0036553 3300061734 Bacteria 3540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0025187 Ga0496100_0025187_102_1202 366
2 3300048912 Ga0496109_0098100 Ga0496109_0098100_22_1122 366
3 iso_pu_bacteria 8016566248 8016571473 367
4 3300047444 Ga0495675_0079174 Ga0495675_0079174_949_2058 368
5 3300046473 Ga0495582_0096640 Ga0495582_0096640_526_1641 370
6 3300003659 JGI25404J52841_10017804 JGI25404J52841_100178041 382
7 3300046543 Ga0495645_0042138 Ga0495645_0042138_2150_3316 388
8 3300048912 Ga0496109_0090637 Ga0496109_0090637_100_1332 396
9 3300031239 Ga0265328_10013276 Ga0265328_100132763 403
10 iso_pu_bacteria 2643221547 2643757298 403
11 3300031241 Ga0265325_10017995 Ga0265325_100179953 404
12 3300031249 Ga0265339_10002691 Ga0265339_100026913 404
13 3300031595 Ga0265313_10000024 Ga0265313_10000024137 404
14 3300035089 Ga0373944_0008802 Ga0373944_0008802_609_1877 404
15 3300035170 Ga0373943_0000094 Ga0373943_0000094_27669_28937 404
16 3300035171 Ga0373946_0002372 Ga0373946_0002372_2797_4065 404
17 3300035692 Ga0373935_0000839 Ga0373935_0000839_12533_13801 404
18 3300035695 Ga0373927_0013337 Ga0373927_0013337_383_1651 404
19 3300035725 Ga0373947_0000225 Ga0373947_0000225_4156_5424 404
20 3300037068 Ga0373925_0002349 Ga0373925_0002349_3795_5063 404
21 3300046459 Ga0495629_0049761 Ga0495629_0049761_1007_2275 404
22 3300046476 Ga0495662_0011404 Ga0495662_0011404_947_2215 404
23 3300046514 Ga0495618_0019088 Ga0495618_0019088_1619_2887 404
24 3300046517 Ga0495630_0001809 Ga0495630_0001809_3542_4810 404
25 3300046531 Ga0495665_0005525 Ga0495665_0005525_1735_3003 404
26 3300046533 Ga0495640_0021118 Ga0495640_0021118_1849_3117 404
27 3300046642 Ga0495634_0005346 Ga0495634_0005346_6737_8005 404
28 3300046663 Ga0495635_0013102 Ga0495635_0013102_3166_4434 404
29 3300046689 Ga0495613_0040596 Ga0495613_0040596_1602_2870 404
30 3300046690 Ga0495624_0001669 Ga0495624_0001669_4756_6024 404
31 3300047315 Ga0495581_0008178 Ga0495581_0008178_2124_3392 404
32 3300047321 Ga0495676_0036451 Ga0495676_0036451_199_1467 404
33 3300047471 Ga0495684_0001394 Ga0495684_0001394_14353_15621 404
34 3300049575 Ga0501039_0061278 Ga0501039_0061278_850_2103 404
35 3300049576 Ga0501040_0056944 Ga0501040_0056944_93_1346 404
36 3300049578 Ga0501042_0117893 Ga0501042_0117893_138_1391 404
37 3300049591 Ga0501075_0010328 Ga0501075_0010328_4360_5613 404
38 3300049592 Ga0501076_0012077 Ga0501076_0012077_842_2095 404
39 3300049741 Ga0501079_0002511 Ga0501079_0002511_11238_12491 404
40 3300049742 Ga0501080_0097341 Ga0501080_0097341_627_1880 404
41 3300049743 Ga0501081_0048155 Ga0501081_0048155_889_2142 404
42 3300053085 Ga0495619_0019731 Ga0495619_0019731_320_1588 404
43 3300054114 Ga0501084_0009761 Ga0501084_0009761_6065_7318 404
44 3300060353 Ga0501082_0004331 Ga0501082_0004331_10281_11534 404
45 iso_pu_bacteria 8002060224 8002062780 405
46 3300046475 Ga0495639_0023630 Ga0495639_0023630_89_1312 406
47 3300046537 Ga0495598_0005675 Ga0495598_0005675_1055_2278 406
48 3300048903 Ga0496100_0181938 Ga0496100_0181938_217_1437 406
49 3300048911 Ga0496108_0009284 Ga0496108_0009284_344_1564 406
50 3300048917 Ga0496114_0100059 Ga0496114_0100059_383_1603 406
51 3300053083 Ga0495655_0020855 Ga0495655_0020855_185_1405 406
52 3300005327 Ga0070658_10084403 Ga0070658_100844032 407
53 3300005339 Ga0070660_100024271 Ga0070660_1000242714 407
54 3300005367 Ga0070667_100055501 Ga0070667_1000555014 407
55 3300005530 Ga0070679_100052885 Ga0070679_1000528852 407
56 3300005563 Ga0068855_100038780 Ga0068855_1000387802 407
57 3300005563 Ga0068855_100214351 Ga0068855_1002143512 407
58 3300005616 Ga0068852_100384538 Ga0068852_1003845381 407
59 3300009148 Ga0105243_10066168 Ga0105243_100661684 407
60 3300009551 Ga0105238_10015699 Ga0105238_100156997 407
61 3300025261 Ga0209233_1005808 Ga0209233_10058083 407
62 3300025907 Ga0207645_10021816 Ga0207645_100218164 407
63 3300025909 Ga0207705_10032515 Ga0207705_100325153 407
64 3300025909 Ga0207705_10257027 Ga0207705_102570271 407
65 3300025919 Ga0207657_10151507 Ga0207657_101515072 407
66 3300025919 Ga0207657_10151590 Ga0207657_101515901 407
67 3300025921 Ga0207652_10010940 Ga0207652_100109405 407
68 3300025929 Ga0207664_10097444 Ga0207664_100974443 407
69 3300025949 Ga0207667_10104307 Ga0207667_101043073 407
70 3300025949 Ga0207667_10232569 Ga0207667_102325692 407
71 3300025986 Ga0207658_10185221 Ga0207658_101852211 407
72 3300031712 Ga0265342_10000308 Ga0265342_1000030821 407
73 3300049823 Ga0501044_0028947 Ga0501044_0028947_3430_4653 407
74 3300050509 nmdc:mga0qj67_160269_c1 nmdc:mga0qj67_160269_c1_570_1793 407
75 3300005329 Ga0070683_100018759 Ga0070683_1000187593 408
76 3300005330 Ga0070690_100110980 Ga0070690_1001109802 408
77 3300005331 Ga0070670_100018796 Ga0070670_1000187965 408
78 3300005337 Ga0070682_100002926 Ga0070682_1000029264 408
79 3300005338 Ga0068868_100003444 Ga0068868_1000034446 408
80 3300005341 Ga0070691_10084011 Ga0070691_100840111 408
81 3300005344 Ga0070661_100042144 Ga0070661_1000421442 408
82 3300005356 Ga0070674_100074332 Ga0070674_1000743322 408
83 3300005364 Ga0070673_100028130 Ga0070673_1000281302 408
84 3300005367 Ga0070667_100007711 Ga0070667_10000771110 408
85 3300005367 Ga0070667_100044956 Ga0070667_1000449562 408
86 3300005436 Ga0070713_100005212 Ga0070713_1000052128 408
87 3300005436 Ga0070713_100017355 Ga0070713_1000173555 408
88 3300005437 Ga0070710_10002248 Ga0070710_100022489 408
89 3300005439 Ga0070711_100077494 Ga0070711_1000774942 408
90 3300005439 Ga0070711_100096139 Ga0070711_1000961391 408
91 3300005455 Ga0070663_100034853 Ga0070663_1000348533 408
92 3300005455 Ga0070663_100046367 Ga0070663_1000463672 408
93 3300005530 Ga0070679_100124521 Ga0070679_1001245212 408
94 3300005544 Ga0070686_100001797 Ga0070686_10000179710 408
95 3300005546 Ga0070696_100011191 Ga0070696_1000111912 408
96 3300005547 Ga0070693_100054700 Ga0070693_1000547001 408
97 3300005548 Ga0070665_100004366 Ga0070665_10000436610 408
98 3300005548 Ga0070665_100166436 Ga0070665_1001664362 408
99 3300005618 Ga0068864_100006237 Ga0068864_1000062375 408
100 3300006028 Ga0070717_10007633 Ga0070717_100076334 408
101 3300006173 Ga0070716_100001791 Ga0070716_1000017914 408
102 3300006175 Ga0070712_100003511 Ga0070712_10000351111 408
103 3300006237 Ga0097621_100002618 Ga0097621_1000026188 408
104 3300006358 Ga0068871_100052848 Ga0068871_1000528483 408
105 3300006881 Ga0068865_100006295 Ga0068865_1000062956 408
106 3300007076 Ga0075435_100116863 Ga0075435_1001168632 408
107 3300009093 Ga0105240_10070722 Ga0105240_100707225 408
108 3300009101 Ga0105247_10096410 Ga0105247_100964101 408
109 3300009147 Ga0114129_10003714 Ga0114129_100037142 408
110 3300009148 Ga0105243_10002400 Ga0105243_100024005 408
111 3300009176 Ga0105242_10037751 Ga0105242_100377513 408
112 3300009545 Ga0105237_10028210 Ga0105237_100282105 408
113 3300009545 Ga0105237_10050923 Ga0105237_100509234 408
114 3300009551 Ga0105238_10224064 Ga0105238_102240642 408
115 3300010375 Ga0105239_10254329 Ga0105239_102543292 408
116 3300011119 Ga0105246_10148431 Ga0105246_101484312 408
117 3300013105 Ga0157369_10175662 Ga0157369_101756622 408
118 3300013308 Ga0157375_10014879 Ga0157375_100148792 408
119 3300014969 Ga0157376_10089892 Ga0157376_100898922 408
120 3300017792 Ga0163161_10024166 Ga0163161_100241665 408
121 3300025290 Ga0207673_1001874 Ga0207673_10018742 408
122 3300025297 Ga0209758_1000125 Ga0209758_1000125118 408
123 3300025898 Ga0207692_10001001 Ga0207692_1000100110 408
124 3300025898 Ga0207692_10084992 Ga0207692_100849921 408
125 3300025900 Ga0207710_10000382 Ga0207710_1000038223 408
126 3300025901 Ga0207688_10040179 Ga0207688_100401792 408
127 3300025906 Ga0207699_10002836 Ga0207699_100028361 408
128 3300025909 Ga0207705_10022789 Ga0207705_100227895 408
129 3300025915 Ga0207693_10001038 Ga0207693_1000103818 408
130 3300025915 Ga0207693_10018607 Ga0207693_100186076 408
131 3300025920 Ga0207649_10030680 Ga0207649_100306802 408
132 3300025921 Ga0207652_10013318 Ga0207652_100133186 408
133 3300025924 Ga0207694_10153349 Ga0207694_101533492 408
134 3300025925 Ga0207650_10027646 Ga0207650_100276464 408
135 3300025927 Ga0207687_10003333 Ga0207687_100033338 408
136 3300025929 Ga0207664_10305949 Ga0207664_103059492 408
137 3300025931 Ga0207644_10007818 Ga0207644_100078186 408
138 3300025933 Ga0207706_10025352 Ga0207706_100253525 408
139 3300025934 Ga0207686_10017724 Ga0207686_100177242 408
140 3300025939 Ga0207665_10001067 Ga0207665_100010674 408
141 3300025940 Ga0207691_10056243 Ga0207691_100562432 408
142 3300025941 Ga0207711_10007738 Ga0207711_100077384 408
143 3300025941 Ga0207711_10038083 Ga0207711_100380832 408
144 3300025945 Ga0207679_10202443 Ga0207679_102024432 408
145 3300025961 Ga0207712_10012784 Ga0207712_100127845 408
146 3300025986 Ga0207658_10051684 Ga0207658_100516842 408
147 3300026023 Ga0207677_10009973 Ga0207677_100099735 408
148 3300026067 Ga0207678_10012502 Ga0207678_100125027 408
149 3300026067 Ga0207678_10022685 Ga0207678_100226855 408
150 3300026089 Ga0207648_10175651 Ga0207648_101756512 408
151 3300026095 Ga0207676_10036592 Ga0207676_100365923 408
152 3300026121 Ga0207683_10002044 Ga0207683_1000204417 408
153 3300028379 Ga0268266_10003041 Ga0268266_1000304110 408
154 3300028800 Ga0265338_10045366 Ga0265338_100453663 408
155 3300031241 Ga0265325_10002557 Ga0265325_100025577 408
156 3300031241 Ga0265325_10007571 Ga0265325_100075714 408
157 3300031247 Ga0265340_10008097 Ga0265340_100080972 408
158 3300031247 Ga0265340_10018636 Ga0265340_100186363 408
159 3300031247 Ga0265340_10069458 Ga0265340_100694582 408
160 3300031249 Ga0265339_10010435 Ga0265339_100104353 408
161 3300031249 Ga0265339_10031384 Ga0265339_100313843 408
162 3300031250 Ga0265331_10019203 Ga0265331_100192032 408
163 3300031595 Ga0265313_10012737 Ga0265313_100127373 408
164 3300031711 Ga0265314_10026356 Ga0265314_100263566 408
165 3300031712 Ga0265342_10015560 Ga0265342_100155603 408
166 3300031712 Ga0265342_10032199 Ga0265342_100321993 408
167 3300035086 Ga0373934_0030633 Ga0373934_0030633_346_1572 408
168 3300035089 Ga0373944_0030517 Ga0373944_0030517_156_1382 408
169 3300035112 Ga0373932_0013891 Ga0373932_0013891_303_1529 408
170 3300035118 Ga0373954_0007702 Ga0373954_0007702_2188_3414 408
171 3300035119 Ga0373956_0020289 Ga0373956_0020289_611_1837 408
172 3300035170 Ga0373943_0015446 Ga0373943_0015446_1254_2480 408
173 3300035172 Ga0373955_0014577 Ga0373955_0014577_1657_2883 408
174 3300035692 Ga0373935_0008117 Ga0373935_0008117_1564_2790 408
175 3300035724 Ga0373933_0019753 Ga0373933_0019753_1293_2519 408
176 3300036401 Ga0373937_0000655 Ga0373937_0000655_23581_24807 408
177 3300036401 Ga0373937_0010077 Ga0373937_0010077_2110_3336 408
178 3300045976 Ga0466967_0056493 Ga0466967_0056493_1780_3009 408
179 3300046454 Ga0495592_0022676 Ga0495592_0022676_3331_4557 408
180 3300046455 Ga0495603_0027048 Ga0495603_0027048_2213_3439 408
181 3300046459 Ga0495629_0001465 Ga0495629_0001465_7281_8507 408
182 3300046460 Ga0495638_0043638 Ga0495638_0043638_134_1360 408
183 3300046461 Ga0495641_0027508 Ga0495641_0027508_1019_2245 408
184 3300046461 Ga0495641_0050403 Ga0495641_0050403_508_1734 408
185 3300046462 Ga0495651_0002003 Ga0495651_0002003_1380_2606 408
186 3300046473 Ga0495582_0000570 Ga0495582_0000570_15421_16647 408
187 3300046473 Ga0495582_0010583 Ga0495582_0010583_2196_3422 408
188 3300046491 Ga0495584_0004635 Ga0495584_0004635_2005_3231 408
189 3300046511 Ga0495608_0000428 Ga0495608_0000428_27830_29056 408
190 3300046514 Ga0495618_0024226 Ga0495618_0024226_1151_2377 408
191 3300046516 Ga0495628_0050036 Ga0495628_0050036_1221_2447 408
192 3300046529 Ga0495652_0039202 Ga0495652_0039202_372_1598 408
193 3300046529 Ga0495652_0052790 Ga0495652_0052790_860_2086 408
194 3300046536 Ga0495587_0016789 Ga0495587_0016789_2105_3331 408
195 3300046559 Ga0495667_0003621 Ga0495667_0003621_1190_2416 408
196 3300046559 Ga0495667_0027524 Ga0495667_0027524_1592_2818 408
197 3300046559 Ga0495667_0031716 Ga0495667_0031716_905_2131 408
198 3300046642 Ga0495634_0018772 Ga0495634_0018772_3288_4514 408
199 3300046675 Ga0495657_0005238 Ga0495657_0005238_7739_8965 408
200 3300046678 Ga0495599_0079646 Ga0495599_0079646_601_1827 408
201 3300046679 Ga0495623_0001886 Ga0495623_0001886_1673_2899 408
202 3300046680 Ga0495646_0025341 Ga0495646_0025341_1284_2510 408
203 3300046683 Ga0495658_0000237 Ga0495658_0000237_24981_26207 408
204 3300046690 Ga0495624_0113906 Ga0495624_0113906_332_1558 408
205 3300046809 Ga0495600_0014425 Ga0495600_0014425_2934_4160 408
206 3300046809 Ga0495600_0078742 Ga0495600_0078742_788_2014 408
207 3300047317 Ga0495604_0005688 Ga0495604_0005688_1251_2477 408
208 3300047322 Ga0495680_0028094 Ga0495680_0028094_1163_2389 408
209 3300047444 Ga0495675_0015295 Ga0495675_0015295_741_1967 408
210 3300047471 Ga0495684_0100731 Ga0495684_0100731_898_2124 408
211 3300048088 Ga0495602_0089232 Ga0495602_0089232_410_1636 408
212 3300048089 Ga0495614_0073058 Ga0495614_0073058_136_1362 408
213 3300048903 Ga0496100_0021655 Ga0496100_0021655_201_1427 408
214 3300048905 Ga0496102_0084329 Ga0496102_0084329_340_1566 408
215 3300048906 Ga0496103_0127970 Ga0496103_0127970_336_1562 408
216 3300048908 Ga0496105_0004200 Ga0496105_0004200_4367_5593 408
217 3300048909 Ga0496106_0023744 Ga0496106_0023744_2058_3284 408
218 3300048909 Ga0496106_0083459 Ga0496106_0083459_23_1249 408
219 3300048910 Ga0496107_0025948 Ga0496107_0025948_100_1326 408
220 3300048911 Ga0496108_0002201 Ga0496108_0002201_13654_14925 408
221 3300048911 Ga0496108_0058555 Ga0496108_0058555_1824_3050 408
222 3300048914 Ga0496111_0056107 Ga0496111_0056107_502_1773 408
223 3300048917 Ga0496114_0085439 Ga0496114_0085439_932_2158 408
224 3300048918 Ga0496115_0002647 Ga0496115_0002647_9973_11199 408
225 3300048918 Ga0496115_0044829 Ga0496115_0044829_2016_3242 408
226 3300048918 Ga0496115_0156986 Ga0496115_0156986_329_1555 408
227 3300049575 Ga0501039_0119878 Ga0501039_0119878_612_1838 408
228 3300049581 Ga0501047_0005812 Ga0501047_0005812_4576_5802 408
229 3300049586 Ga0501070_0000711 Ga0501070_0000711_3743_4969 408
230 3300049744 Ga0501083_0006722 Ga0501083_0006722_3060_4286 408
231 3300049822 Ga0501035_0000703 Ga0501035_0000703_22286_23512 408
232 3300050507 nmdc:mga05p37_43225_c1 nmdc:mga05p37_43225_c1_2856_4082 408
233 3300050512 nmdc:mga0n895_18802_c1 nmdc:mga0n895_18802_c1_445_1671 408
234 3300050513 nmdc:mga0rr50_52293_c1 nmdc:mga0rr50_52293_c1_1722_2948 408
235 3300050515 nmdc:mga0a205_38544_c1 nmdc:mga0a205_38544_c1_53_1279 408
236 3300053077 Ga0495601_0002251 Ga0495601_0002251_6057_7283 408
237 3300053077 Ga0495601_0038330 Ga0495601_0038330_1340_2566 408
238 3300053078 Ga0495612_0001801 Ga0495612_0001801_2451_3677 408
239 3300053078 Ga0495612_0017394 Ga0495612_0017394_1619_2845 408
240 3300053078 Ga0495612_0021406 Ga0495612_0021406_798_2024 408
241 3300053084 Ga0495595_0000574 Ga0495595_0000574_11506_12732 408
242 3300053084 Ga0495595_0000589 Ga0495595_0000589_10766_11992 408
243 3300053084 Ga0495595_0009133 Ga0495595_0009133_1671_2897 408
244 3300053085 Ga0495619_0000484 Ga0495619_0000484_6221_7447 408
245 3300053093 Ga0500651_0001643 Ga0500651_0001643_7938_9164 408
246 3300005336 Ga0070680_100087683 Ga0070680_1000876832 409
247 3300005435 Ga0070714_100149488 Ga0070714_1001494882 409
248 3300025917 Ga0207660_10056057 Ga0207660_100560572 409
249 3300025929 Ga0207664_10121845 Ga0207664_101218452 409
250 3300025931 Ga0207644_10157990 Ga0207644_101579902 409
251 3300048903 Ga0496100_0117936 Ga0496100_0117936_543_1814 409
252 3300048904 Ga0496101_0006778 Ga0496101_0006778_4652_5923 409
253 3300048905 Ga0496102_0002614 Ga0496102_0002614_6895_8166 409
254 3300048906 Ga0496103_0013950 Ga0496103_0013950_205_1434 409
255 3300048907 Ga0496104_0013150 Ga0496104_0013150_190_1461 409
256 3300048908 Ga0496105_0003019 Ga0496105_0003019_10003_11274 409
257 3300048910 Ga0496107_0000684 Ga0496107_0000684_12827_14098 409
258 3300048913 Ga0496110_0003093 Ga0496110_0003093_10280_11551 409
259 3300048916 Ga0496113_0003867 Ga0496113_0003867_3908_5179 409
260 3300049585 Ga0501069_0111838 Ga0501069_0111838_52_1323 409
261 3300005336 Ga0070680_100036181 Ga0070680_1000361815 410
262 3300005340 Ga0070689_100046232 Ga0070689_1000462322 410
263 3300005365 Ga0070688_100001644 Ga0070688_1000016447 410
264 3300005458 Ga0070681_10011624 Ga0070681_100116242 410
265 3300005530 Ga0070679_100004048 Ga0070679_1000040487 410
266 3300005618 Ga0068864_100038779 Ga0068864_1000387792 410
267 3300005985 Ga0081539_10070433 Ga0081539_100704332 410
268 3300025912 Ga0207707_10017073 Ga0207707_100170737 410
269 3300025921 Ga0207652_10023345 Ga0207652_100233454 410
270 3300026089 Ga0207648_10212812 Ga0207648_102128122 410
271 3300026095 Ga0207676_10029909 Ga0207676_100299094 410
272 3300026121 Ga0207683_10038330 Ga0207683_100383305 410
273 3300035692 Ga0373935_0017748 Ga0373935_0017748_1792_3102 410
274 3300048903 Ga0496100_0001216 Ga0496100_0001216_311_1621 410
275 3300048904 Ga0496101_0004012 Ga0496101_0004012_1831_3141 410
276 3300048905 Ga0496102_0095094 Ga0496102_0095094_1045_2355 410
277 3300048908 Ga0496105_0058186 Ga0496105_0058186_645_1955 410
278 3300048910 Ga0496107_0006620 Ga0496107_0006620_3279_4589 410
279 3300048911 Ga0496108_0167991 Ga0496108_0167991_280_1587 410
280 3300048912 Ga0496109_0084442 Ga0496109_0084442_1067_2377 410
281 3300048917 Ga0496114_0061734 Ga0496114_0061734_837_2147 410
282 3300049568 Ga0501031_0183274 Ga0501031_0183274_35_1270 410
283 3300049569 Ga0501032_0019495 Ga0501032_0019495_1133_2368 410
284 3300049570 Ga0501033_0049607 Ga0501033_0049607_710_1945 410
285 3300049573 Ga0501037_0001926 Ga0501037_0001926_1990_3225 410
286 3300049575 Ga0501039_0152031 Ga0501039_0152031_56_1291 410
287 3300049579 Ga0501043_0062378 Ga0501043_0062378_935_2170 410
288 3300049580 Ga0501046_0072281 Ga0501046_0072281_629_1864 410
289 3300049581 Ga0501047_0124762 Ga0501047_0124762_629_1864 410
290 3300049582 Ga0501048_0042917 Ga0501048_0042917_1068_2303 410
291 3300049583 Ga0501067_0044033 Ga0501067_0044033_408_1643 410
292 3300049586 Ga0501070_0153785 Ga0501070_0153785_334_1569 410
293 3300049590 Ga0501074_0003367 Ga0501074_0003367_2095_3330 410
294 3300049744 Ga0501083_0022562 Ga0501083_0022562_528_1763 410
295 3300049822 Ga0501035_0014587 Ga0501035_0014587_4933_6168 410
296 3300049823 Ga0501044_0121715 Ga0501044_0121715_418_1653 410
297 3300031250 Ga0265331_10000007 Ga0265331_1000000738 411
298 3300053103 Ga0500555_004279 Ga0500555_004279_435_1724 412
299 3300060346 Ga0587111_0008496 Ga0587111_0008496_228_1475 412
300 3300005546 Ga0070696_100016750 Ga0070696_1000167504 413
301 3300005549 Ga0070704_100038056 Ga0070704_1000380564 413
302 3300009553 Ga0105249_10001791 Ga0105249_1000179117 413
303 3300025961 Ga0207712_10009741 Ga0207712_100097415 413
304 3300006178 Ga0075367_10037533 Ga0075367_100375333 414
305 3300006847 Ga0075431_100058205 Ga0075431_1000582053 414
306 3300009147 Ga0114129_10022018 Ga0114129_1002201810 414
307 3300031711 Ga0265314_10047644 Ga0265314_100476443 414
308 3300049571 Ga0501034_0030962 Ga0501034_0030962_1050_2300 414
309 3300050510 nmdc:mga06r32_2356_c1 nmdc:mga06r32_2356_c1_5406_6659 414
310 3300005437 Ga0070710_10073263 Ga0070710_100732632 415
311 3300005458 Ga0070681_10189413 Ga0070681_101894132 415
312 3300006175 Ga0070712_100000210 Ga0070712_1000002106 415
313 3300006186 Ga0075369_10001820 Ga0075369_100018207 415
314 3300025915 Ga0207693_10002870 Ga0207693_100028705 415
315 3300027866 Ga0209813_10005167 Ga0209813_100051673 415
316 3300049569 Ga0501032_0023041 Ga0501032_0023041_67_1320 415
317 3300049570 Ga0501033_0024781 Ga0501033_0024781_289_1542 415
318 3300049574 Ga0501038_0015163 Ga0501038_0015163_4486_5739 415
319 3300049574 Ga0501038_0043600 Ga0501038_0043600_1228_2481 415
320 3300049581 Ga0501047_0008309 Ga0501047_0008309_4346_5599 415
321 3300049822 Ga0501035_0049523 Ga0501035_0049523_2248_3501 415
322 3300050489 nmdc:mga03683_30630_c1 nmdc:mga03683_30630_c1_413_1663 415
323 3300050490 nmdc:mga03n38_2071_c1 nmdc:mga03n38_2071_c1_1685_2935 415
324 3300050491 nmdc:mga00v17_31265_c1 nmdc:mga00v17_31265_c1_589_1839 415
325 3300050496 nmdc:mga07m45_6408_c1 nmdc:mga07m45_6408_c1_2687_3937 415
326 3300050516 nmdc:mga0sz30_8432_c1 nmdc:mga0sz30_8432_c1_1162_2412 415
327 3300053134 Ga0500658_0076590 Ga0500658_0076590_67_1317 415
328 3300059493 Ga0587077_004290 Ga0587077_004290_27_1274 415
329 3300035083 Ga0373926_0036465 Ga0373926_0036465_382_1662 416
330 3300035089 Ga0373944_0006095 Ga0373944_0006095_773_2053 416
331 3300035116 Ga0373945_0008779 Ga0373945_0008779_608_1888 416
332 3300035170 Ga0373943_0000755 Ga0373943_0000755_3931_5211 416
333 3300035171 Ga0373946_0004314 Ga0373946_0004314_2394_3674 416
334 3300035695 Ga0373927_0000113 Ga0373927_0000113_22585_23865 416
335 3300035725 Ga0373947_0002417 Ga0373947_0002417_8810_10090 416
336 3300037068 Ga0373925_0020265 Ga0373925_0020265_2371_3651 416
337 3300046472 Ga0495580_0007886 Ga0495580_0007886_3671_4951 416
338 3300047315 Ga0495581_0005953 Ga0495581_0005953_760_2040 416
339 3300047471 Ga0495684_0000845 Ga0495684_0000845_2367_3647 416
340 3300047673 Ga0495593_0011906 Ga0495593_0011906_602_1882 416
341 3300005539 Ga0068853_100036354 Ga0068853_1000363543 417
342 3300013100 Ga0157373_10030403 Ga0157373_100304035 417
343 3300025917 Ga0207660_10018800 Ga0207660_100188003 417
344 3300025921 Ga0207652_10074771 Ga0207652_100747713 417
345 3300025949 Ga0207667_10222832 Ga0207667_102228322 417
346 3300049569 Ga0501032_0023660 Ga0501032_0023660_2607_3869 417
347 3300049573 Ga0501037_0129631 Ga0501037_0129631_98_1360 417
348 3300049574 Ga0501038_0008341 Ga0501038_0008341_5689_6951 417
349 3300049581 Ga0501047_0025783 Ga0501047_0025783_4349_5611 417
350 3300049583 Ga0501067_0051420 Ga0501067_0051420_793_2055 417
351 3300049589 Ga0501073_0010479 Ga0501073_0010479_1013_2275 417
352 3300049823 Ga0501044_0121965 Ga0501044_0121965_191_1453 417
353 3300031727 Ga0316576_10021856 Ga0316576_100218564 418
354 3300035398 Ga0316574_0051165 Ga0316574_0051165_786_2042 418
355 iso_pu_bacteria 8019565922 8019574281 418
356 3300049571 Ga0501034_0168174 Ga0501034_0168174_93_1352 419
357 3300049587 Ga0501071_0079291 Ga0501071_0079291_328_1587 419
358 3300005937 Ga0081455_10077031 Ga0081455_100770311 420
359 3300005981 Ga0081538_10042459 Ga0081538_100424593 420
360 3300005981 Ga0081538_10074143 Ga0081538_100741431 420
361 3300006844 Ga0075428_100064479 Ga0075428_1000644792 420
362 3300006846 Ga0075430_100019122 Ga0075430_1000191222 420
363 3300006847 Ga0075431_100011101 Ga0075431_1000111017 420
364 3300006880 Ga0075429_100031662 Ga0075429_1000316622 420
365 3300037466 Ga0395898_0063839 Ga0395898_0063839_1062_2324 420
366 3300038443 Ga0395901_0072385 Ga0395901_0072385_476_1738 420
367 3300039437 Ga0436365_0984369 Ga0436365_0984369_925_2187 420
368 3300049574 Ga0501038_0054502 Ga0501038_0054502_846_2108 420
369 3300049575 Ga0501039_0115703 Ga0501039_0115703_359_1621 420
370 3300049581 Ga0501047_0012173 Ga0501047_0012173_106_1368 420
371 3300049582 Ga0501048_0020472 Ga0501048_0020472_3274_4536 420
372 3300049588 Ga0501072_0083503 Ga0501072_0083503_444_1706 420
373 3300049593 Ga0501077_0036486 Ga0501077_0036486_1349_2611 420
374 3300049742 Ga0501080_0003552 Ga0501080_0003552_709_1971 420
375 3300049743 Ga0501081_0083382 Ga0501081_0083382_823_2085 420
376 3300049822 Ga0501035_0127957 Ga0501035_0127957_10_1272 420
377 3300050507 nmdc:mga05p37_41838_c1 nmdc:mga05p37_41838_c1_3208_4470 420
378 3300050508 nmdc:mga09592_18241_c1 nmdc:mga09592_18241_c1_2981_4243 420
379 3300061734 Ga0530510_0036553 Ga0530510_0036553_1008_2270 420
380 3300005518 Ga0070699_100147036 Ga0070699_1001470362 421
381 3300025928 Ga0207700_10182925 Ga0207700_101829252 421
382 3300031595 Ga0265313_10021608 Ga0265313_100216083 421
383 3300046463 Ga0495653_0016626 Ga0495653_0016626_4694_5971 421
384 3300046477 Ga0495664_0001903 Ga0495664_0001903_879_2156 421
385 3300046514 Ga0495618_0046862 Ga0495618_0046862_751_2028 421
386 3300046517 Ga0495630_0043185 Ga0495630_0043185_1517_2794 421
387 3300046529 Ga0495652_0050357 Ga0495652_0050357_1319_2596 421
388 3300046533 Ga0495640_0000544 Ga0495640_0000544_17159_18436 421
389 3300046535 Ga0495586_0022733 Ga0495586_0022733_1482_2759 421
390 3300046543 Ga0495645_0002211 Ga0495645_0002211_8890_10167 421
391 3300046642 Ga0495634_0007670 Ga0495634_0007670_573_1850 421
392 3300046663 Ga0495635_0004288 Ga0495635_0004288_4780_6057 421
393 3300047319 Ga0495674_0004754 Ga0495674_0004754_9115_10392 421
394 3300047471 Ga0495684_0003192 Ga0495684_0003192_10419_11696 421
395 3300049571 Ga0501034_0341086 Ga0501034_0341086_48_1313 421
396 3300049581 Ga0501047_0048363 Ga0501047_0048363_288_1553 421
397 3300050512 nmdc:mga0n895_71839_c1 nmdc:mga0n895_71839_c1_296_1561 421
398 3300053077 Ga0495601_0005410 Ga0495601_0005410_4703_5980 421
399 3300053078 Ga0495612_0001270 Ga0495612_0001270_5399_6676 421
400 3300053085 Ga0495619_0011487 Ga0495619_0011487_3555_4832 421
401 3300053139 Ga0500568_0000004 Ga0500568_0000004_461652_462929 421
402 3300001991 JGI24743J22301_10005587 JGI24743J22301_100055871 422
403 3300002077 JGI24744J21845_10003568 JGI24744J21845_100035681 422
404 3300002244 JGI24742J22300_10001968 JGI24742J22300_100019682 422
405 3300005328 Ga0070676_10079079 Ga0070676_100790792 422
406 3300005330 Ga0070690_100029551 Ga0070690_1000295512 422
407 3300005334 Ga0068869_100011719 Ga0068869_1000117194 422
408 3300005339 Ga0070660_100029661 Ga0070660_1000296612 422
409 3300005340 Ga0070689_100019008 Ga0070689_1000190083 422
410 3300005341 Ga0070691_10009143 Ga0070691_100091433 422
411 3300005344 Ga0070661_100019314 Ga0070661_1000193142 422
412 3300005354 Ga0070675_100027856 Ga0070675_1000278562 422
413 3300005355 Ga0070671_100047340 Ga0070671_1000473403 422
414 3300005364 Ga0070673_100039440 Ga0070673_1000394403 422
415 3300005434 Ga0070709_10061333 Ga0070709_100613332 422
416 3300005435 Ga0070714_100014321 Ga0070714_1000143216 422
417 3300005435 Ga0070714_100035612 Ga0070714_1000356123 422
418 3300005436 Ga0070713_100006459 Ga0070713_1000064593 422
419 3300005436 Ga0070713_100046367 Ga0070713_1000463672 422
420 3300005437 Ga0070710_10028267 Ga0070710_100282673 422
421 3300005437 Ga0070710_10050836 Ga0070710_100508362 422
422 3300005439 Ga0070711_100066360 Ga0070711_1000663603 422
423 3300005457 Ga0070662_100020307 Ga0070662_1000203074 422
424 3300005459 Ga0068867_100072228 Ga0068867_1000722282 422
425 3300005466 Ga0070685_10019724 Ga0070685_100197242 422
426 3300005535 Ga0070684_100204539 Ga0070684_1002045392 422
427 3300005543 Ga0070672_100048185 Ga0070672_1000481853 422
428 3300005544 Ga0070686_100045875 Ga0070686_1000458752 422
429 3300005547 Ga0070693_100041471 Ga0070693_1000414712 422
430 3300005549 Ga0070704_100039134 Ga0070704_1000391342 422
431 3300005564 Ga0070664_100102314 Ga0070664_1001023142 422
432 3300005577 Ga0068857_100037039 Ga0068857_1000370392 422
433 3300005616 Ga0068852_100089344 Ga0068852_1000893442 422
434 3300005617 Ga0068859_100127718 Ga0068859_1001277182 422
435 3300005719 Ga0068861_100031847 Ga0068861_1000318473 422
436 3300005840 Ga0068870_10004317 Ga0068870_100043175 422
437 3300005841 Ga0068863_100103754 Ga0068863_1001037543 422
438 3300005842 Ga0068858_100182848 Ga0068858_1001828482 422
439 3300005843 Ga0068860_100114683 Ga0068860_1001146832 422
440 3300005844 Ga0068862_100033512 Ga0068862_1000335124 422
441 3300006028 Ga0070717_10000485 Ga0070717_1000048511 422
442 3300006028 Ga0070717_10129106 Ga0070717_101291062 422
443 3300006042 Ga0075368_10022912 Ga0075368_100229122 422
444 3300006163 Ga0070715_10001137 Ga0070715_100011379 422
445 3300006175 Ga0070712_100070328 Ga0070712_1000703282 422
446 3300006175 Ga0070712_100077942 Ga0070712_1000779422 422
447 3300006237 Ga0097621_100102092 Ga0097621_1001020922 422
448 3300006844 Ga0075428_100015591 Ga0075428_1000155919 422
449 3300006881 Ga0068865_100039589 Ga0068865_1000395893 422
450 3300006931 Ga0097620_100127725 Ga0097620_1001277252 422
451 3300009098 Ga0105245_10072617 Ga0105245_100726173 422
452 3300009101 Ga0105247_10003270 Ga0105247_100032703 422
453 3300009101 Ga0105247_10080763 Ga0105247_100807632 422
454 3300009147 Ga0114129_10368765 Ga0114129_103687652 422
455 3300009174 Ga0105241_10049529 Ga0105241_100495292 422
456 3300009176 Ga0105242_10075694 Ga0105242_100756942 422
457 3300009176 Ga0105242_10164879 Ga0105242_101648792 422
458 3300009177 Ga0105248_10025905 Ga0105248_100259056 422
459 3300010375 Ga0105239_10436077 Ga0105239_104360772 422
460 3300025898 Ga0207692_10000282 Ga0207692_100002825 422
461 3300025900 Ga0207710_10013007 Ga0207710_100130071 422
462 3300025901 Ga0207688_10001072 Ga0207688_1000107214 422
463 3300025903 Ga0207680_10108155 Ga0207680_101081552 422
464 3300025905 Ga0207685_10000553 Ga0207685_100005533 422
465 3300025906 Ga0207699_10049073 Ga0207699_100490732 422
466 3300025907 Ga0207645_10005025 Ga0207645_100050256 422
467 3300025908 Ga0207643_10000532 Ga0207643_1000053213 422
468 3300025914 Ga0207671_10047853 Ga0207671_100478533 422
469 3300025915 Ga0207693_10009669 Ga0207693_100096695 422
470 3300025915 Ga0207693_10092949 Ga0207693_100929492 422
471 3300025916 Ga0207663_10001206 Ga0207663_100012064 422
472 3300025918 Ga0207662_10009678 Ga0207662_100096786 422
473 3300025919 Ga0207657_10019049 Ga0207657_100190494 422
474 3300025920 Ga0207649_10092658 Ga0207649_100926581 422
475 3300025927 Ga0207687_10047883 Ga0207687_100478833 422
476 3300025927 Ga0207687_10076123 Ga0207687_100761232 422
477 3300025928 Ga0207700_10000848 Ga0207700_1000084816 422
478 3300025929 Ga0207664_10016622 Ga0207664_100166222 422
479 3300025931 Ga0207644_10004451 Ga0207644_100044515 422
480 3300025933 Ga0207706_10017396 Ga0207706_100173962 422
481 3300025934 Ga0207686_10063530 Ga0207686_100635302 422
482 3300025935 Ga0207709_10093252 Ga0207709_100932522 422
483 3300025936 Ga0207670_10083083 Ga0207670_100830832 422
484 3300025939 Ga0207665_10052160 Ga0207665_100521602 422
485 3300025940 Ga0207691_10033565 Ga0207691_100335653 422
486 3300025940 Ga0207691_10055128 Ga0207691_100551282 422
487 3300025942 Ga0207689_10009477 Ga0207689_100094772 422
488 3300025944 Ga0207661_10020016 Ga0207661_100200163 422
489 3300025961 Ga0207712_10157337 Ga0207712_101573372 422
490 3300026035 Ga0207703_10060233 Ga0207703_100602332 422
491 3300026035 Ga0207703_10103730 Ga0207703_101037302 422
492 3300026041 Ga0207639_10109903 Ga0207639_101099031 422
493 3300026067 Ga0207678_10020636 Ga0207678_100206362 422
494 3300026088 Ga0207641_10083300 Ga0207641_100833003 422
495 3300026089 Ga0207648_10017715 Ga0207648_100177154 422
496 3300026095 Ga0207676_10119170 Ga0207676_101191702 422
497 3300026121 Ga0207683_10015976 Ga0207683_100159765 422
498 3300026142 Ga0207698_10112075 Ga0207698_101120752 422
499 3300027907 Ga0207428_10016365 Ga0207428_100163654 422
500 3300028381 Ga0268264_10143937 Ga0268264_101439372 422
501 3300035692 Ga0373935_0113625 Ga0373935_0113625_394_1665 422
502 3300035695 Ga0373927_0026560 Ga0373927_0026560_1016_2287 422
503 3300035725 Ga0373947_0035669 Ga0373947_0035669_269_1540 422
504 3300039450 Ga0436363_1614455 Ga0436363_1614455_1715_2983 422
505 3300046462 Ga0495651_0019031 Ga0495651_0019031_2629_3897 422
506 3300046463 Ga0495653_0050830 Ga0495653_0050830_1813_3081 422
507 3300046491 Ga0495584_0076237 Ga0495584_0076237_145_1416 422
508 3300046511 Ga0495608_0132505 Ga0495608_0132505_167_1435 422
509 3300046529 Ga0495652_0165897 Ga0495652_0165897_16_1284 422
510 3300046543 Ga0495645_0064173 Ga0495645_0064173_184_1452 422
511 3300046615 Ga0495656_0002309 Ga0495656_0002309_279_1550 422
512 3300046642 Ga0495634_0035163 Ga0495634_0035163_978_2258 422
513 3300046663 Ga0495635_0074352 Ga0495635_0074352_16_1284 422
514 3300046665 Ga0495661_0103213 Ga0495661_0103213_180_1451 422
515 3300047315 Ga0495581_0024707 Ga0495581_0024707_869_2140 422
516 3300047321 Ga0495676_0046516 Ga0495676_0046516_475_1746 422
517 3300047322 Ga0495680_0037561 Ga0495680_0037561_52_1320 422
518 3300047471 Ga0495684_0010217 Ga0495684_0010217_856_2136 422
519 3300048088 Ga0495602_0031564 Ga0495602_0031564_1498_2766 422
520 3300048903 Ga0496100_0103975 Ga0496100_0103975_478_1746 422
521 3300048904 Ga0496101_0055005 Ga0496101_0055005_663_1931 422
522 3300048905 Ga0496102_0014685 Ga0496102_0014685_1394_2662 422
523 3300048906 Ga0496103_0059443 Ga0496103_0059443_193_1461 422
524 3300048907 Ga0496104_0020052 Ga0496104_0020052_2496_3764 422
525 3300048908 Ga0496105_0007082 Ga0496105_0007082_6936_8204 422
526 3300048909 Ga0496106_0019804 Ga0496106_0019804_1847_3115 422
527 3300048909 Ga0496106_0020054 Ga0496106_0020054_2736_4004 422
528 3300048910 Ga0496107_0041675 Ga0496107_0041675_1959_3227 422
529 3300048911 Ga0496108_0000951 Ga0496108_0000951_6644_7912 422
530 3300048912 Ga0496109_0001009 Ga0496109_0001009_1770_3038 422
531 3300048912 Ga0496109_0085264 Ga0496109_0085264_1016_2284 422
532 3300048913 Ga0496110_0020044 Ga0496110_0020044_1461_2729 422
533 3300048914 Ga0496111_0034287 Ga0496111_0034287_216_1484 422
534 3300048914 Ga0496111_0052146 Ga0496111_0052146_1104_2372 422
535 3300048915 Ga0496112_0076740 Ga0496112_0076740_576_1844 422
536 3300048915 Ga0496112_0216524 Ga0496112_0216524_533_1801 422
537 3300048916 Ga0496113_0000043 Ga0496113_0000043_7303_8571 422
538 3300048916 Ga0496113_0017064 Ga0496113_0017064_3135_4403 422
539 3300048917 Ga0496114_0109895 Ga0496114_0109895_1062_2330 422
540 3300050496 nmdc:mga07m45_84719_c1 nmdc:mga07m45_84719_c1_163_1431 422
541 3300050510 nmdc:mga06r32_174494_c1 nmdc:mga06r32_174494_c1_805_2073 422
542 3300050511 nmdc:mga08y16_15821_c1 nmdc:mga08y16_15821_c1_6208_7476 422
543 3300050512 nmdc:mga0n895_100862_c1 nmdc:mga0n895_100862_c1_1589_2857 422
544 3300053077 Ga0495601_0001735 Ga0495601_0001735_6427_7710 422
545 3300053085 Ga0495619_0021211 Ga0495619_0021211_979_2262 422
546 3300053085 Ga0495619_0055908 Ga0495619_0055908_742_2010 422
547 3300053085 Ga0495619_0069641 Ga0495619_0069641_415_1683 422

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00032

Cytochrom_B_C

Cytochrome b(C-terminal)/b6/petD

272

373

0.99

PF00033

Cytochrome_B

Cytochrome b/b6/petB

27

215

0.99

PF13631

Cytochrom_B_N_2

Cytochrome b(N-terminal)/b6/petB

97

267

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ybb-assembly1.cif.gz_c fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) 0.9267 35 389
5luf-assembly1.cif.gz_b cryo-em of bovine respirasome 0.8979 22 389
1sqq-assembly1.cif.gz_C-2 crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas) 0.8943 10 389
7rje-assembly1.cif.gz_T complex iii2 from candida albicans, inz-5 bound 0.8917 10 390
5xte-assembly1.cif.gz_J cryo-em structure of human respiratory complex iii (cytochrome bc1 complex) 0.8912 11 387
ID Description Score Start End Superfamily
1bgyC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8979 22 389 1.20.810.10
af_Q37311_1_385_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8827 10 406 1.20.810.10
3cwbC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8771 3 389 1.20.810.10
2fynA00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8659 3 402 1.20.810.10
1kyoC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8652 6 408 1.20.810.10
ID Description Score Start End GO Terms
AF-A0A3D0UX60-F1-model_v4 deleted 0.972 304 406
AF-A0A3B9K1I6-F1-model_v4 Cytochrome b 0.9705 288 394 GO:0008121
GO:0016020
GO:0046872
AF-A0A2A2KA36-F1-model_v4 Cytochrome b 0.968 312 406 GO:0005743
GO:0009055
GO:0016491
GO:0046872
AF-A0A0F3NJ69-F1-model_v4 Cytochrome b family protein 0.9531 280 402 GO:0008121
GO:0016020
GO:0046872
AF-Q7J5D2-F1-model_v4 Cytochrome b (Complex III subunit 3) (Complex III subunit III) (Cytochrome b-c1 complex subunit 3) (Ubiquinol-cytochrome-c reductase complex cytochrome b subunit) 0.9529 295 389 GO:0005743
GO:0006122
GO:0008121
GO:0046872

Feature Viewer

pLDDT pTM Quality
80.23 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map