F462144

General Info

Members Datasets Scaffolds Average Seq Length
547 258 547 245

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0236779|Ga0451576_0236779_468_1229
Length 235
Sequence MRLKDKVAIVTGAGSGFGAGIAKRFAEEGARVVVNDIHAPAGDRVAGEISSTGGKALFLRGDVTRSADWANMIGAAESAFGRLDIIVNNAGWTHRKKPYLETTEAEFDKVYAVNVKSVYLSAIHAVPGFRKRGGGAIVNVASTVILMSKSMAAEFGPDKIRINCVNPVFSPDTGLSAEFAGGSISPEIRAAYLATIPLGRFSTPLDVANACLYLASDEASFVSGVCIEVDGARCA

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
128 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
162 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
165 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.18
Rhizosphere 99.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10173691 3300005328 Bacteria 1396
2 Ga0070690_100029275 3300005330 Bacteria 3415
3 Ga0070690_100068617 3300005330 Bacteria 2300
4 Ga0068869_100000410 3300005334 Bacteria 23340
5 Ga0068869_100022479 3300005334 Bacteria 4346
6 Ga0068869_100100605 3300005334 Bacteria 2186
7 Ga0068869_100326918 3300005334 Bacteria 1245
8 Ga0070666_10233438 3300005335 Bacteria 1299
9 Ga0070680_100005249 3300005336 Bacteria 9804
10 Ga0070682_100003219 3300005337 Bacteria 9057
11 Ga0068868_100008650 3300005338 Bacteria 7290
12 Ga0070689_100032214 3300005340 Bacteria 3986
13 Ga0070689_100054939 3300005340 Bacteria 3084
14 Ga0070689_100129762 3300005340 Bacteria 2021
15 Ga0070689_100177658 3300005340 Bacteria 1727
16 Ga0070691_10005779 3300005341 Bacteria 5644
17 Ga0070687_100000044 3300005343 Bacteria 40074
18 Ga0070687_100335566 3300005343 Bacteria 971
19 Ga0070692_10008978 3300005345 Bacteria 4485
20 Ga0070692_10023760 3300005345 Bacteria 3007
21 Ga0070692_10122526 3300005345 Bacteria 1452
22 Ga0070669_100005395 3300005353 Bacteria 9223
23 Ga0070675_100023531 3300005354 Bacteria 4927
24 Ga0070671_100117822 3300005355 Bacteria 2233
25 Ga0070673_100308181 3300005364 Bacteria 1396
26 Ga0070711_100350347 3300005439 Bacteria 1187
27 Ga0070705_100002406 3300005440 Bacteria 9418
28 Ga0070705_100003242 3300005440 Bacteria 7995
29 Ga0070705_100077104 3300005440 Bacteria 2035
30 Ga0070705_100147639 3300005440 Bacteria 1556
31 Ga0070700_100000953 3300005441 Bacteria 14285
32 Ga0070700_100084758 3300005441 Bacteria 2054
33 Ga0070700_100206428 3300005441 Bacteria 1383
34 Ga0070694_100000077 3300005444 Bacteria 47645
35 Ga0070694_100003024 3300005444 Bacteria 10018
36 Ga0070694_100016570 3300005444 Bacteria 4640
37 Ga0070694_100020813 3300005444 Bacteria 4187
38 Ga0070694_100070036 3300005444 Bacteria 2414
39 Ga0070694_100078479 3300005444 Bacteria 2290
40 Ga0070681_10000172 3300005458 Bacteria 49288
41 Ga0070681_10648373 3300005458 Bacteria 971
42 Ga0068867_100000107 3300005459 Bacteria 53378
43 Ga0068867_100744308 3300005459 Bacteria 869
44 Ga0070707_100354542 3300005468 Bacteria 1425
45 Ga0070698_100022050 3300005471 Bacteria 6668
46 Ga0070699_100431187 3300005518 Bacteria 1194
47 Ga0070679_100008900 3300005530 Bacteria 9474
48 Ga0070679_100639253 3300005530 Bacteria 1007
49 Ga0070684_100070915 3300005535 Bacteria 3067
50 Ga0070697_100000484 3300005536 Bacteria 30233
51 Ga0070697_100020315 3300005536 Bacteria 5253
52 Ga0068853_100092728 3300005539 Bacteria 2657
53 Ga0070686_100000168 3300005544 Bacteria 45696
54 Ga0070686_100038971 3300005544 Bacteria 2958
55 Ga0070686_100307504 3300005544 Bacteria 1178
56 Ga0070695_100000956 3300005545 Bacteria 15701
57 Ga0070695_100002049 3300005545 Bacteria 11523
58 Ga0070695_100065990 3300005545 Bacteria 2358
59 Ga0070695_100214785 3300005545 Bacteria 1383
60 Ga0070696_100001446 3300005546 Bacteria 15542
61 Ga0070696_100005276 3300005546 Bacteria 8626
62 Ga0070696_100151196 3300005546 Bacteria 1704
63 Ga0070693_100000040 3300005547 Bacteria 49709
64 Ga0070693_100326178 3300005547 Bacteria 1043
65 Ga0070704_100000120 3300005549 Bacteria 28329
66 Ga0070704_100035153 3300005549 Bacteria 3405
67 Ga0070704_100058372 3300005549 Bacteria 2748
68 Ga0070704_100077085 3300005549 Bacteria 2441
69 Ga0070704_100567076 3300005549 Bacteria 994
70 Ga0068855_100005158 3300005563 Bacteria 15933
71 Ga0068854_100043227 3300005578 Bacteria 3193
72 Ga0068856_100082293 3300005614 Bacteria 3195
73 Ga0068856_100104245 3300005614 Bacteria 2830
74 Ga0070702_100000050 3300005615 Bacteria 32860
75 Ga0070702_100036864 3300005615 Bacteria 2712
76 Ga0068852_100033221 3300005616 Bacteria 4282
77 Ga0068859_100000332 3300005617 Bacteria 47130
78 Ga0068864_100135062 3300005618 Bacteria 2220
79 Ga0068861_100000100 3300005719 Bacteria 42431
80 Ga0068861_100407274 3300005719 Bacteria 1208
81 Ga0068861_100413816 3300005719 Bacteria 1200
82 Ga0068870_10069275 3300005840 Bacteria 1919
83 Ga0068870_10073405 3300005840 Bacteria 1871
84 Ga0068863_100977570 3300005841 Bacteria 849
85 Ga0068863_101080348 3300005841 Bacteria 807
86 Ga0068858_100000941 3300005842 Bacteria 30171
87 Ga0068858_100030040 3300005842 Bacteria 5046
88 Ga0068860_100000773 3300005843 Bacteria 35982
89 Ga0068862_100021482 3300005844 Bacteria 5394
90 Ga0068862_100021620 3300005844 Bacteria 5379
91 Ga0081538_10183878 3300005981 Bacteria 889
92 Ga0081539_10000276 3300005985 Bacteria 117151
93 Ga0070716_100045423 3300006173 Bacteria 2466
94 Ga0070716_100055456 3300006173 Bacteria 2268
95 Ga0097621_100002104 3300006237 Bacteria 13650
96 Ga0097621_100007190 3300006237 Bacteria 7942
97 Ga0097621_100197542 3300006237 Bacteria 1745
98 Ga0068871_100000238 3300006358 Bacteria 38970
99 Ga0068871_100003779 3300006358 Bacteria 10425
100 Ga0075428_100002555 3300006844 Bacteria 19788
101 Ga0075428_100017193 3300006844 Bacteria 7991
102 Ga0075428_100121466 3300006844 Bacteria 2844
103 Ga0075430_100000884 3300006846 Bacteria 23515
104 Ga0075430_100014853 3300006846 Bacteria 6631
105 Ga0075430_100106842 3300006846 Bacteria 2335
106 Ga0075430_100114832 3300006846 Bacteria 2243
107 Ga0075430_100586179 3300006846 Bacteria 920
108 Ga0075430_100601249 3300006846 Bacteria 907
109 Ga0075431_100009882 3300006847 Bacteria 9579
110 Ga0075431_100176470 3300006847 Bacteria 2194
111 Ga0075431_100177686 3300006847 Bacteria 2186
112 Ga0075431_100185255 3300006847 Bacteria 2135
113 Ga0075431_100316277 3300006847 Bacteria 1575
114 Ga0075431_100358378 3300006847 Bacteria 1465
115 Ga0075433_10004807 3300006852 Bacteria 10545
116 Ga0075433_10058361 3300006852 Bacteria 3375
117 Ga0075433_10212678 3300006852 Bacteria 1718
118 Ga0075434_100000211 3300006871 Bacteria 39638
119 Ga0075434_100003303 3300006871 Bacteria 14417
120 Ga0075434_100016970 3300006871 Bacteria 7004
121 Ga0075434_100115306 3300006871 Bacteria 2699
122 Ga0075429_100000463 3300006880 Bacteria 30330
123 Ga0075429_100000575 3300006880 Bacteria 28243
124 Ga0075429_100290515 3300006880 Bacteria 1431
125 Ga0075429_100508065 3300006880 Bacteria 1056
126 Ga0068865_100000142 3300006881 Bacteria 37988
127 Ga0075436_100000711 3300006914 Bacteria 22075
128 Ga0075436_100027470 3300006914 Bacteria 3916
129 Ga0075436_100042857 3300006914 Bacteria 3121
130 Ga0075436_100047042 3300006914 Bacteria 2975
131 Ga0075436_100069536 3300006914 Bacteria 2433
132 Ga0075436_100101108 3300006914 Bacteria 2008
133 Ga0097620_100000332 3300006931 Bacteria 47130
134 Ga0097620_100072524 3300006931 Bacteria 3480
135 Ga0075435_100000118 3300007076 Bacteria 44235
136 Ga0075435_100001401 3300007076 Bacteria 15529
137 Ga0075435_100066389 3300007076 Bacteria 2935
138 Ga0075435_100174083 3300007076 Bacteria 1817
139 Ga0075435_100284687 3300007076 Bacteria 1411
140 Ga0075435_100315110 3300007076 Bacteria 1339
141 Ga0099794_10011740 3300007265 Bacteria 3760
142 Ga0099794_10018153 3300007265 Bacteria 3149
143 Ga0105250_10146599 3300009092 Bacteria 980
144 Ga0111539_10065805 3300009094 Bacteria 4282
145 Ga0111539_10221213 3300009094 Bacteria 2205
146 Ga0111539_10242976 3300009094 Bacteria 2096
147 Ga0111539_10276847 3300009094 Bacteria 1953
148 Ga0105245_10000115 3300009098 Bacteria 77632
149 Ga0114129_10004402 3300009147 Bacteria 19867
150 Ga0114129_10018075 3300009147 Bacteria 10043
151 Ga0114129_10072631 3300009147 Bacteria 4796
152 Ga0114129_10144836 3300009147 Bacteria 3255
153 Ga0114129_10193300 3300009147 Bacteria 2761
154 Ga0114129_10341567 3300009147 Bacteria 1986
155 Ga0105243_10000035 3300009148 Bacteria 177598
156 Ga0105243_10389244 3300009148 Bacteria 1292
157 Ga0105241_10190576 3300009174 Bacteria 1706
158 Ga0105242_10000268 3300009176 Bacteria 41263
159 Ga0105249_10001725 3300009553 Bacteria 19130
160 Ga0105249_10016872 3300009553 Bacteria 6480
161 Ga0105239_10315968 3300010375 Bacteria 1761
162 Ga0157378_10001006 3300013297 Bacteria 25838
163 Ga0163162_10375743 3300013306 Bacteria 1554
164 Ga0157372_10436919 3300013307 Bacteria 1525
165 Ga0157375_10114851 3300013308 Bacteria 2795
166 Ga0157380_10034856 3300014326 Bacteria 3884
167 Ga0157380_10038962 3300014326 Bacteria 3693
168 Ga0157377_10023079 3300014745 Bacteria 3293
169 Ga0157379_10119529 3300014968 Bacteria 2370
170 Ga0157376_10000582 3300014969 Bacteria 23542
171 Ga0157376_10012402 3300014969 Bacteria 6326
172 Ga0207642_10000374 3300025899 Bacteria 13524
173 Ga0207688_10075767 3300025901 Bacteria 1915
174 Ga0207647_10129366 3300025904 Bacteria 1485
175 Ga0207645_10252761 3300025907 Bacteria 1166
176 Ga0207643_10034524 3300025908 Bacteria 2834
177 Ga0207643_10048836 3300025908 Bacteria 2398
178 Ga0207654_10099707 3300025911 Bacteria 1787
179 Ga0207707_10004410 3300025912 Bacteria 12423
180 Ga0207660_10010257 3300025917 Bacteria 6074
181 Ga0207660_10139536 3300025917 Bacteria 1852
182 Ga0207662_10000061 3300025918 Bacteria 47261
183 Ga0207662_10093240 3300025918 Bacteria 1855
184 Ga0207662_10154700 3300025918 Bacteria 1461
185 Ga0207652_10008890 3300025921 Bacteria 8091
186 Ga0207646_10140271 3300025922 Bacteria 2177
187 Ga0207659_10088536 3300025926 Bacteria 2306
188 Ga0207687_10002769 3300025927 Bacteria 11891
189 Ga0207686_10001105 3300025934 Bacteria 15705
190 Ga0207709_10003264 3300025935 Bacteria 9728
191 Ga0207709_10027953 3300025935 Bacteria 3256
192 Ga0207670_10000311 3300025936 Bacteria 29168
193 Ga0207670_10012235 3300025936 Bacteria 5012
194 Ga0207670_10085644 3300025936 Bacteria 2215
195 Ga0207704_10000141 3300025938 Bacteria 38563
196 Ga0207704_10386168 3300025938 Bacteria 1100
197 Ga0207665_10068176 3300025939 Bacteria 2424
198 Ga0207691_10141707 3300025940 Bacteria 2118
199 Ga0207689_10000024 3300025942 Bacteria 107574
200 Ga0207689_10016219 3300025942 Bacteria 6310
201 Ga0207689_10079658 3300025942 Bacteria 2692
202 Ga0207667_10001264 3300025949 Bacteria 31701
203 Ga0207712_10011070 3300025961 Bacteria 5744
204 Ga0207640_10008300 3300025981 Bacteria 5765
205 Ga0207677_10003198 3300026023 Bacteria 8640
206 Ga0207677_10516971 3300026023 Bacteria 1035
207 Ga0207703_10002833 3300026035 Bacteria 14796
208 Ga0207703_10078985 3300026035 Bacteria 2736
209 Ga0207639_10197022 3300026041 Bacteria 1725
210 Ga0207708_10000905 3300026075 Bacteria 22282
211 Ga0207708_10014623 3300026075 Bacteria 5872
212 Ga0207702_10003642 3300026078 Bacteria 13960
213 Ga0207641_10230178 3300026088 Bacteria 1722
214 Ga0207648_10000113 3300026089 Bacteria 78626
215 Ga0207648_10014691 3300026089 Bacteria 7227
216 Ga0207648_10419777 3300026089 Bacteria 1214
217 Ga0207676_10116173 3300026095 Bacteria 2248
218 Ga0207675_100000017 3300026118 Bacteria 124338
219 Ga0207675_100045031 3300026118 Bacteria 4122
220 Ga0207698_10038396 3300026142 Bacteria 3538
221 Ga0209969_1007012 3300027360 Bacteria 1590
222 Ga0209981_1020587 3300027378 Bacteria 941
223 Ga0209996_1020828 3300027395 Bacteria 920
224 Ga0210000_1008026 3300027462 Bacteria 1548
225 Ga0209995_1003227 3300027471 Bacteria 2595
226 Ga0209995_1004282 3300027471 Bacteria 2281
227 Ga0209968_1001351 3300027526 Bacteria 3719
228 Ga0209999_1002349 3300027543 Bacteria 3334
229 Ga0209999_1005187 3300027543 Bacteria 2343
230 Ga0209999_1012000 3300027543 Bacteria 1568
231 Ga0209999_1022188 3300027543 Bacteria 1167
232 Ga0209983_1003590 3300027665 Bacteria 3292
233 Ga0209971_1001237 3300027682 Bacteria 6400
234 Ga0209974_10016607 3300027876 Bacteria 2444
235 Ga0207428_10005014 3300027907 Bacteria 12451
236 Ga0207428_10084062 3300027907 Bacteria 2481
237 Ga0207428_10259499 3300027907 Bacteria 1294
238 Ga0268265_10002990 3300028380 Bacteria 12347
239 Ga0268265_10060294 3300028380 Bacteria 2907
240 Ga0268265_10241045 3300028380 Bacteria 1596
241 Ga0268265_10355480 3300028380 Bacteria 1339
242 Ga0268264_10001524 3300028381 Bacteria 21559
243 Ga0268264_10285629 3300028381 Bacteria 1547
244 Ga0316575_10000505 3300031665 Bacteria 11281
245 Ga0316579_10014289 3300031691 Bacteria 3429
246 Ga0316578_10271358 3300031728 Bacteria 1016
247 Ga0307412_10367257 3300031911 Bacteria 1161
248 Ga0307409_100251963 3300031995 Bacteria 1615
249 Ga0307409_100386688 3300031995 Bacteria 1332
250 Ga0307416_100165705 3300032002 Bacteria 2049
251 Ga0307411_10801391 3300032005 Unclassified 829
252 Ga0316583_10003377 3300032133 Bacteria 5620
253 Ga0373926_0030787 3300035083 Bacteria 1891
254 Ga0373934_0006924 3300035086 Bacteria 4208
255 Ga0373934_0096374 3300035086 Bacteria 1195
256 Ga0373949_0013319 3300035090 Bacteria 1822
257 Ga0373923_0041536 3300035111 Bacteria 1896
258 Ga0373932_0039972 3300035112 Bacteria 1348
259 Ga0373936_0153410 3300035113 Bacteria 999
260 Ga0373939_0010873 3300035114 Bacteria 2286
261 Ga0373939_0043306 3300035114 Bacteria 1365
262 Ga0373941_0002545 3300035115 Bacteria 4032
263 Ga0373941_0004843 3300035115 Bacteria 3136
264 Ga0373953_0016723 3300035117 Bacteria 2683
265 Ga0373953_0034679 3300035117 Bacteria 1979
266 Ga0373953_0143884 3300035117 Bacteria 1020
267 Ga0373954_0000001 3300035118 Bacteria 158201
268 Ga0373954_0228272 3300035118 Bacteria 916
269 Ga0373956_0010377 3300035119 Bacteria 3817
270 Ga0373960_0007807 3300035121 Bacteria 2545
271 Ga0373943_0002039 3300035170 Bacteria 9166
272 Ga0373943_0151230 3300035170 Bacteria 1258
273 Ga0373946_0046399 3300035171 Bacteria 1800
274 Ga0373955_0113922 3300035172 Bacteria 1566
275 Ga0373955_0180942 3300035172 Bacteria 1251
276 Ga0373955_0194502 3300035172 Bacteria 1206
277 Ga0373942_0002569 3300035207 Bacteria 4381
278 Ga0316574_0002756 3300035398 Bacteria 8916
279 Ga0373924_0004289 3300035410 Bacteria 4974
280 Ga0373931_0000559 3300035691 Bacteria 15345
281 Ga0373931_0009317 3300035691 Bacteria 4689
282 Ga0373931_0012022 3300035691 Bacteria 4190
283 Ga0373931_0057355 3300035691 Bacteria 2088
284 Ga0373931_0076511 3300035691 Bacteria 1838
285 Ga0373935_0089216 3300035692 Bacteria 2016
286 Ga0373935_0163710 3300035692 Bacteria 1517
287 Ga0373927_0087015 3300035695 Bacteria 2028
288 Ga0373933_0003218 3300035724 Bacteria 9119
289 Ga0373933_0040548 3300035724 Bacteria 2744
290 Ga0373933_0121715 3300035724 Bacteria 1634
291 Ga0373947_0008402 3300035725 Bacteria 5948
292 Ga0373937_0001813 3300036401 Bacteria 17929
293 Ga0373937_0002345 3300036401 Bacteria 15783
294 Ga0373937_0071623 3300036401 Bacteria 3196
295 Ga0373937_0439968 3300036401 Bacteria 1238
296 Ga0373937_0525816 3300036401 Bacteria 1124
297 Ga0316582_0000598 3300036647 Bacteria 13985
298 Ga0316584_0242036 3300036712 Bacteria 1320
299 Ga0373925_0034353 3300037068 Bacteria 3736
300 Ga0373925_0067316 3300037068 Bacteria 2701
301 Ga0316581_0001270 3300037588 Bacteria 5592
302 Ga0439453_0007638 3300041408 Bacteria 1721
303 Ga0451807_2701969 3300041486 Bacteria 1509
304 Ga0439441_000465 3300042001 Bacteria 4360
305 Ga0439441_002134 3300042001 Bacteria 2734
306 Ga0450896_023358 3300042133 Bacteria 913
307 Ga0439434_0020731 3300042435 Bacteria 1974
308 Ga0439435_0000279 3300042436 Bacteria 7539
309 Ga0439435_0017083 3300042436 Bacteria 1829
310 Ga0439460_0000486 3300042461 Bacteria 8592
311 Ga0451577_0070572 3300042876 Bacteria 3115
312 Ga0466963_0049261 3300044694 Bacteria 2786
313 Ga0466960_0170475 3300044901 Bacteria 1174
314 Ga0451576_0005105 3300045051 Bacteria 16640
315 Ga0451576_0019832 3300045051 Bacteria 7332
316 Ga0451576_0049046 3300045051 Bacteria 4431
317 Ga0451576_0192120 3300045051 Bacteria 2132
318 Ga0451576_0236779 3300045051 Bacteria 1907
319 Ga0451576_0879226 3300045051 Bacteria 940
320 Ga0466967_0006376 3300045976 Bacteria 8339
321 Ga0495592_0000330 3300046454 Bacteria 39376
322 Ga0495603_0012521 3300046455 Bacteria 5136
323 Ga0495641_0073365 3300046461 Bacteria 1535
324 Ga0495653_0069549 3300046463 Bacteria 2637
325 Ga0495580_0041741 3300046472 Bacteria 3270
326 Ga0495582_0077028 3300046473 Bacteria 1849
327 Ga0495639_0025059 3300046475 Bacteria 2629
328 Ga0495639_0049815 3300046475 Bacteria 1902
329 Ga0495639_0235299 3300046475 Bacteria 903
330 Ga0495662_0002692 3300046476 Bacteria 8976
331 Ga0495662_0007567 3300046476 Bacteria 5361
332 Ga0495584_0058855 3300046491 Bacteria 1933
333 Ga0495608_0000582 3300046511 Bacteria 25075
334 Ga0495608_0175473 3300046511 Bacteria 1358
335 Ga0495618_0066558 3300046514 Bacteria 2290
336 Ga0495628_0001020 3300046516 Bacteria 25585
337 Ga0495628_0094005 3300046516 Bacteria 2318
338 Ga0495630_0003958 3300046517 Bacteria 10354
339 Ga0495630_0046196 3300046517 Bacteria 3255
340 Ga0495666_0109256 3300046526 Bacteria 1299
341 Ga0495642_0076175 3300046528 Bacteria 1408
342 Ga0495652_0190348 3300046529 Bacteria 1566
343 Ga0495640_0000361 3300046533 Bacteria 31989
344 Ga0495640_0024765 3300046533 Bacteria 4361
345 Ga0495586_0001795 3300046535 Bacteria 11724
346 Ga0495586_0013669 3300046535 Bacteria 4307
347 Ga0495586_0044524 3300046535 Bacteria 2391
348 Ga0495586_0265942 3300046535 Bacteria 980
349 Ga0495587_0087447 3300046536 Bacteria 1803
350 Ga0495598_0007379 3300046537 Bacteria 2520
351 Ga0495598_0079200 3300046537 Bacteria 1051
352 Ga0495621_0027665 3300046539 Bacteria 1922
353 Ga0495645_0072058 3300046543 Bacteria 2490
354 Ga0495667_0001990 3300046559 Bacteria 13534
355 Ga0495667_0009994 3300046559 Bacteria 6425
356 Ga0495656_0023407 3300046615 Bacteria 2431
357 Ga0495634_0002172 3300046642 Bacteria 16474
358 Ga0495635_0056609 3300046663 Bacteria 2699
359 Ga0495659_0005103 3300046664 Bacteria 4127
360 Ga0495657_0170146 3300046675 Bacteria 1342
361 Ga0495599_0004361 3300046678 Bacteria 8377
362 Ga0495647_0003144 3300046681 Bacteria 5285
363 Ga0495658_0012080 3300046683 Bacteria 4361
364 Ga0495658_0049210 3300046683 Bacteria 2380
365 Ga0495669_0010134 3300046684 Bacteria 3979
366 Ga0495669_0038353 3300046684 Bacteria 2122
367 Ga0495613_0003055 3300046689 Bacteria 12507
368 Ga0495624_0036328 3300046690 Bacteria 3177
369 Ga0495624_0105254 3300046690 Bacteria 1736
370 Ga0495670_0096505 3300046691 Bacteria 1518
371 Ga0495600_0001984 3300046809 Bacteria 11501
372 Ga0495604_0016454 3300047317 Bacteria 5913
373 Ga0495674_0228737 3300047319 Bacteria 1535
374 Ga0495676_0079122 3300047321 Bacteria 2500
375 Ga0495680_0191493 3300047322 Bacteria 1471
376 Ga0495684_0049112 3300047471 Bacteria 3225
377 Ga0495684_0184485 3300047471 Bacteria 1545
378 Ga0495614_0255553 3300048089 Bacteria 802
379 Ga0501031_0017804 3300049568 Bacteria 4620
380 Ga0501031_0117445 3300049568 Bacteria 1738
381 Ga0501032_0047701 3300049569 Bacteria 2892
382 Ga0501033_0001537 3300049570 Bacteria 20402
383 Ga0501036_0024904 3300049572 Bacteria 5047
384 Ga0501036_0069178 3300049572 Bacteria 2987
385 Ga0501036_0300178 3300049572 Bacteria 1343
386 Ga0501037_0007957 3300049573 Bacteria 7770
387 Ga0501038_0000396 3300049574 Bacteria 37861
388 Ga0501038_0044336 3300049574 Bacteria 3866
389 Ga0501038_0071808 3300049574 Bacteria 2935
390 Ga0501038_0078140 3300049574 Bacteria 2793
391 Ga0501038_0647186 3300049574 Bacteria 796
392 Ga0501039_0002363 3300049575 Bacteria 14055
393 Ga0501039_0012456 3300049575 Bacteria 6493
394 Ga0501039_0044316 3300049575 Bacteria 3436
395 Ga0501039_0095921 3300049575 Bacteria 2312
396 Ga0501040_0005983 3300049576 Bacteria 7876
397 Ga0501040_0024223 3300049576 Bacteria 4072
398 Ga0501040_0112013 3300049576 Bacteria 1908
399 Ga0501040_0203656 3300049576 Bacteria 1405
400 Ga0501041_0000044 3300049577 Bacteria 43476
401 Ga0501041_0021620 3300049577 Bacteria 3854
402 Ga0501041_0033004 3300049577 Bacteria 3129
403 Ga0501042_0002115 3300049578 Bacteria 12037
404 Ga0501042_0017074 3300049578 Bacteria 5000
405 Ga0501042_0082379 3300049578 Bacteria 2306
406 Ga0501042_0097860 3300049578 Bacteria 2109
407 Ga0501042_0200155 3300049578 Bacteria 1440
408 Ga0501042_0228423 3300049578 Bacteria 1342
409 Ga0501043_0042369 3300049579 Bacteria 3578
410 Ga0501046_0004953 3300049580 Bacteria 11960
411 Ga0501046_0144543 3300049580 Bacteria 1797
412 Ga0501046_0152656 3300049580 Bacteria 1742
413 Ga0501046_0216432 3300049580 Bacteria 1420
414 Ga0501047_0111805 3300049581 Bacteria 2614
415 Ga0501048_0001832 3300049582 Bacteria 16125
416 Ga0501048_0015381 3300049582 Bacteria 5650
417 Ga0501048_0019035 3300049582 Bacteria 5045
418 Ga0501048_0052990 3300049582 Bacteria 2887
419 Ga0501048_0092179 3300049582 Bacteria 2137
420 Ga0501048_0327567 3300049582 Bacteria 1091
421 Ga0501067_0291931 3300049583 Bacteria 908
422 Ga0501068_0001598 3300049584 Bacteria 12063
423 Ga0501068_0025922 3300049584 Bacteria 3450
424 Ga0501068_0115308 3300049584 Bacteria 1673
425 Ga0501070_0046406 3300049586 Bacteria 3613
426 Ga0501070_0532582 3300049586 Bacteria 942
427 Ga0501071_0001606 3300049587 Bacteria 13265
428 Ga0501071_0002455 3300049587 Bacteria 11259
429 Ga0501071_0060791 3300049587 Bacteria 2735
430 Ga0501071_0081484 3300049587 Bacteria 2368
431 Ga0501071_0166504 3300049587 Bacteria 1649
432 Ga0501071_0439923 3300049587 Bacteria 998
433 Ga0501072_0002962 3300049588 Bacteria 12790
434 Ga0501072_0004090 3300049588 Bacteria 11040
435 Ga0501072_0028349 3300049588 Bacteria 4372
436 Ga0501072_0095954 3300049588 Bacteria 2357
437 Ga0501072_0197117 3300049588 Bacteria 1606
438 Ga0501072_0202246 3300049588 Bacteria 1584
439 Ga0501072_0314370 3300049588 Bacteria 1245
440 Ga0501073_0137115 3300049589 Bacteria 1696
441 Ga0501074_0003394 3300049590 Bacteria 11273
442 Ga0501074_0129709 3300049590 Bacteria 1804
443 Ga0501074_0207703 3300049590 Bacteria 1395
444 Ga0501074_0316769 3300049590 Bacteria 1108
445 Ga0501075_0000475 3300049591 Bacteria 23966
446 Ga0501075_0001610 3300049591 Bacteria 14794
447 Ga0501075_0074123 3300049591 Bacteria 2575
448 Ga0501075_0099209 3300049591 Bacteria 2211
449 Ga0501075_0165259 3300049591 Bacteria 1688
450 Ga0501075_0298124 3300049591 Bacteria 1228
451 Ga0501075_0466272 3300049591 Bacteria 963
452 Ga0501075_0583884 3300049591 Bacteria 852
453 Ga0501076_0000508 3300049592 Bacteria 24672
454 Ga0501076_0001071 3300049592 Bacteria 17977
455 Ga0501076_0013791 3300049592 Bacteria 6065
456 Ga0501076_0142017 3300049592 Bacteria 1951
457 Ga0501076_0157158 3300049592 Bacteria 1851
458 Ga0501077_0001283 3300049593 Bacteria 15184
459 Ga0501077_0012845 3300049593 Bacteria 5249
460 Ga0501077_0038545 3300049593 Bacteria 3043
461 Ga0501077_0073810 3300049593 Bacteria 2161
462 Ga0501079_0000184 3300049741 Bacteria 35607
463 Ga0501079_0008396 3300049741 Bacteria 7828
464 Ga0501079_0018472 3300049741 Bacteria 5327
465 Ga0501079_0095964 3300049741 Bacteria 2298
466 Ga0501079_0484422 3300049741 Bacteria 972
467 Ga0501080_0016516 3300049742 Bacteria 6819
468 Ga0501080_0024339 3300049742 Bacteria 5614
469 Ga0501080_0061307 3300049742 Bacteria 3502
470 Ga0501080_0108304 3300049742 Bacteria 2575
471 Ga0501081_0000384 3300049743 Bacteria 24346
472 Ga0501081_0057966 3300049743 Bacteria 2679
473 Ga0501081_0095359 3300049743 Bacteria 2097
474 Ga0501081_0306371 3300049743 Bacteria 1166
475 Ga0501081_0399771 3300049743 Bacteria 1017
476 Ga0501035_0180403 3300049822 Bacteria 1819
477 Ga0501035_0598540 3300049822 Bacteria 899
478 Ga0501044_0241769 3300049823 Bacteria 1749
479 Ga0501045_0000572 3300049824 Bacteria 23126
480 Ga0501045_0008941 3300049824 Bacteria 6996
481 Ga0501045_0011965 3300049824 Bacteria 6100
482 Ga0501045_0023408 3300049824 Bacteria 4427
483 Ga0501045_0044323 3300049824 Bacteria 3240
484 Ga0501045_0045392 3300049824 Bacteria 3199
485 Ga0501045_0082563 3300049824 Bacteria 2370
486 Ga0501045_0288609 3300049824 Bacteria 1221
487 nmdc:mga05p37_21359_c1 3300050507 Bacteria 7840
488 nmdc:mga05p37_347136_c1 3300050507 Bacteria 1748
489 nmdc:mga05p37_52919_c1 3300050507 Bacteria 4993
490 nmdc:mga05p37_899805_c1 3300050507 Bacteria 954
491 nmdc:mga05p37_943_c1 3300050507 Bacteria 32776
492 nmdc:mga09592_134570_c1 3300050508 Bacteria 2129
493 nmdc:mga09592_1507_c1 3300050508 Bacteria 18749
494 nmdc:mga09592_1889_c1 3300050508 Bacteria 16869
495 nmdc:mga09592_227047_c1 3300050508 Bacteria 1618
496 nmdc:mga09592_460460_c1 3300050508 Bacteria 1097
497 nmdc:mga09592_825967_c1 3300050508 Bacteria 783
498 nmdc:mga0qj67_100223_c1 3300050509 Bacteria 2335
499 nmdc:mga0qj67_10463_c1 3300050509 Bacteria 6930
500 nmdc:mga0qj67_158448_c1 3300050509 Bacteria 1838
501 nmdc:mga0qj67_2203_c1 3300050509 Bacteria 13849
502 nmdc:mga06r32_16270_c1 3300050510 Bacteria 6773
503 nmdc:mga06r32_305936_c1 3300050510 Bacteria 1575
504 nmdc:mga06r32_380877_c1 3300050510 Bacteria 1394
505 nmdc:mga08y16_107679_c1 3300050511 Bacteria 2902
506 nmdc:mga08y16_199643_c1 3300050511 Bacteria 2073
507 nmdc:mga08y16_269396_c1 3300050511 Bacteria 1758
508 nmdc:mga08y16_356037_c1 3300050511 Bacteria 1503
509 nmdc:mga08y16_464959_c1 3300050511 Bacteria 1289
510 nmdc:mga08y16_6221_c1 3300050511 Bacteria 12519
511 nmdc:mga0n895_370168_c1 3300050512 Bacteria 1450
512 nmdc:mga0n895_546501_c1 3300050512 Bacteria 1164
513 nmdc:mga0n895_612_c1 3300050512 Bacteria 24763
514 nmdc:mga0n895_77418_c1 3300050512 Bacteria 3309
515 nmdc:mga0n895_774_c1 3300050512 Bacteria 22704
516 nmdc:mga0n895_8791_c1 3300050512 Bacteria 8785
517 nmdc:mga0rr50_1855_c1 3300050513 Bacteria 11716
518 nmdc:mga0rr50_19679_c1 3300050513 Bacteria 4563
519 nmdc:mga0rr50_2798_c1 3300050513 Bacteria 9915
520 nmdc:mga0rr50_308827_c1 3300050513 Bacteria 1324
521 nmdc:mga0rr50_323552_c1 3300050513 Bacteria 1293
522 nmdc:mga0rr50_547148_c1 3300050513 Bacteria 986
523 nmdc:mga08x19_1378_c1 3300050514 Bacteria 15037
524 nmdc:mga08x19_17807_c2 3300050514 Bacteria 2412
525 nmdc:mga08x19_287021_c1 3300050514 Bacteria 1141
526 nmdc:mga08x19_316851_c1 3300050514 Bacteria 1085
527 nmdc:mga08x19_65067_c1 3300050514 Bacteria 2367
528 nmdc:mga08x19_7535_c1 3300050514 Bacteria 6468
529 nmdc:mga08x19_7642_c1 3300050514 Bacteria 6422
530 nmdc:mga0a205_127493_c1 3300050515 Bacteria 2445
531 nmdc:mga0a205_1692_c1 3300050515 Bacteria 19048
532 nmdc:mga0a205_189483_c1 3300050515 Bacteria 1949
533 nmdc:mga0a205_210617_c1 3300050515 Bacteria 1832
534 nmdc:mga0a205_296994_c1 3300050515 Bacteria 1489
535 nmdc:mga0a205_451017_c1 3300050515 Bacteria 1146
536 Ga0495619_0068447 3300053085 Bacteria 2372
537 Ga0501084_0000800 3300054114 Bacteria 24076
538 Ga0501084_0003320 3300054114 Bacteria 13013
539 Ga0501084_0055700 3300054114 Bacteria 3308
540 Ga0501082_0007037 3300060353 Bacteria 9707
541 Ga0501082_0024956 3300060353 Bacteria 5150
542 Ga0501082_0032392 3300060353 Bacteria 4508
543 Ga0501082_0096600 3300060353 Bacteria 2554
544 Ga0501082_0359979 3300060353 Bacteria 1269
545 Ga0530510_0000383 3300061734 Bacteria 28772
546 Ga0530510_0002976 3300061734 Bacteria 11619
547 Ga0530510_0016725 3300061734 Bacteria 5193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035207 Ga0373942_0002569 Ga0373942_0002569_3573_4325 222
2 3300045051 Ga0451576_0236779 Ga0451576_0236779_468_1229 226
3 3300049586 Ga0501070_0532582 Ga0501070_0532582_89_778 228
4 3300005985 Ga0081539_10000276 Ga0081539_1000027616 233
5 3300005440 Ga0070705_100147639 Ga0070705_1001476393 239
6 3300005444 Ga0070694_100016570 Ga0070694_1000165702 239
7 3300005546 Ga0070696_100151196 Ga0070696_1001511962 239
8 3300005549 Ga0070704_100567076 Ga0070704_1005670761 239
9 3300006237 Ga0097621_100197542 Ga0097621_1001975422 239
10 3300046535 Ga0495586_0265942 Ga0495586_0265942_121_870 239
11 3300005468 Ga0070707_100354542 Ga0070707_1003545422 242
12 3300005547 Ga0070693_100326178 Ga0070693_1003261781 242
13 3300006852 Ga0075433_10058361 Ga0075433_100583614 242
14 3300006871 Ga0075434_100115306 Ga0075434_1001153061 242
15 3300006914 Ga0075436_100047042 Ga0075436_1000470422 242
16 3300007076 Ga0075435_100284687 Ga0075435_1002846872 242
17 3300025922 Ga0207646_10140271 Ga0207646_101402712 242
18 3300035112 Ga0373932_0039972 Ga0373932_0039972_126_857 242
19 3300035113 Ga0373936_0153410 Ga0373936_0153410_146_877 242
20 3300035691 Ga0373931_0012022 Ga0373931_0012022_2728_3459 242
21 3300035692 Ga0373935_0089216 Ga0373935_0089216_374_1105 242
22 3300042001 Ga0439441_000465 Ga0439441_000465_1920_2678 242
23 3300046528 Ga0495642_0076175 Ga0495642_0076175_53_784 242
24 3300049584 Ga0501068_0025922 Ga0501068_0025922_2602_3342 242
25 3300049587 Ga0501071_0060791 Ga0501071_0060791_866_1606 242
26 3300049590 Ga0501074_0129709 Ga0501074_0129709_1002_1742 242
27 3300049591 Ga0501075_0165259 Ga0501075_0165259_29_769 242
28 3300049741 Ga0501079_0095964 Ga0501079_0095964_716_1456 242
29 3300049742 Ga0501080_0016516 Ga0501080_0016516_2415_3155 242
30 3300049743 Ga0501081_0095359 Ga0501081_0095359_1006_1746 242
31 3300049822 Ga0501035_0598540 Ga0501035_0598540_128_868 242
32 3300050512 nmdc:mga0n895_77418_c1 nmdc:mga0n895_77418_c1_2392_3123 242
33 3300050513 nmdc:mga0rr50_547148_c1 nmdc:mga0rr50_547148_c1_175_906 242
34 3300050514 nmdc:mga08x19_287021_c1 nmdc:mga08x19_287021_c1_110_841 242
35 3300050514 nmdc:mga08x19_65067_c1 nmdc:mga08x19_65067_c1_361_1092 242
36 3300050515 nmdc:mga0a205_127493_c1 nmdc:mga0a205_127493_c1_831_1562 242
37 3300060353 Ga0501082_0096600 Ga0501082_0096600_1768_2508 242
38 3300005334 Ga0068869_100326918 Ga0068869_1003269182 243
39 3300005340 Ga0070689_100129762 Ga0070689_1001297622 243
40 3300005340 Ga0070689_100177658 Ga0070689_1001776582 243
41 3300005345 Ga0070692_10008978 Ga0070692_100089785 243
42 3300005364 Ga0070673_100308181 Ga0070673_1003081812 243
43 3300005440 Ga0070705_100002406 Ga0070705_1000024067 243
44 3300005440 Ga0070705_100077104 Ga0070705_1000771042 243
45 3300005444 Ga0070694_100003024 Ga0070694_1000030247 243
46 3300005444 Ga0070694_100020813 Ga0070694_1000208135 243
47 3300005444 Ga0070694_100070036 Ga0070694_1000700362 243
48 3300005444 Ga0070694_100078479 Ga0070694_1000784792 243
49 3300005458 Ga0070681_10000172 Ga0070681_1000017244 243
50 3300005459 Ga0068867_100744308 Ga0068867_1007443081 243
51 3300005536 Ga0070697_100020315 Ga0070697_1000203153 243
52 3300005545 Ga0070695_100002049 Ga0070695_10000204911 243
53 3300005545 Ga0070695_100065990 Ga0070695_1000659903 243
54 3300005545 Ga0070695_100214785 Ga0070695_1002147852 243
55 3300005546 Ga0070696_100005276 Ga0070696_1000052762 243
56 3300005549 Ga0070704_100035153 Ga0070704_1000351535 243
57 3300005549 Ga0070704_100077085 Ga0070704_1000770852 243
58 3300006173 Ga0070716_100045423 Ga0070716_1000454232 243
59 3300006846 Ga0075430_100000884 Ga0075430_10000088417 243
60 3300006847 Ga0075431_100176470 Ga0075431_1001764702 243
61 3300006847 Ga0075431_100185255 Ga0075431_1001852552 243
62 3300006852 Ga0075433_10212678 Ga0075433_102126782 243
63 3300006871 Ga0075434_100000211 Ga0075434_10000021129 243
64 3300006871 Ga0075434_100016970 Ga0075434_1000169706 243
65 3300006880 Ga0075429_100508065 Ga0075429_1005080652 243
66 3300006914 Ga0075436_100000711 Ga0075436_10000071119 243
67 3300006914 Ga0075436_100027470 Ga0075436_1000274704 243
68 3300006914 Ga0075436_100069536 Ga0075436_1000695362 243
69 3300006914 Ga0075436_100101108 Ga0075436_1001011082 243
70 3300007076 Ga0075435_100001401 Ga0075435_1000014017 243
71 3300007076 Ga0075435_100066389 Ga0075435_1000663893 243
72 3300007076 Ga0075435_100174083 Ga0075435_1001740831 243
73 3300007076 Ga0075435_100315110 Ga0075435_1003151102 243
74 3300007265 Ga0099794_10011740 Ga0099794_100117403 243
75 3300009094 Ga0111539_10276847 Ga0111539_102768472 243
76 3300009147 Ga0114129_10144836 Ga0114129_101448362 243
77 3300009147 Ga0114129_10193300 Ga0114129_101933002 243
78 3300009147 Ga0114129_10341567 Ga0114129_103415672 243
79 3300025912 Ga0207707_10004410 Ga0207707_1000441010 243
80 3300025917 Ga0207660_10139536 Ga0207660_101395362 243
81 3300025936 Ga0207670_10085644 Ga0207670_100856442 243
82 3300025939 Ga0207665_10068176 Ga0207665_100681762 243
83 3300027543 Ga0209999_1002349 Ga0209999_10023493 243
84 3300035086 Ga0373934_0006924 Ga0373934_0006924_1031_1765 243
85 3300035114 Ga0373939_0043306 Ga0373939_0043306_373_1107 243
86 3300035115 Ga0373941_0004843 Ga0373941_0004843_492_1226 243
87 3300035117 Ga0373953_0034679 Ga0373953_0034679_682_1416 243
88 3300035117 Ga0373953_0143884 Ga0373953_0143884_72_806 243
89 3300035118 Ga0373954_0000001 Ga0373954_0000001_108721_109455 243
90 3300035172 Ga0373955_0180942 Ga0373955_0180942_166_900 243
91 3300035691 Ga0373931_0009317 Ga0373931_0009317_939_1673 243
92 3300035724 Ga0373933_0121715 Ga0373933_0121715_267_1001 243
93 3300036401 Ga0373937_0001813 Ga0373937_0001813_7570_8304 243
94 3300036401 Ga0373937_0002345 Ga0373937_0002345_6888_7622 243
95 3300036401 Ga0373937_0439968 Ga0373937_0439968_274_1008 243
96 3300041408 Ga0439453_0007638 Ga0439453_0007638_800_1537 243
97 3300042435 Ga0439434_0020731 Ga0439434_0020731_852_1589 243
98 3300042436 Ga0439435_0000279 Ga0439435_0000279_3067_3804 243
99 3300042461 Ga0439460_0000486 Ga0439460_0000486_5840_6574 243
100 3300042876 Ga0451577_0070572 Ga0451577_0070572_1023_1781 243
101 3300044694 Ga0466963_0049261 Ga0466963_0049261_289_1032 243
102 3300044901 Ga0466960_0170475 Ga0466960_0170475_161_895 243
103 3300045051 Ga0451576_0192120 Ga0451576_0192120_934_1671 243
104 3300045051 Ga0451576_0879226 Ga0451576_0879226_144_878 243
105 3300045976 Ga0466967_0006376 Ga0466967_0006376_2498_3241 243
106 3300046454 Ga0495592_0000330 Ga0495592_0000330_33561_34295 243
107 3300046461 Ga0495641_0073365 Ga0495641_0073365_10_744 243
108 3300046463 Ga0495653_0069549 Ga0495653_0069549_126_860 243
109 3300046475 Ga0495639_0049815 Ga0495639_0049815_112_849 243
110 3300046475 Ga0495639_0235299 Ga0495639_0235299_25_759 243
111 3300046476 Ga0495662_0002692 Ga0495662_0002692_7240_7977 243
112 3300046476 Ga0495662_0007567 Ga0495662_0007567_4348_5082 243
113 3300046491 Ga0495584_0058855 Ga0495584_0058855_246_980 243
114 3300046511 Ga0495608_0000582 Ga0495608_0000582_8683_9417 243
115 3300046514 Ga0495618_0066558 Ga0495618_0066558_1411_2145 243
116 3300046516 Ga0495628_0001020 Ga0495628_0001020_1716_2450 243
117 3300046516 Ga0495628_0094005 Ga0495628_0094005_1048_1785 243
118 3300046517 Ga0495630_0003958 Ga0495630_0003958_4181_4915 243
119 3300046517 Ga0495630_0046196 Ga0495630_0046196_1227_1964 243
120 3300046526 Ga0495666_0109256 Ga0495666_0109256_452_1186 243
121 3300046529 Ga0495652_0190348 Ga0495652_0190348_467_1201 243
122 3300046533 Ga0495640_0000361 Ga0495640_0000361_9330_10064 243
123 3300046533 Ga0495640_0024765 Ga0495640_0024765_2521_3258 243
124 3300046535 Ga0495586_0001795 Ga0495586_0001795_5668_6402 243
125 3300046535 Ga0495586_0044524 Ga0495586_0044524_1604_2341 243
126 3300046536 Ga0495587_0087447 Ga0495587_0087447_154_888 243
127 3300046537 Ga0495598_0079200 Ga0495598_0079200_17_751 243
128 3300046539 Ga0495621_0027665 Ga0495621_0027665_610_1344 243
129 3300046543 Ga0495645_0072058 Ga0495645_0072058_311_1045 243
130 3300046559 Ga0495667_0001990 Ga0495667_0001990_9542_10276 243
131 3300046642 Ga0495634_0002172 Ga0495634_0002172_5729_6463 243
132 3300046663 Ga0495635_0056609 Ga0495635_0056609_1823_2557 243
133 3300046678 Ga0495599_0004361 Ga0495599_0004361_2216_2950 243
134 3300046683 Ga0495658_0012080 Ga0495658_0012080_3614_4348 243
135 3300046684 Ga0495669_0010134 Ga0495669_0010134_597_1331 243
136 3300046689 Ga0495613_0003055 Ga0495613_0003055_6076_6810 243
137 3300046690 Ga0495624_0036328 Ga0495624_0036328_1139_1873 243
138 3300046690 Ga0495624_0105254 Ga0495624_0105254_172_909 243
139 3300046809 Ga0495600_0001984 Ga0495600_0001984_7539_8273 243
140 3300047317 Ga0495604_0016454 Ga0495604_0016454_2173_2907 243
141 3300047319 Ga0495674_0228737 Ga0495674_0228737_606_1343 243
142 3300047471 Ga0495684_0049112 Ga0495684_0049112_503_1237 243
143 3300047471 Ga0495684_0184485 Ga0495684_0184485_664_1401 243
144 3300048089 Ga0495614_0255553 Ga0495614_0255553_39_773 243
145 3300049572 Ga0501036_0300178 Ga0501036_0300178_367_1101 243
146 3300049574 Ga0501038_0044336 Ga0501038_0044336_1792_2526 243
147 3300049575 Ga0501039_0095921 Ga0501039_0095921_892_1626 243
148 3300049576 Ga0501040_0024223 Ga0501040_0024223_3030_3764 243
149 3300049578 Ga0501042_0082379 Ga0501042_0082379_899_1633 243
150 3300049580 Ga0501046_0216432 Ga0501046_0216432_644_1378 243
151 3300049582 Ga0501048_0019035 Ga0501048_0019035_433_1167 243
152 3300049583 Ga0501067_0291931 Ga0501067_0291931_41_775 243
153 3300049584 Ga0501068_0115308 Ga0501068_0115308_20_844 243
154 3300049588 Ga0501072_0028349 Ga0501072_0028349_1012_1746 243
155 3300049588 Ga0501072_0095954 Ga0501072_0095954_1066_1800 243
156 3300049591 Ga0501075_0099209 Ga0501075_0099209_308_1042 243
157 3300049592 Ga0501076_0013791 Ga0501076_0013791_4307_5041 243
158 3300049593 Ga0501077_0012845 Ga0501077_0012845_965_1699 243
159 3300049741 Ga0501079_0008396 Ga0501079_0008396_5331_6065 243
160 3300049742 Ga0501080_0108304 Ga0501080_0108304_1604_2338 243
161 3300049824 Ga0501045_0023408 Ga0501045_0023408_1258_1992 243
162 3300050507 nmdc:mga05p37_347136_c1 nmdc:mga05p37_347136_c1_825_1559 243
163 3300050507 nmdc:mga05p37_899805_c1 nmdc:mga05p37_899805_c1_101_835 243
164 3300050508 nmdc:mga09592_460460_c1 nmdc:mga09592_460460_c1_160_894 243
165 3300050508 nmdc:mga09592_825967_c1 nmdc:mga09592_825967_c1_13_747 243
166 3300050509 nmdc:mga0qj67_2203_c1 nmdc:mga0qj67_2203_c1_4363_5097 243
167 3300050511 nmdc:mga08y16_269396_c1 nmdc:mga08y16_269396_c1_653_1387 243
168 3300050512 nmdc:mga0n895_370168_c1 nmdc:mga0n895_370168_c1_198_932 243
169 3300050512 nmdc:mga0n895_612_c1 nmdc:mga0n895_612_c1_16212_16943 243
170 3300050512 nmdc:mga0n895_8791_c1 nmdc:mga0n895_8791_c1_4700_5437 243
171 3300050513 nmdc:mga0rr50_1855_c1 nmdc:mga0rr50_1855_c1_6736_7467 243
172 3300050513 nmdc:mga0rr50_19679_c1 nmdc:mga0rr50_19679_c1_1504_2238 243
173 3300050513 nmdc:mga0rr50_308827_c1 nmdc:mga0rr50_308827_c1_239_973 243
174 3300050513 nmdc:mga0rr50_323552_c1 nmdc:mga0rr50_323552_c1_117_851 243
175 3300050514 nmdc:mga08x19_1378_c1 nmdc:mga08x19_1378_c1_6622_7356 243
176 3300050514 nmdc:mga08x19_17807_c2 nmdc:mga08x19_17807_c2_1242_1973 243
177 3300050514 nmdc:mga08x19_316851_c1 nmdc:mga08x19_316851_c1_35_769 243
178 3300050514 nmdc:mga08x19_7642_c1 nmdc:mga08x19_7642_c1_160_894 243
179 3300050515 nmdc:mga0a205_210617_c1 nmdc:mga0a205_210617_c1_899_1633 243
180 3300050515 nmdc:mga0a205_296994_c1 nmdc:mga0a205_296994_c1_685_1416 243
181 3300050515 nmdc:mga0a205_451017_c1 nmdc:mga0a205_451017_c1_155_892 243
182 3300053085 Ga0495619_0068447 Ga0495619_0068447_329_1063 243
183 3300054114 Ga0501084_0055700 Ga0501084_0055700_1234_1968 243
184 3300060353 Ga0501082_0024956 Ga0501082_0024956_1263_1997 243
185 3300060353 Ga0501082_0359979 Ga0501082_0359979_318_1052 243
186 3300061734 Ga0530510_0016725 Ga0530510_0016725_3302_4036 243
187 3300005328 Ga0070676_10173691 Ga0070676_101736912 244
188 3300005330 Ga0070690_100029275 Ga0070690_1000292752 244
189 3300005330 Ga0070690_100068617 Ga0070690_1000686172 244
190 3300005334 Ga0068869_100000410 Ga0068869_10000041019 244
191 3300005334 Ga0068869_100022479 Ga0068869_1000224793 244
192 3300005334 Ga0068869_100100605 Ga0068869_1001006052 244
193 3300005335 Ga0070666_10233438 Ga0070666_102334382 244
194 3300005336 Ga0070680_100005249 Ga0070680_1000052498 244
195 3300005337 Ga0070682_100003219 Ga0070682_1000032197 244
196 3300005338 Ga0068868_100008650 Ga0068868_10000865011 244
197 3300005340 Ga0070689_100032214 Ga0070689_1000322144 244
198 3300005340 Ga0070689_100054939 Ga0070689_1000549394 244
199 3300005341 Ga0070691_10005779 Ga0070691_100057795 244
200 3300005343 Ga0070687_100000044 Ga0070687_1000000447 244
201 3300005343 Ga0070687_100335566 Ga0070687_1003355661 244
202 3300005345 Ga0070692_10023760 Ga0070692_100237602 244
203 3300005345 Ga0070692_10122526 Ga0070692_101225261 244
204 3300005353 Ga0070669_100005395 Ga0070669_10000539510 244
205 3300005354 Ga0070675_100023531 Ga0070675_1000235317 244
206 3300005355 Ga0070671_100117822 Ga0070671_1001178222 244
207 3300005439 Ga0070711_100350347 Ga0070711_1003503472 244
208 3300005440 Ga0070705_100003242 Ga0070705_1000032422 244
209 3300005441 Ga0070700_100000953 Ga0070700_1000009537 244
210 3300005441 Ga0070700_100084758 Ga0070700_1000847582 244
211 3300005441 Ga0070700_100206428 Ga0070700_1002064281 244
212 3300005444 Ga0070694_100000077 Ga0070694_10000007716 244
213 3300005458 Ga0070681_10648373 Ga0070681_106483731 244
214 3300005459 Ga0068867_100000107 Ga0068867_10000010736 244
215 3300005471 Ga0070698_100022050 Ga0070698_1000220503 244
216 3300005518 Ga0070699_100431187 Ga0070699_1004311871 244
217 3300005530 Ga0070679_100008900 Ga0070679_10000890012 244
218 3300005530 Ga0070679_100639253 Ga0070679_1006392532 244
219 3300005535 Ga0070684_100070915 Ga0070684_1000709152 244
220 3300005536 Ga0070697_100000484 Ga0070697_10000048428 244
221 3300005539 Ga0068853_100092728 Ga0068853_1000927282 244
222 3300005544 Ga0070686_100000168 Ga0070686_10000016838 244
223 3300005544 Ga0070686_100038971 Ga0070686_1000389712 244
224 3300005544 Ga0070686_100307504 Ga0070686_1003075042 244
225 3300005545 Ga0070695_100000956 Ga0070695_10000095612 244
226 3300005546 Ga0070696_100001446 Ga0070696_10000144612 244
227 3300005547 Ga0070693_100000040 Ga0070693_10000004040 244
228 3300005549 Ga0070704_100000120 Ga0070704_1000001207 244
229 3300005549 Ga0070704_100058372 Ga0070704_1000583723 244
230 3300005563 Ga0068855_100005158 Ga0068855_1000051582 244
231 3300005578 Ga0068854_100043227 Ga0068854_1000432272 244
232 3300005614 Ga0068856_100082293 Ga0068856_1000822932 244
233 3300005614 Ga0068856_100104245 Ga0068856_1001042452 244
234 3300005615 Ga0070702_100000050 Ga0070702_10000005030 244
235 3300005615 Ga0070702_100036864 Ga0070702_1000368642 244
236 3300005616 Ga0068852_100033221 Ga0068852_1000332213 244
237 3300005617 Ga0068859_100000332 Ga0068859_10000033222 244
238 3300005618 Ga0068864_100135062 Ga0068864_1001350622 244
239 3300005719 Ga0068861_100000100 Ga0068861_10000010026 244
240 3300005719 Ga0068861_100407274 Ga0068861_1004072742 244
241 3300005719 Ga0068861_100413816 Ga0068861_1004138162 244
242 3300005840 Ga0068870_10069275 Ga0068870_100692752 244
243 3300005840 Ga0068870_10073405 Ga0068870_100734052 244
244 3300005841 Ga0068863_100977570 Ga0068863_1009775701 244
245 3300005841 Ga0068863_101080348 Ga0068863_1010803481 244
246 3300005842 Ga0068858_100000941 Ga0068858_10000094111 244
247 3300005842 Ga0068858_100030040 Ga0068858_1000300406 244
248 3300005843 Ga0068860_100000773 Ga0068860_1000007732 244
249 3300005844 Ga0068862_100021482 Ga0068862_1000214822 244
250 3300005844 Ga0068862_100021620 Ga0068862_1000216207 244
251 3300005981 Ga0081538_10183878 Ga0081538_101838782 244
252 3300006173 Ga0070716_100055456 Ga0070716_1000554562 244
253 3300006237 Ga0097621_100002104 Ga0097621_1000021045 244
254 3300006237 Ga0097621_100007190 Ga0097621_1000071904 244
255 3300006358 Ga0068871_100000238 Ga0068871_10000023825 244
256 3300006358 Ga0068871_100003779 Ga0068871_10000377913 244
257 3300006844 Ga0075428_100002555 Ga0075428_10000255517 244
258 3300006844 Ga0075428_100017193 Ga0075428_1000171937 244
259 3300006844 Ga0075428_100121466 Ga0075428_1001214664 244
260 3300006846 Ga0075430_100014853 Ga0075430_1000148532 244
261 3300006846 Ga0075430_100106842 Ga0075430_1001068422 244
262 3300006846 Ga0075430_100114832 Ga0075430_1001148322 244
263 3300006846 Ga0075430_100586179 Ga0075430_1005861791 244
264 3300006846 Ga0075430_100601249 Ga0075430_1006012492 244
265 3300006847 Ga0075431_100009882 Ga0075431_1000098823 244
266 3300006847 Ga0075431_100177686 Ga0075431_1001776863 244
267 3300006847 Ga0075431_100316277 Ga0075431_1003162772 244
268 3300006847 Ga0075431_100358378 Ga0075431_1003583782 244
269 3300006852 Ga0075433_10004807 Ga0075433_1000480711 244
270 3300006871 Ga0075434_100003303 Ga0075434_1000033034 244
271 3300006880 Ga0075429_100000463 Ga0075429_10000046325 244
272 3300006880 Ga0075429_100000575 Ga0075429_1000005756 244
273 3300006880 Ga0075429_100290515 Ga0075429_1002905152 244
274 3300006881 Ga0068865_100000142 Ga0068865_1000001427 244
275 3300006914 Ga0075436_100042857 Ga0075436_1000428573 244
276 3300006931 Ga0097620_100000332 Ga0097620_10000033231 244
277 3300006931 Ga0097620_100072524 Ga0097620_1000725242 244
278 3300007076 Ga0075435_100000118 Ga0075435_10000011841 244
279 3300007265 Ga0099794_10018153 Ga0099794_100181534 244
280 3300009092 Ga0105250_10146599 Ga0105250_101465991 244
281 3300009094 Ga0111539_10065805 Ga0111539_100658052 244
282 3300009094 Ga0111539_10221213 Ga0111539_102212132 244
283 3300009094 Ga0111539_10242976 Ga0111539_102429761 244
284 3300009098 Ga0105245_10000115 Ga0105245_1000011541 244
285 3300009147 Ga0114129_10004402 Ga0114129_100044027 244
286 3300009147 Ga0114129_10018075 Ga0114129_100180753 244
287 3300009147 Ga0114129_10072631 Ga0114129_100726316 244
288 3300009148 Ga0105243_10000035 Ga0105243_1000003514 244
289 3300009148 Ga0105243_10389244 Ga0105243_103892442 244
290 3300009174 Ga0105241_10190576 Ga0105241_101905762 244
291 3300009176 Ga0105242_10000268 Ga0105242_1000026824 244
292 3300009553 Ga0105249_10001725 Ga0105249_100017257 244
293 3300009553 Ga0105249_10016872 Ga0105249_100168727 244
294 3300010375 Ga0105239_10315968 Ga0105239_103159682 244
295 3300013297 Ga0157378_10001006 Ga0157378_1000100624 244
296 3300013306 Ga0163162_10375743 Ga0163162_103757432 244
297 3300013307 Ga0157372_10436919 Ga0157372_104369191 244
298 3300013308 Ga0157375_10114851 Ga0157375_101148514 244
299 3300014326 Ga0157380_10034856 Ga0157380_100348565 244
300 3300014326 Ga0157380_10038962 Ga0157380_100389622 244
301 3300014745 Ga0157377_10023079 Ga0157377_100230792 244
302 3300014968 Ga0157379_10119529 Ga0157379_101195292 244
303 3300014969 Ga0157376_10000582 Ga0157376_1000058215 244
304 3300014969 Ga0157376_10012402 Ga0157376_100124025 244
305 3300025899 Ga0207642_10000374 Ga0207642_100003745 244
306 3300025901 Ga0207688_10075767 Ga0207688_100757672 244
307 3300025904 Ga0207647_10129366 Ga0207647_101293662 244
308 3300025907 Ga0207645_10252761 Ga0207645_102527611 244
309 3300025908 Ga0207643_10034524 Ga0207643_100345245 244
310 3300025908 Ga0207643_10048836 Ga0207643_100488362 244
311 3300025911 Ga0207654_10099707 Ga0207654_100997072 244
312 3300025917 Ga0207660_10010257 Ga0207660_100102572 244
313 3300025918 Ga0207662_10000061 Ga0207662_1000006141 244
314 3300025918 Ga0207662_10093240 Ga0207662_100932402 244
315 3300025918 Ga0207662_10154700 Ga0207662_101547002 244
316 3300025921 Ga0207652_10008890 Ga0207652_100088902 244
317 3300025926 Ga0207659_10088536 Ga0207659_100885363 244
318 3300025927 Ga0207687_10002769 Ga0207687_1000276912 244
319 3300025934 Ga0207686_10001105 Ga0207686_100011057 244
320 3300025935 Ga0207709_10003264 Ga0207709_100032642 244
321 3300025935 Ga0207709_10027953 Ga0207709_100279535 244
322 3300025936 Ga0207670_10000311 Ga0207670_1000031113 244
323 3300025936 Ga0207670_10012235 Ga0207670_100122356 244
324 3300025938 Ga0207704_10000141 Ga0207704_1000014131 244
325 3300025938 Ga0207704_10386168 Ga0207704_103861682 244
326 3300025940 Ga0207691_10141707 Ga0207691_101417072 244
327 3300025942 Ga0207689_10000024 Ga0207689_100000247 244
328 3300025942 Ga0207689_10016219 Ga0207689_100162197 244
329 3300025942 Ga0207689_10079658 Ga0207689_100796582 244
330 3300025949 Ga0207667_10001264 Ga0207667_1000126422 244
331 3300025961 Ga0207712_10011070 Ga0207712_100110704 244
332 3300025981 Ga0207640_10008300 Ga0207640_100083002 244
333 3300026023 Ga0207677_10003198 Ga0207677_1000319812 244
334 3300026023 Ga0207677_10516971 Ga0207677_105169712 244
335 3300026035 Ga0207703_10002833 Ga0207703_1000283316 244
336 3300026035 Ga0207703_10078985 Ga0207703_100789852 244
337 3300026041 Ga0207639_10197022 Ga0207639_101970222 244
338 3300026075 Ga0207708_10000905 Ga0207708_1000090522 244
339 3300026075 Ga0207708_10014623 Ga0207708_100146233 244
340 3300026078 Ga0207702_10003642 Ga0207702_100036422 244
341 3300026088 Ga0207641_10230178 Ga0207641_102301782 244
342 3300026089 Ga0207648_10000113 Ga0207648_1000011357 244
343 3300026089 Ga0207648_10014691 Ga0207648_100146918 244
344 3300026089 Ga0207648_10419777 Ga0207648_104197772 244
345 3300026095 Ga0207676_10116173 Ga0207676_101161732 244
346 3300026118 Ga0207675_100000017 Ga0207675_100000017115 244
347 3300026118 Ga0207675_100045031 Ga0207675_1000450315 244
348 3300026142 Ga0207698_10038396 Ga0207698_100383962 244
349 3300027360 Ga0209969_1007012 Ga0209969_10070122 244
350 3300027378 Ga0209981_1020587 Ga0209981_10205872 244
351 3300027395 Ga0209996_1020828 Ga0209996_10208282 244
352 3300027462 Ga0210000_1008026 Ga0210000_10080262 244
353 3300027471 Ga0209995_1003227 Ga0209995_10032272 244
354 3300027471 Ga0209995_1004282 Ga0209995_10042823 244
355 3300027526 Ga0209968_1001351 Ga0209968_10013514 244
356 3300027543 Ga0209999_1005187 Ga0209999_10051871 244
357 3300027543 Ga0209999_1012000 Ga0209999_10120002 244
358 3300027543 Ga0209999_1022188 Ga0209999_10221882 244
359 3300027665 Ga0209983_1003590 Ga0209983_10035903 244
360 3300027682 Ga0209971_1001237 Ga0209971_10012372 244
361 3300027876 Ga0209974_10016607 Ga0209974_100166073 244
362 3300027907 Ga0207428_10005014 Ga0207428_1000501413 244
363 3300027907 Ga0207428_10084062 Ga0207428_100840622 244
364 3300027907 Ga0207428_10259499 Ga0207428_102594992 244
365 3300028380 Ga0268265_10002990 Ga0268265_100029909 244
366 3300028380 Ga0268265_10060294 Ga0268265_100602945 244
367 3300028380 Ga0268265_10241045 Ga0268265_102410452 244
368 3300028380 Ga0268265_10355480 Ga0268265_103554802 244
369 3300028381 Ga0268264_10001524 Ga0268264_1000152410 244
370 3300028381 Ga0268264_10285629 Ga0268264_102856292 244
371 3300031665 Ga0316575_10000505 Ga0316575_100005057 244
372 3300031691 Ga0316579_10014289 Ga0316579_100142895 244
373 3300031728 Ga0316578_10271358 Ga0316578_102713581 244
374 3300031911 Ga0307412_10367257 Ga0307412_103672572 244
375 3300031995 Ga0307409_100251963 Ga0307409_1002519632 244
376 3300031995 Ga0307409_100386688 Ga0307409_1003866882 244
377 3300032002 Ga0307416_100165705 Ga0307416_1001657052 244
378 3300032005 Ga0307411_10801391 Ga0307411_108013911 244
379 3300032133 Ga0316583_10003377 Ga0316583_100033773 244
380 3300035083 Ga0373926_0030787 Ga0373926_0030787_936_1673 244
381 3300035086 Ga0373934_0096374 Ga0373934_0096374_100_837 244
382 3300035090 Ga0373949_0013319 Ga0373949_0013319_69_806 244
383 3300035111 Ga0373923_0041536 Ga0373923_0041536_958_1695 244
384 3300035114 Ga0373939_0010873 Ga0373939_0010873_463_1200 244
385 3300035115 Ga0373941_0002545 Ga0373941_0002545_1079_1816 244
386 3300035117 Ga0373953_0016723 Ga0373953_0016723_544_1281 244
387 3300035118 Ga0373954_0228272 Ga0373954_0228272_33_770 244
388 3300035119 Ga0373956_0010377 Ga0373956_0010377_2318_3055 244
389 3300035121 Ga0373960_0007807 Ga0373960_0007807_1248_1985 244
390 3300035170 Ga0373943_0002039 Ga0373943_0002039_7802_8539 244
391 3300035170 Ga0373943_0151230 Ga0373943_0151230_353_1090 244
392 3300035171 Ga0373946_0046399 Ga0373946_0046399_336_1073 244
393 3300035172 Ga0373955_0113922 Ga0373955_0113922_461_1198 244
394 3300035172 Ga0373955_0194502 Ga0373955_0194502_364_1101 244
395 3300035398 Ga0316574_0002756 Ga0316574_0002756_3631_4392 244
396 3300035410 Ga0373924_0004289 Ga0373924_0004289_3527_4264 244
397 3300035691 Ga0373931_0000559 Ga0373931_0000559_10702_11439 244
398 3300035691 Ga0373931_0057355 Ga0373931_0057355_113_850 244
399 3300035691 Ga0373931_0076511 Ga0373931_0076511_1056_1793 244
400 3300035692 Ga0373935_0163710 Ga0373935_0163710_59_796 244
401 3300035695 Ga0373927_0087015 Ga0373927_0087015_702_1439 244
402 3300035724 Ga0373933_0003218 Ga0373933_0003218_8184_8921 244
403 3300035724 Ga0373933_0040548 Ga0373933_0040548_417_1154 244
404 3300035725 Ga0373947_0008402 Ga0373947_0008402_628_1365 244
405 3300036401 Ga0373937_0071623 Ga0373937_0071623_1071_1808 244
406 3300036401 Ga0373937_0525816 Ga0373937_0525816_293_1030 244
407 3300036647 Ga0316582_0000598 Ga0316582_0000598_12012_12773 244
408 3300036712 Ga0316584_0242036 Ga0316584_0242036_138_899 244
409 3300037068 Ga0373925_0034353 Ga0373925_0034353_2706_3443 244
410 3300037068 Ga0373925_0067316 Ga0373925_0067316_1400_2137 244
411 3300037588 Ga0316581_0001270 Ga0316581_0001270_635_1396 244
412 3300041486 Ga0451807_2701969 Ga0451807_2701969_83_820 244
413 3300042001 Ga0439441_002134 Ga0439441_002134_1395_2132 244
414 3300042133 Ga0450896_023358 Ga0450896_023358_153_890 244
415 3300042436 Ga0439435_0017083 Ga0439435_0017083_641_1378 244
416 3300045051 Ga0451576_0005105 Ga0451576_0005105_12297_13034 244
417 3300045051 Ga0451576_0019832 Ga0451576_0019832_3690_4427 244
418 3300045051 Ga0451576_0049046 Ga0451576_0049046_160_921 244
419 3300046455 Ga0495603_0012521 Ga0495603_0012521_377_1114 244
420 3300046472 Ga0495580_0041741 Ga0495580_0041741_1956_2693 244
421 3300046473 Ga0495582_0077028 Ga0495582_0077028_602_1339 244
422 3300046475 Ga0495639_0025059 Ga0495639_0025059_615_1352 244
423 3300046511 Ga0495608_0175473 Ga0495608_0175473_254_991 244
424 3300046535 Ga0495586_0013669 Ga0495586_0013669_423_1160 244
425 3300046537 Ga0495598_0007379 Ga0495598_0007379_38_775 244
426 3300046559 Ga0495667_0009994 Ga0495667_0009994_4585_5322 244
427 3300046615 Ga0495656_0023407 Ga0495656_0023407_156_893 244
428 3300046664 Ga0495659_0005103 Ga0495659_0005103_137_874 244
429 3300046675 Ga0495657_0170146 Ga0495657_0170146_159_896 244
430 3300046681 Ga0495647_0003144 Ga0495647_0003144_356_1093 244
431 3300046683 Ga0495658_0049210 Ga0495658_0049210_1000_1737 244
432 3300046684 Ga0495669_0038353 Ga0495669_0038353_800_1534 244
433 3300046691 Ga0495670_0096505 Ga0495670_0096505_163_900 244
434 3300047321 Ga0495676_0079122 Ga0495676_0079122_495_1232 244
435 3300047322 Ga0495680_0191493 Ga0495680_0191493_533_1270 244
436 3300049568 Ga0501031_0017804 Ga0501031_0017804_3801_4538 244
437 3300049568 Ga0501031_0117445 Ga0501031_0117445_697_1434 244
438 3300049569 Ga0501032_0047701 Ga0501032_0047701_1260_1997 244
439 3300049570 Ga0501033_0001537 Ga0501033_0001537_9720_10457 244
440 3300049572 Ga0501036_0024904 Ga0501036_0024904_554_1291 244
441 3300049572 Ga0501036_0069178 Ga0501036_0069178_966_1703 244
442 3300049573 Ga0501037_0007957 Ga0501037_0007957_6385_7122 244
443 3300049574 Ga0501038_0000396 Ga0501038_0000396_28606_29343 244
444 3300049574 Ga0501038_0071808 Ga0501038_0071808_1718_2479 244
445 3300049574 Ga0501038_0078140 Ga0501038_0078140_478_1215 244
446 3300049574 Ga0501038_0647186 Ga0501038_0647186_28_765 244
447 3300049575 Ga0501039_0002363 Ga0501039_0002363_9306_10043 244
448 3300049575 Ga0501039_0012456 Ga0501039_0012456_3103_3840 244
449 3300049575 Ga0501039_0044316 Ga0501039_0044316_2146_2883 244
450 3300049576 Ga0501040_0005983 Ga0501040_0005983_4257_4994 244
451 3300049576 Ga0501040_0112013 Ga0501040_0112013_447_1184 244
452 3300049576 Ga0501040_0203656 Ga0501040_0203656_202_939 244
453 3300049577 Ga0501041_0000044 Ga0501041_0000044_597_1334 244
454 3300049577 Ga0501041_0021620 Ga0501041_0021620_1382_2143 244
455 3300049577 Ga0501041_0033004 Ga0501041_0033004_303_1040 244
456 3300049578 Ga0501042_0002115 Ga0501042_0002115_5225_5962 244
457 3300049578 Ga0501042_0017074 Ga0501042_0017074_2641_3402 244
458 3300049578 Ga0501042_0097860 Ga0501042_0097860_806_1543 244
459 3300049578 Ga0501042_0200155 Ga0501042_0200155_418_1155 244
460 3300049578 Ga0501042_0228423 Ga0501042_0228423_339_1076 244
461 3300049579 Ga0501043_0042369 Ga0501043_0042369_2507_3244 244
462 3300049580 Ga0501046_0004953 Ga0501046_0004953_10905_11642 244
463 3300049580 Ga0501046_0144543 Ga0501046_0144543_175_936 244
464 3300049580 Ga0501046_0152656 Ga0501046_0152656_57_794 244
465 3300049581 Ga0501047_0111805 Ga0501047_0111805_675_1412 244
466 3300049582 Ga0501048_0001832 Ga0501048_0001832_8666_9403 244
467 3300049582 Ga0501048_0015381 Ga0501048_0015381_3490_4251 244
468 3300049582 Ga0501048_0052990 Ga0501048_0052990_2105_2842 244
469 3300049582 Ga0501048_0092179 Ga0501048_0092179_181_918 244
470 3300049582 Ga0501048_0327567 Ga0501048_0327567_171_908 244
471 3300049584 Ga0501068_0001598 Ga0501068_0001598_35_772 244
472 3300049586 Ga0501070_0046406 Ga0501070_0046406_584_1321 244
473 3300049587 Ga0501071_0001606 Ga0501071_0001606_8444_9181 244
474 3300049587 Ga0501071_0002455 Ga0501071_0002455_9018_9779 244
475 3300049587 Ga0501071_0081484 Ga0501071_0081484_670_1407 244
476 3300049587 Ga0501071_0166504 Ga0501071_0166504_33_770 244
477 3300049587 Ga0501071_0439923 Ga0501071_0439923_25_762 244
478 3300049588 Ga0501072_0002962 Ga0501072_0002962_64_825 244
479 3300049588 Ga0501072_0004090 Ga0501072_0004090_5085_5822 244
480 3300049588 Ga0501072_0197117 Ga0501072_0197117_512_1249 244
481 3300049588 Ga0501072_0202246 Ga0501072_0202246_90_827 244
482 3300049588 Ga0501072_0314370 Ga0501072_0314370_320_1057 244
483 3300049589 Ga0501073_0137115 Ga0501073_0137115_586_1347 244
484 3300049590 Ga0501074_0003394 Ga0501074_0003394_1769_2506 244
485 3300049590 Ga0501074_0207703 Ga0501074_0207703_162_923 244
486 3300049590 Ga0501074_0316769 Ga0501074_0316769_268_1005 244
487 3300049591 Ga0501075_0000475 Ga0501075_0000475_13407_14144 244
488 3300049591 Ga0501075_0001610 Ga0501075_0001610_5431_6192 244
489 3300049591 Ga0501075_0074123 Ga0501075_0074123_1607_2344 244
490 3300049591 Ga0501075_0298124 Ga0501075_0298124_137_898 244
491 3300049591 Ga0501075_0466272 Ga0501075_0466272_183_920 244
492 3300049591 Ga0501075_0583884 Ga0501075_0583884_91_828 244
493 3300049592 Ga0501076_0000508 Ga0501076_0000508_15426_16163 244
494 3300049592 Ga0501076_0001071 Ga0501076_0001071_7264_8025 244
495 3300049592 Ga0501076_0142017 Ga0501076_0142017_242_988 244
496 3300049592 Ga0501076_0157158 Ga0501076_0157158_185_922 244
497 3300049593 Ga0501077_0001283 Ga0501077_0001283_4855_5592 244
498 3300049593 Ga0501077_0038545 Ga0501077_0038545_534_1295 244
499 3300049593 Ga0501077_0073810 Ga0501077_0073810_485_1222 244
500 3300049741 Ga0501079_0000184 Ga0501079_0000184_9321_10058 244
501 3300049741 Ga0501079_0018472 Ga0501079_0018472_3202_3963 244
502 3300049741 Ga0501079_0484422 Ga0501079_0484422_33_779 244
503 3300049742 Ga0501080_0024339 Ga0501080_0024339_4830_5591 244
504 3300049742 Ga0501080_0061307 Ga0501080_0061307_2467_3204 244
505 3300049743 Ga0501081_0000384 Ga0501081_0000384_10147_10884 244
506 3300049743 Ga0501081_0057966 Ga0501081_0057966_1127_1864 244
507 3300049743 Ga0501081_0306371 Ga0501081_0306371_108_854 244
508 3300049743 Ga0501081_0399771 Ga0501081_0399771_64_801 244
509 3300049822 Ga0501035_0180403 Ga0501035_0180403_740_1477 244
510 3300049823 Ga0501044_0241769 Ga0501044_0241769_927_1664 244
511 3300049824 Ga0501045_0000572 Ga0501045_0000572_15666_16403 244
512 3300049824 Ga0501045_0008941 Ga0501045_0008941_3180_3941 244
513 3300049824 Ga0501045_0011965 Ga0501045_0011965_2061_2798 244
514 3300049824 Ga0501045_0044323 Ga0501045_0044323_395_1156 244
515 3300049824 Ga0501045_0045392 Ga0501045_0045392_1426_2163 244
516 3300049824 Ga0501045_0082563 Ga0501045_0082563_260_997 244
517 3300049824 Ga0501045_0288609 Ga0501045_0288609_293_1039 244
518 3300050507 nmdc:mga05p37_21359_c1 nmdc:mga05p37_21359_c1_960_1721 244
519 3300050507 nmdc:mga05p37_52919_c1 nmdc:mga05p37_52919_c1_478_1215 244
520 3300050507 nmdc:mga05p37_943_c1 nmdc:mga05p37_943_c1_23789_24526 244
521 3300050508 nmdc:mga09592_134570_c1 nmdc:mga09592_134570_c1_401_1138 244
522 3300050508 nmdc:mga09592_1507_c1 nmdc:mga09592_1507_c1_11765_12526 244
523 3300050508 nmdc:mga09592_1889_c1 nmdc:mga09592_1889_c1_10707_11444 244
524 3300050508 nmdc:mga09592_227047_c1 nmdc:mga09592_227047_c1_733_1470 244
525 3300050509 nmdc:mga0qj67_100223_c1 nmdc:mga0qj67_100223_c1_436_1173 244
526 3300050509 nmdc:mga0qj67_10463_c1 nmdc:mga0qj67_10463_c1_637_1383 244
527 3300050509 nmdc:mga0qj67_158448_c1 nmdc:mga0qj67_158448_c1_93_830 244
528 3300050510 nmdc:mga06r32_16270_c1 nmdc:mga06r32_16270_c1_4016_4777 244
529 3300050510 nmdc:mga06r32_305936_c1 nmdc:mga06r32_305936_c1_192_938 244
530 3300050510 nmdc:mga06r32_380877_c1 nmdc:mga06r32_380877_c1_462_1223 244
531 3300050511 nmdc:mga08y16_107679_c1 nmdc:mga08y16_107679_c1_1715_2449 244
532 3300050511 nmdc:mga08y16_199643_c1 nmdc:mga08y16_199643_c1_477_1211 244
533 3300050511 nmdc:mga08y16_356037_c1 nmdc:mga08y16_356037_c1_647_1381 244
534 3300050511 nmdc:mga08y16_464959_c1 nmdc:mga08y16_464959_c1_526_1272 244
535 3300050511 nmdc:mga08y16_6221_c1 nmdc:mga08y16_6221_c1_3773_4510 244
536 3300050512 nmdc:mga0n895_546501_c1 nmdc:mga0n895_546501_c1_376_1122 244
537 3300050512 nmdc:mga0n895_774_c1 nmdc:mga0n895_774_c1_10028_10765 244
538 3300050513 nmdc:mga0rr50_2798_c1 nmdc:mga0rr50_2798_c1_5630_6367 244
539 3300050514 nmdc:mga08x19_7535_c1 nmdc:mga08x19_7535_c1_4348_5085 244
540 3300050515 nmdc:mga0a205_1692_c1 nmdc:mga0a205_1692_c1_6902_7639 244
541 3300050515 nmdc:mga0a205_189483_c1 nmdc:mga0a205_189483_c1_972_1709 244
542 3300054114 Ga0501084_0000800 Ga0501084_0000800_14845_15582 244
543 3300054114 Ga0501084_0003320 Ga0501084_0003320_8121_8882 244
544 3300060353 Ga0501082_0007037 Ga0501082_0007037_203_940 244
545 3300060353 Ga0501082_0032392 Ga0501082_0032392_1548_2309 244
546 3300061734 Ga0530510_0000383 Ga0530510_0000383_18709_19446 244
547 3300061734 Ga0530510_0002976 Ga0530510_0002976_3491_4252 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

6

147

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

143

232

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

146

0.9

PF08659

KR

KR domain

7

154

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sy8-assembly1.cif.gz_B-2 crystal structure of tsac 0.9092 3 240
8sy8-assembly1.cif.gz_B-2 crystal structure of tsac 0.9007 3 240
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.8985 1 242
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.8944 1 242
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.8936 1 242
ID Description Score Start End Superfamily
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9161 2 89 3.40.50.720
af_A0A1D6Q3A1_14_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9146 6 109 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9058 5 50 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9013 2 72 3.40.50.720
af_Q0ISZ5_12_118_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8913 2 85 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A538HET2-F1-model_v4 SDR family oxidoreductase 0.9718 2 128 GO:0016616
GO:0030497
AF-A0A538HET2-F1-model_v4 SDR family oxidoreductase 0.9217 2 128 GO:0016616
GO:0030497
AF-A0A535LZB0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.8901 1 156 GO:0016616
AF-A0A1A3JCG5-F1-model_v4 deleted 0.8857 6 176
AF-A0A7Z0AYI4-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.8843 1 179 GO:0004090
GO:0005997
GO:0006006
GO:0050038

Feature Viewer

pLDDT pTM Quality
82.15 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map