F462139

General Info

Members Datasets Scaffolds Average Seq Length
547 243 546 299

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000032|Ga0451577_0000032_335306_336199
Length 273
Sequence MTVKPDKFRVGLVQMAMSSDPQANEEKAAAKVEEAARKGAQVVCLPEMYRTPYFCQREDAALFDLAEPVPGPSSERFAKVARQAGVAVVVPIFEKRAAGLYHNSAIVIDANGERVGLYRKMHIPDDPAFTLICWDQWYPEGARLTALQGASILFYPTAIGWHPAEKAQHGASQRDAWRTVQRGHAVANGVYVAAVNRVGHELFTPGTPGLEFWGSSFLCDPFGVVIAEASVEKEEILVGEVDLGRIEEVRRGWPFLRDRRIDAYGDVTKRFID

Samples

Sample ID Description Type Environment
1 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
109 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.91
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.39
Rhizosphere 94.88
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000760 3300001976 Bacteria 4321
2 JGI24743J22301_10000732 3300001991 Bacteria 4087
3 JGI24751J29686_10002139 3300002459 Bacteria 4009
4 Ga0058862_12269112 3300004803 Bacteria 1457
5 Ga0070658_10123038 3300005327 Bacteria 2157
6 Ga0070658_10289284 3300005327 Bacteria 1396
7 Ga0070683_100005160 3300005329 Bacteria 10864
8 Ga0070683_100013551 3300005329 Bacteria 7115
9 Ga0070683_100303650 3300005329 Bacteria 1519
10 Ga0070690_100001232 3300005330 Bacteria 13262
11 Ga0070690_100457637 3300005330 Bacteria 947
12 Ga0070670_100027850 3300005331 Bacteria 4862
13 Ga0070670_100028793 3300005331 Bacteria 4782
14 Ga0070670_100092072 3300005331 Bacteria 2607
15 Ga0070670_100327888 3300005331 Bacteria 1342
16 Ga0070677_10002066 3300005333 Bacteria 6399
17 Ga0068869_100002093 3300005334 Bacteria 12002
18 Ga0068869_100017008 3300005334 Bacteria 4919
19 Ga0070666_10011786 3300005335 Bacteria 5496
20 Ga0070680_100012093 3300005336 Bacteria 6702
21 Ga0070680_100114376 3300005336 Bacteria 2248
22 Ga0068868_100002768 3300005338 Bacteria 12147
23 Ga0068868_100052477 3300005338 Bacteria 3210
24 Ga0068868_100084996 3300005338 Bacteria 2542
25 Ga0068868_100183413 3300005338 Bacteria 1737
26 Ga0070660_100001367 3300005339 Bacteria 16582
27 Ga0070689_100010580 3300005340 Bacteria 6577
28 Ga0070687_100008223 3300005343 Bacteria 4404
29 Ga0070661_100001005 3300005344 Bacteria 19985
30 Ga0070668_100016440 3300005347 Bacteria 5531
31 Ga0070669_100006659 3300005353 Bacteria 8319
32 Ga0070675_100006918 3300005354 Bacteria 8709
33 Ga0070674_100033607 3300005356 Bacteria 3416
34 Ga0070673_100006604 3300005364 Bacteria 7552
35 Ga0070673_100137052 3300005364 Bacteria 2061
36 Ga0070688_100001696 3300005365 Bacteria 11005
37 Ga0070709_10004373 3300005434 Bacteria 7618
38 Ga0070709_10070408 3300005434 Bacteria 2254
39 Ga0070709_10103888 3300005434 Bacteria 1898
40 Ga0070709_10138605 3300005434 Bacteria 1669
41 Ga0070709_10149026 3300005434 Bacteria 1615
42 Ga0070709_10193599 3300005434 Bacteria 1436
43 Ga0070714_100000774 3300005435 Bacteria 22670
44 Ga0070714_100028421 3300005435 Bacteria 4639
45 Ga0070714_100043164 3300005435 Bacteria 3812
46 Ga0070714_100054403 3300005435 Bacteria 3419
47 Ga0070714_100268537 3300005435 Bacteria 1581
48 Ga0070714_100401623 3300005435 Bacteria 1295
49 Ga0070713_100000176 3300005436 Bacteria 42775
50 Ga0070713_100016175 3300005436 Bacteria 5606
51 Ga0070713_100081727 3300005436 Bacteria 2757
52 Ga0070713_100149331 3300005436 Bacteria 2077
53 Ga0070713_100588533 3300005436 Bacteria 1056
54 Ga0070710_10042053 3300005437 Bacteria 2525
55 Ga0070711_100000600 3300005439 Bacteria 18772
56 Ga0070711_100024601 3300005439 Bacteria 3930
57 Ga0070711_100052634 3300005439 Bacteria 2802
58 Ga0070711_100150102 3300005439 Bacteria 1756
59 Ga0070711_100328932 3300005439 Bacteria 1223
60 Ga0070705_100142676 3300005440 Bacteria 1578
61 Ga0070708_100000748 3300005445 Bacteria 24604
62 Ga0070708_100038569 3300005445 Bacteria 4174
63 Ga0070708_100129458 3300005445 Bacteria 2335
64 Ga0070663_100041038 3300005455 Bacteria 3243
65 Ga0070678_100019120 3300005456 Bacteria 4457
66 Ga0070678_100104905 3300005456 Bacteria 2199
67 Ga0070662_100024068 3300005457 Bacteria 4191
68 Ga0070681_10002695 3300005458 Bacteria 16333
69 Ga0070681_10003943 3300005458 Bacteria 13978
70 Ga0070681_10076620 3300005458 Bacteria 3302
71 Ga0070681_10310270 3300005458 Bacteria 1487
72 Ga0070681_10537662 3300005458 Bacteria 1082
73 Ga0068867_100005124 3300005459 Bacteria 9260
74 Ga0068867_100025292 3300005459 Bacteria 4259
75 Ga0070685_10000440 3300005466 Bacteria 24150
76 Ga0070706_100055642 3300005467 Bacteria 3652
77 Ga0070706_100072197 3300005467 Bacteria 3194
78 Ga0070706_100103582 3300005467 Bacteria 2645
79 Ga0070706_100132811 3300005467 Bacteria 2323
80 Ga0070707_100000589 3300005468 Bacteria 36546
81 Ga0070707_100045486 3300005468 Bacteria 4202
82 Ga0070707_100156119 3300005468 Bacteria 2223
83 Ga0070707_100160381 3300005468 Bacteria 2191
84 Ga0070707_100179394 3300005468 Bacteria 2064
85 Ga0070698_100000393 3300005471 Bacteria 46076
86 Ga0070698_100000707 3300005471 Bacteria 35672
87 Ga0070698_100454420 3300005471 Bacteria 1217
88 Ga0070699_100000656 3300005518 Bacteria 32377
89 Ga0070699_100042521 3300005518 Bacteria 3932
90 Ga0070679_100008359 3300005530 Bacteria 9739
91 Ga0070679_100008723 3300005530 Bacteria 9559
92 Ga0070684_100000669 3300005535 Bacteria 23704
93 Ga0070684_100115328 3300005535 Bacteria 2412
94 Ga0070684_100140325 3300005535 Bacteria 2185
95 Ga0070684_100323549 3300005535 Bacteria 1416
96 Ga0070697_100000469 3300005536 Bacteria 30871
97 Ga0070697_100078932 3300005536 Bacteria 2709
98 Ga0070697_100102044 3300005536 Bacteria 2384
99 Ga0068853_100054918 3300005539 Bacteria 3432
100 Ga0068853_100194210 3300005539 Bacteria 1845
101 Ga0068853_100228489 3300005539 Bacteria 1701
102 Ga0070672_100024753 3300005543 Bacteria 4442
103 Ga0070686_100004780 3300005544 Bacteria 7478
104 Ga0070665_100401913 3300005548 Bacteria 1378
105 Ga0068855_100006845 3300005563 Bacteria 13830
106 Ga0068855_100016291 3300005563 Bacteria 8940
107 Ga0068855_100059668 3300005563 Bacteria 4463
108 Ga0068855_100101076 3300005563 Bacteria 3319
109 Ga0068855_100248761 3300005563 Bacteria 1983
110 Ga0070664_100011700 3300005564 Bacteria 7122
111 Ga0070664_100021785 3300005564 Bacteria 5284
112 Ga0068857_100000145 3300005577 Bacteria 43701
113 Ga0068857_100001889 3300005577 Bacteria 16882
114 Ga0068857_100089016 3300005577 Bacteria 2762
115 Ga0068857_100300798 3300005577 Bacteria 1479
116 Ga0068854_100003939 3300005578 Bacteria 9304
117 Ga0068854_100036500 3300005578 Bacteria 3446
118 Ga0068856_100001202 3300005614 Bacteria 27260
119 Ga0068856_100007263 3300005614 Bacteria 10807
120 Ga0068856_100016465 3300005614 Bacteria 7156
121 Ga0068856_100052102 3300005614 Bacteria 4035
122 Ga0070702_100045462 3300005615 Bacteria 2484
123 Ga0068852_100007091 3300005616 Bacteria 8165
124 Ga0068852_100031817 3300005616 Bacteria 4360
125 Ga0068852_100476496 3300005616 Bacteria 1240
126 Ga0068859_100013535 3300005617 Bacteria 8181
127 Ga0068864_100025183 3300005618 Bacteria 5009
128 Ga0068864_100405582 3300005618 Bacteria 1296
129 Ga0068866_10001986 3300005718 Bacteria 8525
130 Ga0068861_100091639 3300005719 Bacteria 2400
131 Ga0068851_10008850 3300005834 Bacteria 4668
132 Ga0068851_10037081 3300005834 Bacteria 2444
133 Ga0068851_10159664 3300005834 Bacteria 1238
134 Ga0068870_10011066 3300005840 Bacteria 4168
135 Ga0068870_10038906 3300005840 Bacteria 2458
136 Ga0068863_100006144 3300005841 Bacteria 11778
137 Ga0068863_100022772 3300005841 Bacteria 5984
138 Ga0068863_100175890 3300005841 Bacteria 2054
139 Ga0068863_100191846 3300005841 Bacteria 1964
140 Ga0068863_100408047 3300005841 Bacteria 1330
141 Ga0068858_100001387 3300005842 Bacteria 24924
142 Ga0068858_100003105 3300005842 Bacteria 16625
143 Ga0068858_100027491 3300005842 Bacteria 5284
144 Ga0068858_100256510 3300005842 Bacteria 1662
145 Ga0068860_100012949 3300005843 Bacteria 8192
146 Ga0068860_100022151 3300005843 Bacteria 6151
147 Ga0068862_100002740 3300005844 Bacteria 15462
148 Ga0068862_100100021 3300005844 Bacteria 2536
149 Ga0068862_100336674 3300005844 Bacteria 1397
150 Ga0081455_10163505 3300005937 Bacteria 1703
151 Ga0070717_10001411 3300006028 Bacteria 16567
152 Ga0070717_10003358 3300006028 Bacteria 11436
153 Ga0070717_10005210 3300006028 Bacteria 9471
154 Ga0070717_10006243 3300006028 Bacteria 8753
155 Ga0070717_10012530 3300006028 Bacteria 6466
156 Ga0070717_10033032 3300006028 Bacteria 4172
157 Ga0070717_10238846 3300006028 Bacteria 1601
158 Ga0070717_10257874 3300006028 Bacteria 1542
159 Ga0070717_10392086 3300006028 Bacteria 1246
160 Ga0070716_100004995 3300006173 Bacteria 6390
161 Ga0070716_100208506 3300006173 Bacteria 1304
162 Ga0070712_100000421 3300006175 Bacteria 24270
163 Ga0070712_100001386 3300006175 Bacteria 14713
164 Ga0070712_100008837 3300006175 Bacteria 6343
165 Ga0070712_100009254 3300006175 Bacteria 6205
166 Ga0070712_100058249 3300006175 Bacteria 2717
167 Ga0070712_100105143 3300006175 Bacteria 2096
168 Ga0070712_100236588 3300006175 Bacteria 1453
169 Ga0097621_100000942 3300006237 Bacteria 20383
170 Ga0097621_100085829 3300006237 Bacteria 2626
171 Ga0097621_100190467 3300006237 Bacteria 1776
172 Ga0068871_100000071 3300006358 Bacteria 57255
173 Ga0068871_100032798 3300006358 Bacteria 4106
174 Ga0068871_100133771 3300006358 Bacteria 2104
175 Ga0075433_10005868 3300006852 Bacteria 9675
176 Ga0075433_10262780 3300006852 Bacteria 1530
177 Ga0075434_100004458 3300006871 Bacteria 12624
178 Ga0075434_100018310 3300006871 Bacteria 6764
179 Ga0075434_100035958 3300006871 Bacteria 4898
180 Ga0068865_100005605 3300006881 Bacteria 7619
181 Ga0068865_100015438 3300006881 Bacteria 4871
182 Ga0068865_100024708 3300006881 Bacteria 3945
183 Ga0075436_100004055 3300006914 Bacteria 10046
184 Ga0075436_100068453 3300006914 Bacteria 2452
185 Ga0097620_100013535 3300006931 Bacteria 8181
186 Ga0075435_100000718 3300007076 Bacteria 20569
187 Ga0075435_100043947 3300007076 Bacteria 3578
188 Ga0075435_100044540 3300007076 Bacteria 3554
189 Ga0075435_100086382 3300007076 Bacteria 2583
190 Ga0105251_10048706 3300009011 Bacteria 2030
191 Ga0105240_10008591 3300009093 Bacteria 14599
192 Ga0105240_10277403 3300009093 Unclassified 1927
193 Ga0105240_10291959 3300009093 Bacteria 1868
194 Ga0105245_10076452 3300009098 Bacteria 3050
195 Ga0105245_10085471 3300009098 Bacteria 2892
196 Ga0105241_10021088 3300009174 Bacteria 4817
197 Ga0105241_10378038 3300009174 Bacteria 1237
198 Ga0105242_10011471 3300009176 Bacteria 6814
199 Ga0105248_10025955 3300009177 Bacteria 6516
200 Ga0105248_10105338 3300009177 Bacteria 3179
201 Ga0105248_10109729 3300009177 Bacteria 3111
202 Ga0105248_10261933 3300009177 Bacteria 1946
203 Ga0105237_10017706 3300009545 Bacteria 7385
204 Ga0105237_10425258 3300009545 Unclassified 1334
205 Ga0105238_10040398 3300009551 Bacteria 4727
206 Ga0105238_10199502 3300009551 Bacteria 1976
207 Ga0105238_10468574 3300009551 Bacteria 1258
208 Ga0105249_10012681 3300009553 Bacteria 7434
209 Ga0105249_10098445 3300009553 Bacteria 2747
210 Ga0105249_10555019 3300009553 Bacteria 1200
211 Ga0099796_10032670 3300010159 Bacteria 1707
212 Ga0105239_10002009 3300010375 Bacteria 26421
213 Ga0105239_10093117 3300010375 Bacteria 3327
214 Ga0105239_10133451 3300010375 Bacteria 2763
215 Ga0105239_10399945 3300010375 Bacteria 1554
216 Ga0105246_10001305 3300011119 Bacteria 14647
217 Ga0157373_10003038 3300013100 Bacteria 12650
218 Ga0157373_10036572 3300013100 Bacteria 3523
219 Ga0157371_10003428 3300013102 Bacteria 14393
220 Ga0157371_10058269 3300013102 Bacteria 2740
221 Ga0157370_10084580 3300013104 Bacteria 2982
222 Ga0157370_10142444 3300013104 Bacteria 2234
223 Ga0157369_10015571 3300013105 Bacteria 8569
224 Ga0157369_10087680 3300013105 Bacteria 3323
225 Ga0157369_10148613 3300013105 Bacteria 2477
226 Ga0157369_10436491 3300013105 Bacteria 1357
227 Ga0157369_10468985 3300013105 Bacteria 1303
228 Ga0157374_10002559 3300013296 Bacteria 15345
229 Ga0157374_10038641 3300013296 Bacteria 4388
230 Ga0157374_10070584 3300013296 Bacteria 3292
231 Ga0157374_10155554 3300013296 Bacteria 2225
232 Ga0157378_10002739 3300013297 Bacteria 15692
233 Ga0157378_10071492 3300013297 Bacteria 3116
234 Ga0163162_10020914 3300013306 Bacteria 6436
235 Ga0157372_10000287 3300013307 Bacteria 56080
236 Ga0157372_10002160 3300013307 Bacteria 21394
237 Ga0157372_10011370 3300013307 Bacteria 9469
238 Ga0157372_10081862 3300013307 Bacteria 3654
239 Ga0157372_10260086 3300013307 Bacteria 2015
240 Ga0157372_10442718 3300013307 Bacteria 1514
241 Ga0157372_10529217 3300013307 Bacteria 1374
242 Ga0157375_10060569 3300013308 Bacteria 3754
243 Ga0157375_10285792 3300013308 Bacteria 1813
244 Ga0163163_10000476 3300014325 Bacteria 36424
245 Ga0163163_10007755 3300014325 Bacteria 9487
246 Ga0163163_10304743 3300014325 Bacteria 1645
247 Ga0163163_10376725 3300014325 Bacteria 1477
248 Ga0182008_10018929 3300014497 Bacteria 3560
249 Ga0182008_10020707 3300014497 Unclassified 3382
250 Ga0157377_10002501 3300014745 Bacteria 8138
251 Ga0157379_10012783 3300014968 Bacteria 7342
252 Ga0157379_10032622 3300014968 Bacteria 4643
253 Ga0157376_10056994 3300014969 Bacteria 3267
254 Ga0157376_10072757 3300014969 Bacteria 2925
255 Ga0157376_10108864 3300014969 Bacteria 2435
256 Ga0182006_1026521 3300015261 Bacteria 2370
257 Ga0182007_10003044 3300015262 Bacteria 8089
258 Ga0182005_1018980 3300015265 Bacteria 1898
259 Ga0163161_10011074 3300017792 Bacteria 6245
260 Ga0224569_100115 3300022732 Bacteria 5697
261 Ga0228598_1017005 3300024227 Bacteria 1434
262 Ga0207697_10086353 3300025315 Bacteria 1326
263 Ga0207656_10078645 3300025321 Bacteria 1478
264 Ga0207688_10005473 3300025901 Bacteria 6905
265 Ga0207647_10031744 3300025904 Bacteria 3397
266 Ga0207699_10004141 3300025906 Bacteria 6944
267 Ga0207699_10033457 3300025906 Bacteria 2906
268 Ga0207699_10170969 3300025906 Bacteria 1454
269 Ga0207645_10000029 3300025907 Bacteria 93895
270 Ga0207643_10000140 3300025908 Bacteria 48979
271 Ga0207705_10115864 3300025909 Bacteria 1983
272 Ga0207684_10046785 3300025910 Bacteria 3671
273 Ga0207654_10063814 3300025911 Bacteria 2163
274 Ga0207707_10012523 3300025912 Bacteria 7374
275 Ga0207707_10014857 3300025912 Bacteria 6780
276 Ga0207707_10025206 3300025912 Bacteria 5202
277 Ga0207707_10255967 3300025912 Bacteria 1520
278 Ga0207695_10031663 3300025913 Bacteria 5797
279 Ga0207695_10045564 3300025913 Bacteria 4654
280 Ga0207671_10027691 3300025914 Bacteria 4237
281 Ga0207671_10031574 3300025914 Bacteria 3946
282 Ga0207693_10000260 3300025915 Bacteria 48765
283 Ga0207693_10007612 3300025915 Bacteria 8899
284 Ga0207693_10009048 3300025915 Bacteria 8126
285 Ga0207693_10014248 3300025915 Bacteria 6395
286 Ga0207693_10019547 3300025915 Bacteria 5386
287 Ga0207693_10435198 3300025915 Bacteria 1025
288 Ga0207663_10008000 3300025916 Bacteria 5513
289 Ga0207663_10086196 3300025916 Bacteria 2070
290 Ga0207663_10120479 3300025916 Bacteria 1796
291 Ga0207663_10125018 3300025916 Bacteria 1768
292 Ga0207663_10241084 3300025916 Bacteria 1326
293 Ga0207660_10005222 3300025917 Bacteria 8436
294 Ga0207660_10057593 3300025917 Bacteria 2784
295 Ga0207662_10002389 3300025918 Bacteria 9415
296 Ga0207657_10000197 3300025919 Bacteria 62537
297 Ga0207657_10001658 3300025919 Bacteria 24013
298 Ga0207649_10003051 3300025920 Bacteria 9215
299 Ga0207652_10003920 3300025921 Bacteria 12161
300 Ga0207652_10088194 3300025921 Bacteria 2721
301 Ga0207652_10233047 3300025921 Bacteria 1659
302 Ga0207646_10000405 3300025922 Bacteria 57762
303 Ga0207646_10157407 3300025922 Bacteria 2049
304 Ga0207646_10277619 3300025922 Bacteria 1514
305 Ga0207694_10093325 3300025924 Bacteria 2377
306 Ga0207650_10000040 3300025925 Bacteria 204095
307 Ga0207650_10008077 3300025925 Bacteria 7171
308 Ga0207650_10267937 3300025925 Bacteria 1387
309 Ga0207650_10300494 3300025925 Bacteria 1311
310 Ga0207659_10056370 3300025926 Bacteria 2814
311 Ga0207687_10026472 3300025927 Unclassified 3884
312 Ga0207687_10085026 3300025927 Bacteria 2294
313 Ga0207700_10000885 3300025928 Bacteria 17232
314 Ga0207700_10030948 3300025928 Bacteria 3796
315 Ga0207700_10051176 3300025928 Bacteria 3081
316 Ga0207700_10074352 3300025928 Bacteria 2628
317 Ga0207700_10218326 3300025928 Bacteria 1615
318 Ga0207700_10500068 3300025928 Bacteria 1076
319 Ga0207664_10002693 3300025929 Bacteria 11784
320 Ga0207664_10051920 3300025929 Bacteria 3240
321 Ga0207664_10174193 3300025929 Bacteria 1843
322 Ga0207664_10189595 3300025929 Bacteria 1769
323 Ga0207664_10250813 3300025929 Bacteria 1545
324 Ga0207644_10193637 3300025931 Bacteria 1600
325 Ga0207706_10003524 3300025933 Bacteria 14946
326 Ga0207706_10033945 3300025933 Bacteria 4541
327 Ga0207706_10078448 3300025933 Bacteria 2904
328 Ga0207670_10013711 3300025936 Bacteria 4789
329 Ga0207704_10012134 3300025938 Bacteria 4268
330 Ga0207704_10331524 3300025938 Bacteria 1178
331 Ga0207665_10000527 3300025939 Bacteria 25778
332 Ga0207665_10027202 3300025939 Bacteria 3779
333 Ga0207665_10039947 3300025939 Bacteria 3129
334 Ga0207665_10063966 3300025939 Bacteria 2499
335 Ga0207665_10079902 3300025939 Bacteria 2249
336 Ga0207691_10000120 3300025940 Bacteria 70657
337 Ga0207711_10008332 3300025941 Bacteria 8678
338 Ga0207689_10000172 3300025942 Bacteria 56576
339 Ga0207689_10000695 3300025942 Bacteria 32215
340 Ga0207689_10415206 3300025942 Bacteria 1123
341 Ga0207661_10006617 3300025944 Bacteria 8188
342 Ga0207661_10127783 3300025944 Bacteria 2173
343 Ga0207679_10007393 3300025945 Bacteria 6964
344 Ga0207679_10131562 3300025945 Bacteria 2008
345 Ga0207667_10000827 3300025949 Bacteria 39994
346 Ga0207667_10012855 3300025949 Bacteria 9620
347 Ga0207667_10021669 3300025949 Bacteria 7119
348 Ga0207667_10033122 3300025949 Bacteria 5559
349 Ga0207651_10002457 3300025960 Bacteria 8849
350 Ga0207712_10007601 3300025961 Bacteria 6848
351 Ga0207712_10372816 3300025961 Bacteria 1192
352 Ga0207668_10146318 3300025972 Bacteria 1823
353 Ga0207640_10019503 3300025981 Bacteria 4008
354 Ga0207640_10222122 3300025981 Bacteria 1447
355 Ga0207658_10012066 3300025986 Bacteria 5893
356 Ga0207677_10022233 3300026023 Bacteria 3893
357 Ga0207677_10263676 3300026023 Bacteria 1405
358 Ga0207677_10266021 3300026023 Bacteria 1400
359 Ga0207703_10010654 3300026035 Bacteria 7182
360 Ga0207639_10070347 3300026041 Bacteria 2733
361 Ga0207639_10081985 3300026041 Bacteria 2556
362 Ga0207639_10192896 3300026041 Bacteria 1741
363 Ga0207678_10000058 3300026067 Bacteria 86018
364 Ga0207702_10000612 3300026078 Bacteria 39396
365 Ga0207702_10042696 3300026078 Bacteria 3805
366 Ga0207702_10051310 3300026078 Bacteria 3485
367 Ga0207641_10000009 3300026088 Bacteria 407901
368 Ga0207641_10216098 3300026088 Bacteria 1775
369 Ga0207641_10512196 3300026088 Bacteria 1166
370 Ga0207648_10000158 3300026089 Bacteria 69351
371 Ga0207648_10019941 3300026089 Bacteria 6051
372 Ga0207648_10400476 3300026089 Bacteria 1244
373 Ga0207676_10000058 3300026095 Bacteria 120315
374 Ga0207676_10123734 3300026095 Bacteria 2186
375 Ga0207676_10181535 3300026095 Bacteria 1843
376 Ga0207676_10208845 3300026095 Bacteria 1731
377 Ga0207674_10000010 3300026116 Bacteria 196710
378 Ga0207674_10007554 3300026116 Bacteria 12664
379 Ga0207674_10012876 3300026116 Bacteria 9332
380 Ga0207674_10120563 3300026116 Bacteria 2591
381 Ga0207674_10153506 3300026116 Bacteria 2259
382 Ga0207674_10158821 3300026116 Bacteria 2216
383 Ga0207675_100044215 3300026118 Bacteria 4161
384 Ga0207675_100113133 3300026118 Bacteria 2563
385 Ga0207683_10000134 3300026121 Bacteria 61057
386 Ga0207698_10018455 3300026142 Bacteria 4753
387 Ga0207698_10111325 3300026142 Bacteria 2295
388 Ga0265356_1000280 3300028017 Bacteria 9520
389 Ga0268266_10020010 3300028379 Bacteria 5704
390 Ga0268265_10005587 3300028380 Bacteria 8582
391 Ga0268265_10095122 3300028380 Bacteria 2391
392 Ga0268265_10200737 3300028380 Bacteria 1730
393 Ga0268264_10009970 3300028381 Bacteria 7868
394 Ga0268264_10013571 3300028381 Bacteria 6706
395 Ga0268264_10046866 3300028381 Bacteria 3592
396 Ga0268264_10312543 3300028381 Bacteria 1483
397 Ga0265338_10007328 3300028800 Bacteria 13755
398 Ga0265338_10015616 3300028800 Bacteria 8321
399 Ga0265338_10127315 3300028800 Bacteria 2018
400 Ga0265762_1003837 3300030760 Bacteria 2692
401 Ga0265762_1008239 3300030760 Bacteria 1854
402 Ga0265760_10005843 3300031090 Bacteria 3516
403 Ga0265760_10018216 3300031090 Bacteria 2020
404 Ga0265330_10017554 3300031235 Bacteria 3293
405 Ga0265330_10077379 3300031235 Bacteria 1435
406 Ga0265328_10049782 3300031239 Bacteria 1538
407 Ga0265325_10020220 3300031241 Bacteria 3671
408 Ga0265339_10016565 3300031249 Bacteria 4391
409 Ga0265339_10026156 3300031249 Bacteria 3343
410 Ga0265331_10021155 3300031250 Bacteria 3332
411 Ga0265331_10170191 3300031250 Bacteria 986
412 Ga0265316_10018979 3300031344 Bacteria 5901
413 Ga0265316_10061828 3300031344 Bacteria 2907
414 Ga0265316_10088723 3300031344 Bacteria 2361
415 Ga0265314_10001900 3300031711 Bacteria 22356
416 Ga0265314_10174490 3300031711 Bacteria 1294
417 Ga0373926_0008377 3300035083 Bacteria 3439
418 Ga0373926_0085869 3300035083 Bacteria 1167
419 Ga0373934_0014481 3300035086 Bacteria 2989
420 Ga0373923_0014763 3300035111 Bacteria 2940
421 Ga0373936_0005409 3300035113 Bacteria 4813
422 Ga0373936_0108180 3300035113 Bacteria 1178
423 Ga0373945_0001345 3300035116 Bacteria 7481
424 Ga0373945_0010675 3300035116 Bacteria 3028
425 Ga0373945_0022564 3300035116 Bacteria 2169
426 Ga0373943_0000521 3300035170 Bacteria 16617
427 Ga0373943_0006331 3300035170 Bacteria 5313
428 Ga0373943_0061772 3300035170 Bacteria 1874
429 Ga0373946_0002343 3300035171 Bacteria 6693
430 Ga0373946_0041386 3300035171 Bacteria 1889
431 Ga0373946_0211765 3300035171 Bacteria 932
432 Ga0373955_0020095 3300035172 Bacteria 3352
433 Ga0373924_0000125 3300035410 Bacteria 22298
434 Ga0373935_0002478 3300035692 Bacteria 10558
435 Ga0373935_0040840 3300035692 Bacteria 2912
436 Ga0373935_0109846 3300035692 Bacteria 1829
437 Ga0373935_0398479 3300035692 Bacteria 988
438 Ga0373927_0000508 3300035695 Bacteria 29619
439 Ga0373927_0004487 3300035695 Bacteria 9769
440 Ga0373927_0007794 3300035695 Bacteria 7243
441 Ga0373927_0045291 3300035695 Bacteria 2846
442 Ga0373927_0110174 3300035695 Bacteria 1793
443 Ga0373933_0165681 3300035724 Bacteria 1405
444 Ga0373947_0002356 3300035725 Bacteria 11422
445 Ga0373947_0046244 3300035725 Bacteria 2606
446 Ga0373947_0050523 3300035725 Bacteria 2500
447 Ga0373947_0065614 3300035725 Bacteria 2214
448 Ga0373937_0000791 3300036401 Bacteria 27108
449 Ga0373937_0039151 3300036401 Bacteria 4321
450 Ga0373937_0041432 3300036401 Bacteria 4200
451 Ga0373937_0055073 3300036401 Bacteria 3650
452 Ga0373937_0069701 3300036401 Bacteria 3242
453 Ga0373937_0217518 3300036401 Bacteria 1798
454 Ga0373925_0007422 3300037068 Bacteria 8000
455 Ga0373925_0018259 3300037068 Bacteria 5097
456 Ga0373925_0020806 3300037068 Bacteria 4781
457 Ga0373925_0051009 3300037068 Bacteria 3087
458 Ga0373925_0095482 3300037068 Bacteria 2277
459 Ga0373925_0238005 3300037068 Bacteria 1457
460 Ga0373925_0328539 3300037068 Bacteria 1238
461 Ga0395905_0011365 3300037471 Bacteria 8608
462 Ga0395905_0129673 3300037471 Bacteria 2371
463 Ga0395901_0495890 3300038443 Bacteria 1244
464 Ga0436360_0071174 3300039438 Bacteria 1673
465 Ga0436363_0058218 3300039450 Bacteria 6884
466 Ga0436363_0595457 3300039450 Bacteria 1385
467 Ga0436363_1703825 3300039450 Bacteria 5951
468 Ga0436362_0964093 3300039453 Bacteria 5823
469 Ga0451577_0000032 3300042876 Bacteria 386126
470 Ga0453683_0004825 3300044673 Bacteria 9492
471 Ga0453684_0000028 3300044712 Bacteria 762381
472 Ga0466968_0100129 3300044735 Bacteria 1293
473 Ga0466957_0060550 3300044842 Bacteria 2321
474 Ga0466957_0124343 3300044842 Bacteria 1647
475 Ga0451576_0019480 3300045051 Bacteria 7404
476 Ga0466967_0009360 3300045976 Bacteria 7264
477 Ga0466967_0038511 3300045976 Bacteria 4101
478 Ga0466967_0312840 3300045976 Bacteria 1513
479 Ga0495629_0055197 3300046459 Bacteria 2778
480 Ga0495580_0000491 3300046472 Bacteria 33040
481 Ga0495580_0000747 3300046472 Bacteria 27881
482 Ga0495580_0000936 3300046472 Bacteria 25491
483 Ga0495580_0021454 3300046472 Bacteria 4765
484 Ga0495580_0109647 3300046472 Bacteria 1917
485 Ga0495580_0229953 3300046472 Bacteria 1273
486 Ga0495582_0058870 3300046473 Bacteria 2119
487 Ga0495584_0037264 3300046491 Bacteria 2457
488 Ga0495628_0275400 3300046516 Bacteria 1251
489 Ga0495628_0372160 3300046516 Bacteria 1047
490 Ga0495630_0009870 3300046517 Bacteria 6876
491 Ga0495630_0031060 3300046517 Bacteria 3976
492 Ga0495665_0093060 3300046531 Bacteria 1584
493 Ga0495635_0221261 3300046663 Bacteria 1280
494 Ga0495599_0188087 3300046678 Bacteria 1271
495 Ga0495623_0010574 3300046679 Bacteria 5972
496 Ga0495647_0019602 3300046681 Bacteria 2420
497 Ga0495669_0001548 3300046684 Bacteria 9451
498 Ga0495669_0083602 3300046684 Bacteria 1467
499 Ga0495624_0023300 3300046690 Bacteria 4084
500 Ga0495674_0041304 3300047319 Bacteria 4121
501 Ga0495674_0053103 3300047319 Bacteria 3564
502 Ga0495593_0091238 3300047673 Bacteria 1569
503 Ga0495602_0304013 3300048088 Bacteria 1166
504 Ga0496102_0075409 3300048905 Bacteria 3101
505 Ga0496102_0438234 3300048905 Bacteria 1226
506 Ga0496104_0047569 3300048907 Bacteria 4043
507 Ga0496104_0332965 3300048907 Bacteria 1431
508 Ga0496105_0006687 3300048908 Bacteria 8875
509 Ga0496105_0161792 3300048908 Bacteria 1838
510 Ga0496108_0009941 3300048911 Bacteria 7714
511 Ga0496108_0172398 3300048911 Bacteria 1872
512 Ga0496109_0000345 3300048912 Bacteria 43268
513 Ga0496110_0000352 3300048913 Bacteria 30755
514 Ga0496110_0055685 3300048913 Bacteria 3480
515 Ga0496110_0221675 3300048913 Bacteria 1720
516 Ga0496112_0000352 3300048915 Bacteria 30026
517 Ga0496112_0004479 3300048915 Bacteria 11849
518 Ga0496112_0009947 3300048915 Bacteria 8604
519 Ga0496112_0053309 3300048915 Bacteria 3972
520 Ga0496112_0054210 3300048915 Bacteria 3939
521 Ga0496113_0007545 3300048916 Bacteria 7012
522 Ga0496113_0024991 3300048916 Bacteria 4253
523 Ga0496113_0349352 3300048916 Bacteria 1186
524 Ga0496114_0325966 3300048917 Bacteria 1357
525 Ga0496115_0006715 3300048918 Bacteria 8441
526 Ga0496115_0062142 3300048918 Bacteria 3012
527 Ga0496115_0501490 3300048918 Bacteria 975
528 Ga0501298_033619 3300049521 Bacteria 1017
529 Ga0501036_0102199 3300049572 Bacteria 2425
530 Ga0501069_0123657 3300049585 Unclassified 1479
531 Ga0501075_0356262 3300049591 Bacteria 1115
532 nmdc:mga05p37_210963_c1 3300050507 Bacteria 2348
533 nmdc:mga0n895_1165_c1 3300050512 Bacteria 19255
534 nmdc:mga0n895_59930_c1 3300050512 Bacteria 3755
535 nmdc:mga0n895_930_c1 3300050512 Bacteria 21139
536 nmdc:mga0rr50_115635_c1 3300050513 Bacteria 2129
537 nmdc:mga0rr50_116054_c1 3300050513 Bacteria 2125
538 nmdc:mga0rr50_2747_c1 3300050513 Bacteria 9996
539 nmdc:mga0rr50_38654_c1 3300050513 Bacteria 3455
540 nmdc:mga0rr50_4107_c1 3300050513 Bacteria 8507
541 nmdc:mga08x19_1807_c1 3300050514 Bacteria 13146
542 nmdc:mga0a205_2439_c1 3300050515 Bacteria 16400
543 nmdc:mga0a205_4160_c1 3300050515 Bacteria 12964
544 Ga0495601_0011719 3300053077 Bacteria 5255
545 Ga0495619_0353233 3300053085 Bacteria 1017
546 Ga0501082_0241770 3300060353 Bacteria 1571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0019480 Ga0451576_0019480_6623_7375 249
2 3300042876 Ga0451577_0000032 Ga0451577_0000032_335306_336199 270
3 3300044673 Ga0453683_0004825 Ga0453683_0004825_4719_5612 270
4 3300044712 Ga0453684_0000028 Ga0453684_0000028_51031_51924 270
5 3300046681 Ga0495647_0019602 Ga0495647_0019602_791_1705 276
6 3300060353 Ga0501082_0241770 Ga0501082_0241770_707_1558 282
7 3300046472 Ga0495580_0109647 Ga0495580_0109647_197_1111 285
8 3300030760 Ga0265762_1003837 Ga0265762_10038372 286
9 3300005329 Ga0070683_100303650 Ga0070683_1003036502 288
10 3300005334 Ga0068869_100002093 Ga0068869_10000209310 288
11 3300005334 Ga0068869_100017008 Ga0068869_1000170084 288
12 3300005335 Ga0070666_10011786 Ga0070666_100117864 288
13 3300005338 Ga0068868_100002768 Ga0068868_10000276810 288
14 3300005347 Ga0070668_100016440 Ga0070668_1000164402 288
15 3300005436 Ga0070713_100081727 Ga0070713_1000817272 288
16 3300005445 Ga0070708_100038569 Ga0070708_1000385695 288
17 3300005467 Ga0070706_100072197 Ga0070706_1000721971 288
18 3300005468 Ga0070707_100179394 Ga0070707_1001793942 288
19 3300005544 Ga0070686_100004780 Ga0070686_1000047804 288
20 3300005617 Ga0068859_100013535 Ga0068859_1000135356 288
21 3300005842 Ga0068858_100003105 Ga0068858_1000031052 288
22 3300005842 Ga0068858_100256510 Ga0068858_1002565101 288
23 3300005844 Ga0068862_100100021 Ga0068862_1001000213 288
24 3300006358 Ga0068871_100133771 Ga0068871_1001337711 288
25 3300006931 Ga0097620_100013535 Ga0097620_1000135356 288
26 3300009093 Ga0105240_10008591 Ga0105240_100085918 288
27 3300009093 Ga0105240_10277403 Ga0105240_102774032 288
28 3300009098 Ga0105245_10085471 Ga0105245_100854713 288
29 3300009177 Ga0105248_10105338 Ga0105248_101053384 288
30 3300009177 Ga0105248_10261933 Ga0105248_102619332 288
31 3300009545 Ga0105237_10017706 Ga0105237_100177067 288
32 3300009545 Ga0105237_10425258 Ga0105237_104252582 288
33 3300009551 Ga0105238_10040398 Ga0105238_100403985 288
34 3300010375 Ga0105239_10093117 Ga0105239_100931172 288
35 3300010375 Ga0105239_10133451 Ga0105239_101334511 288
36 3300013105 Ga0157369_10436491 Ga0157369_104364911 288
37 3300013296 Ga0157374_10038641 Ga0157374_100386413 288
38 3300013297 Ga0157378_10071492 Ga0157378_100714922 288
39 3300013306 Ga0163162_10020914 Ga0163162_100209144 288
40 3300013307 Ga0157372_10260086 Ga0157372_102600862 288
41 3300013307 Ga0157372_10529217 Ga0157372_105292172 288
42 3300013308 Ga0157375_10285792 Ga0157375_102857922 288
43 3300014497 Ga0182008_10020707 Ga0182008_100207073 288
44 3300015262 Ga0182007_10003044 Ga0182007_100030443 288
45 3300015265 Ga0182005_1018980 Ga0182005_10189802 288
46 3300025906 Ga0207699_10004141 Ga0207699_100041412 288
47 3300025912 Ga0207707_10255967 Ga0207707_102559672 288
48 3300025914 Ga0207671_10027691 Ga0207671_100276912 288
49 3300025938 Ga0207704_10331524 Ga0207704_103315241 288
50 3300025939 Ga0207665_10063966 Ga0207665_100639663 288
51 3300025942 Ga0207689_10000695 Ga0207689_1000069518 288
52 3300026089 Ga0207648_10019941 Ga0207648_100199414 288
53 3300026118 Ga0207675_100113133 Ga0207675_1001131331 288
54 3300028380 Ga0268265_10095122 Ga0268265_100951223 288
55 3300028381 Ga0268264_10013571 Ga0268264_100135716 288
56 3300035083 Ga0373926_0008377 Ga0373926_0008377_1378_2244 288
57 3300035086 Ga0373934_0014481 Ga0373934_0014481_1902_2768 288
58 3300035113 Ga0373936_0005409 Ga0373936_0005409_295_1161 288
59 3300035116 Ga0373945_0022564 Ga0373945_0022564_1038_1904 288
60 3300035170 Ga0373943_0000521 Ga0373943_0000521_6192_7058 288
61 3300035171 Ga0373946_0002343 Ga0373946_0002343_4025_4891 288
62 3300035692 Ga0373935_0002478 Ga0373935_0002478_2049_2915 288
63 3300035692 Ga0373935_0398479 Ga0373935_0398479_22_888 288
64 3300035695 Ga0373927_0000508 Ga0373927_0000508_23589_24455 288
65 3300035695 Ga0373927_0110174 Ga0373927_0110174_369_1235 288
66 3300035725 Ga0373947_0002356 Ga0373947_0002356_5230_6096 288
67 3300036401 Ga0373937_0217518 Ga0373937_0217518_198_1064 288
68 3300037068 Ga0373925_0018259 Ga0373925_0018259_2048_2914 288
69 3300037068 Ga0373925_0020806 Ga0373925_0020806_565_1431 288
70 3300044735 Ga0466968_0100129 Ga0466968_0100129_392_1258 288
71 3300045976 Ga0466967_0038511 Ga0466967_0038511_946_1812 288
72 3300046472 Ga0495580_0000936 Ga0495580_0000936_10441_11307 288
73 3300046472 Ga0495580_0229953 Ga0495580_0229953_318_1184 288
74 3300046473 Ga0495582_0058870 Ga0495582_0058870_890_1756 288
75 3300046516 Ga0495628_0275400 Ga0495628_0275400_327_1193 288
76 3300046531 Ga0495665_0093060 Ga0495665_0093060_375_1241 288
77 3300046690 Ga0495624_0023300 Ga0495624_0023300_1658_2524 288
78 3300047319 Ga0495674_0053103 Ga0495674_0053103_2390_3256 288
79 3300048088 Ga0495602_0304013 Ga0495602_0304013_239_1105 288
80 3300048905 Ga0496102_0438234 Ga0496102_0438234_257_1123 288
81 3300048913 Ga0496110_0221675 Ga0496110_0221675_477_1343 288
82 3300048915 Ga0496112_0009947 Ga0496112_0009947_1932_2798 288
83 3300050512 nmdc:mga0n895_59930_c1 nmdc:mga0n895_59930_c1_367_1233 288
84 3300050513 nmdc:mga0rr50_4107_c1 nmdc:mga0rr50_4107_c1_5321_6187 288
85 3300031235 Ga0265330_10077379 Ga0265330_100773791 289
86 3300031250 Ga0265331_10021155 Ga0265331_100211554 289
87 3300031344 Ga0265316_10088723 Ga0265316_100887232 289
88 3300005518 Ga0070699_100042521 Ga0070699_1000425211 290
89 3300006028 Ga0070717_10006243 Ga0070717_100062437 290
90 3300050513 nmdc:mga0rr50_38654_c1 nmdc:mga0rr50_38654_c1_1698_2573 290
91 3300005468 Ga0070707_100156119 Ga0070707_1001561192 291
92 3300014968 Ga0157379_10012783 Ga0157379_100127832 291
93 3300049572 Ga0501036_0102199 Ga0501036_0102199_1131_2015 291
94 3300049591 Ga0501075_0356262 Ga0501075_0356262_71_955 291
95 iso_pu_bacteria 2684623219 2687239217 291
96 3300013307 Ga0157372_10442718 Ga0157372_104427182 292
97 3300025921 Ga0207652_10233047 Ga0207652_102330471 292
98 3300005467 Ga0070706_100055642 Ga0070706_1000556424 293
99 3300005471 Ga0070698_100454420 Ga0070698_1004544201 293
100 3300047319 Ga0495674_0041304 Ga0495674_0041304_616_1497 293
101 3300048915 Ga0496112_0053309 Ga0496112_0053309_1488_2369 293
102 3300050507 nmdc:mga05p37_210963_c1 nmdc:mga05p37_210963_c1_1367_2251 293
103 3300050512 nmdc:mga0n895_930_c1 nmdc:mga0n895_930_c1_16878_17759 293
104 3300050513 nmdc:mga0rr50_2747_c1 nmdc:mga0rr50_2747_c1_3297_4178 293
105 3300014325 Ga0163163_10007755 Ga0163163_100077552 294
106 3300046684 Ga0495669_0001548 Ga0495669_0001548_5843_6733 296
107 3300036401 Ga0373937_0041432 Ga0373937_0041432_235_1140 297
108 3300005331 Ga0070670_100327888 Ga0070670_1003278882 298
109 3300005338 Ga0068868_100084996 Ga0068868_1000849962 298
110 3300005456 Ga0070678_100104905 Ga0070678_1001049051 298
111 3300005563 Ga0068855_100016291 Ga0068855_1000162914 298
112 3300005578 Ga0068854_100036500 Ga0068854_1000365003 298
113 3300005614 Ga0068856_100001202 Ga0068856_10000120220 298
114 3300005841 Ga0068863_100006144 Ga0068863_1000061446 298
115 3300006237 Ga0097621_100000942 Ga0097621_10000094214 298
116 3300006358 Ga0068871_100000071 Ga0068871_10000007121 298
117 3300025925 Ga0207650_10300494 Ga0207650_103004942 298
118 3300025927 Ga0207687_10026472 Ga0207687_100264723 298
119 3300025949 Ga0207667_10000827 Ga0207667_1000082717 298
120 3300025981 Ga0207640_10019503 Ga0207640_100195033 298
121 3300026078 Ga0207702_10000612 Ga0207702_1000061219 298
122 3300026089 Ga0207648_10400476 Ga0207648_104004761 298
123 3300026095 Ga0207676_10181535 Ga0207676_101815352 298
124 3300028381 Ga0268264_10312543 Ga0268264_103125431 298
125 3300005327 Ga0070658_10289284 Ga0070658_102892841 299
126 3300005330 Ga0070690_100457637 Ga0070690_1004576371 299
127 3300005331 Ga0070670_100027850 Ga0070670_1000278502 299
128 3300005331 Ga0070670_100092072 Ga0070670_1000920722 299
129 3300005434 Ga0070709_10138605 Ga0070709_101386052 299
130 3300005434 Ga0070709_10193599 Ga0070709_101935993 299
131 3300005435 Ga0070714_100000774 Ga0070714_1000007742 299
132 3300005435 Ga0070714_100268537 Ga0070714_1002685372 299
133 3300005436 Ga0070713_100588533 Ga0070713_1005885331 299
134 3300005439 Ga0070711_100052634 Ga0070711_1000526342 299
135 3300005440 Ga0070705_100142676 Ga0070705_1001426762 299
136 3300005458 Ga0070681_10003943 Ga0070681_1000394312 299
137 3300005468 Ga0070707_100045486 Ga0070707_1000454862 299
138 3300005468 Ga0070707_100160381 Ga0070707_1001603812 299
139 3300005471 Ga0070698_100000393 Ga0070698_10000039314 299
140 3300005539 Ga0068853_100194210 Ga0068853_1001942102 299
141 3300005563 Ga0068855_100006845 Ga0068855_1000068454 299
142 3300005563 Ga0068855_100101076 Ga0068855_1001010764 299
143 3300005564 Ga0070664_100011700 Ga0070664_1000117008 299
144 3300005577 Ga0068857_100000145 Ga0068857_10000014536 299
145 3300005577 Ga0068857_100089016 Ga0068857_1000890163 299
146 3300005614 Ga0068856_100052102 Ga0068856_1000521023 299
147 3300005616 Ga0068852_100476496 Ga0068852_1004764962 299
148 3300005840 Ga0068870_10011066 Ga0068870_100110662 299
149 3300005841 Ga0068863_100191846 Ga0068863_1001918462 299
150 3300005842 Ga0068858_100001387 Ga0068858_10000138723 299
151 3300005843 Ga0068860_100022151 Ga0068860_1000221516 299
152 3300006028 Ga0070717_10005210 Ga0070717_100052106 299
153 3300006237 Ga0097621_100085829 Ga0097621_1000858292 299
154 3300006852 Ga0075433_10005868 Ga0075433_100058685 299
155 3300006852 Ga0075433_10262780 Ga0075433_102627801 299
156 3300006871 Ga0075434_100004458 Ga0075434_10000445811 299
157 3300006871 Ga0075434_100035958 Ga0075434_1000359582 299
158 3300006881 Ga0068865_100005605 Ga0068865_1000056052 299
159 3300007076 Ga0075435_100044540 Ga0075435_1000445402 299
160 3300007076 Ga0075435_100086382 Ga0075435_1000863822 299
161 3300013104 Ga0157370_10084580 Ga0157370_100845803 299
162 3300013296 Ga0157374_10155554 Ga0157374_101555541 299
163 3300013307 Ga0157372_10081862 Ga0157372_100818621 299
164 3300014325 Ga0163163_10376725 Ga0163163_103767252 299
165 3300025906 Ga0207699_10170969 Ga0207699_101709693 299
166 3300025910 Ga0207684_10046785 Ga0207684_100467852 299
167 3300025913 Ga0207695_10031663 Ga0207695_100316635 299
168 3300025914 Ga0207671_10031574 Ga0207671_100315744 299
169 3300025922 Ga0207646_10157407 Ga0207646_101574072 299
170 3300025922 Ga0207646_10277619 Ga0207646_102776192 299
171 3300025925 Ga0207650_10008077 Ga0207650_100080772 299
172 3300025925 Ga0207650_10267937 Ga0207650_102679372 299
173 3300025928 Ga0207700_10218326 Ga0207700_102183262 299
174 3300025928 Ga0207700_10500068 Ga0207700_105000682 299
175 3300025929 Ga0207664_10002693 Ga0207664_100026931 299
176 3300025929 Ga0207664_10189595 Ga0207664_101895952 299
177 3300025929 Ga0207664_10250813 Ga0207664_102508132 299
178 3300025949 Ga0207667_10012855 Ga0207667_100128555 299
179 3300025961 Ga0207712_10372816 Ga0207712_103728161 299
180 3300026035 Ga0207703_10010654 Ga0207703_100106547 299
181 3300026078 Ga0207702_10042696 Ga0207702_100426963 299
182 3300026095 Ga0207676_10123734 Ga0207676_101237341 299
183 3300026116 Ga0207674_10007554 Ga0207674_100075548 299
184 3300026116 Ga0207674_10012876 Ga0207674_100128764 299
185 3300028800 Ga0265338_10015616 Ga0265338_100156163 299
186 3300031239 Ga0265328_10049782 Ga0265328_100497822 299
187 3300031249 Ga0265339_10026156 Ga0265339_100261562 299
188 3300031250 Ga0265331_10170191 Ga0265331_101701911 299
189 3300031344 Ga0265316_10018979 Ga0265316_100189791 299
190 3300031711 Ga0265314_10001900 Ga0265314_1000190019 299
191 3300035724 Ga0373933_0165681 Ga0373933_0165681_300_1199 299
192 3300036401 Ga0373937_0055073 Ga0373937_0055073_298_1197 299
193 3300037068 Ga0373925_0238005 Ga0373925_0238005_268_1167 299
194 3300037471 Ga0395905_0011365 Ga0395905_0011365_514_1416 299
195 3300037471 Ga0395905_0129673 Ga0395905_0129673_81_983 299
196 3300038443 Ga0395901_0495890 Ga0395901_0495890_220_1122 299
197 3300039450 Ga0436363_0058218 Ga0436363_0058218_4494_5393 299
198 3300039450 Ga0436363_0595457 Ga0436363_0595457_235_1134 299
199 3300039450 Ga0436363_1703825 Ga0436363_1703825_1057_1956 299
200 3300044842 Ga0466957_0124343 Ga0466957_0124343_679_1578 299
201 3300045976 Ga0466967_0009360 Ga0466967_0009360_6272_7174 299
202 3300048911 Ga0496108_0172398 Ga0496108_0172398_855_1754 299
203 3300048915 Ga0496112_0054210 Ga0496112_0054210_2898_3797 299
204 3300050512 nmdc:mga0n895_1165_c1 nmdc:mga0n895_1165_c1_6255_7202 299
205 3300050513 nmdc:mga0rr50_115635_c1 nmdc:mga0rr50_115635_c1_525_1472 299
206 3300050515 nmdc:mga0a205_4160_c1 nmdc:mga0a205_4160_c1_9159_10106 299
207 3300001976 JGI24752J21851_1000760 JGI24752J21851_10007604 300
208 3300001991 JGI24743J22301_10000732 JGI24743J22301_100007322 300
209 3300002459 JGI24751J29686_10002139 JGI24751J29686_100021393 300
210 3300004803 Ga0058862_12269112 Ga0058862_122691121 300
211 3300005327 Ga0070658_10123038 Ga0070658_101230381 300
212 3300005329 Ga0070683_100005160 Ga0070683_1000051607 300
213 3300005329 Ga0070683_100013551 Ga0070683_1000135513 300
214 3300005330 Ga0070690_100001232 Ga0070690_1000012322 300
215 3300005331 Ga0070670_100028793 Ga0070670_1000287934 300
216 3300005333 Ga0070677_10002066 Ga0070677_100020664 300
217 3300005336 Ga0070680_100012093 Ga0070680_1000120934 300
218 3300005336 Ga0070680_100114376 Ga0070680_1001143763 300
219 3300005338 Ga0068868_100052477 Ga0068868_1000524773 300
220 3300005338 Ga0068868_100183413 Ga0068868_1001834132 300
221 3300005339 Ga0070660_100001367 Ga0070660_1000013676 300
222 3300005340 Ga0070689_100010580 Ga0070689_1000105805 300
223 3300005343 Ga0070687_100008223 Ga0070687_1000082235 300
224 3300005344 Ga0070661_100001005 Ga0070661_10000100514 300
225 3300005353 Ga0070669_100006659 Ga0070669_1000066595 300
226 3300005354 Ga0070675_100006918 Ga0070675_1000069186 300
227 3300005356 Ga0070674_100033607 Ga0070674_1000336072 300
228 3300005364 Ga0070673_100006604 Ga0070673_1000066045 300
229 3300005364 Ga0070673_100137052 Ga0070673_1001370523 300
230 3300005365 Ga0070688_100001696 Ga0070688_1000016965 300
231 3300005434 Ga0070709_10004373 Ga0070709_100043737 300
232 3300005434 Ga0070709_10070408 Ga0070709_100704082 300
233 3300005434 Ga0070709_10103888 Ga0070709_101038882 300
234 3300005434 Ga0070709_10149026 Ga0070709_101490261 300
235 3300005435 Ga0070714_100028421 Ga0070714_1000284212 300
236 3300005435 Ga0070714_100043164 Ga0070714_1000431642 300
237 3300005435 Ga0070714_100054403 Ga0070714_1000544034 300
238 3300005435 Ga0070714_100401623 Ga0070714_1004016231 300
239 3300005436 Ga0070713_100000176 Ga0070713_1000001769 300
240 3300005436 Ga0070713_100016175 Ga0070713_1000161756 300
241 3300005436 Ga0070713_100149331 Ga0070713_1001493312 300
242 3300005437 Ga0070710_10042053 Ga0070710_100420532 300
243 3300005439 Ga0070711_100000600 Ga0070711_10000060016 300
244 3300005439 Ga0070711_100024601 Ga0070711_1000246013 300
245 3300005439 Ga0070711_100150102 Ga0070711_1001501021 300
246 3300005439 Ga0070711_100328932 Ga0070711_1003289322 300
247 3300005445 Ga0070708_100000748 Ga0070708_10000074811 300
248 3300005445 Ga0070708_100129458 Ga0070708_1001294582 300
249 3300005455 Ga0070663_100041038 Ga0070663_1000410382 300
250 3300005456 Ga0070678_100019120 Ga0070678_1000191202 300
251 3300005457 Ga0070662_100024068 Ga0070662_1000240683 300
252 3300005458 Ga0070681_10002695 Ga0070681_1000269510 300
253 3300005458 Ga0070681_10076620 Ga0070681_100766204 300
254 3300005458 Ga0070681_10310270 Ga0070681_103102702 300
255 3300005458 Ga0070681_10537662 Ga0070681_105376621 300
256 3300005459 Ga0068867_100005124 Ga0068867_1000051244 300
257 3300005459 Ga0068867_100025292 Ga0068867_1000252924 300
258 3300005466 Ga0070685_10000440 Ga0070685_1000044012 300
259 3300005467 Ga0070706_100103582 Ga0070706_1001035824 300
260 3300005467 Ga0070706_100132811 Ga0070706_1001328111 300
261 3300005468 Ga0070707_100000589 Ga0070707_10000058913 300
262 3300005471 Ga0070698_100000707 Ga0070698_1000007072 300
263 3300005518 Ga0070699_100000656 Ga0070699_10000065621 300
264 3300005530 Ga0070679_100008359 Ga0070679_1000083592 300
265 3300005530 Ga0070679_100008723 Ga0070679_1000087236 300
266 3300005535 Ga0070684_100000669 Ga0070684_10000066915 300
267 3300005535 Ga0070684_100115328 Ga0070684_1001153282 300
268 3300005535 Ga0070684_100140325 Ga0070684_1001403253 300
269 3300005535 Ga0070684_100323549 Ga0070684_1003235492 300
270 3300005536 Ga0070697_100000469 Ga0070697_10000046915 300
271 3300005536 Ga0070697_100078932 Ga0070697_1000789323 300
272 3300005536 Ga0070697_100102044 Ga0070697_1001020444 300
273 3300005539 Ga0068853_100054918 Ga0068853_1000549182 300
274 3300005539 Ga0068853_100228489 Ga0068853_1002284892 300
275 3300005543 Ga0070672_100024753 Ga0070672_1000247533 300
276 3300005548 Ga0070665_100401913 Ga0070665_1004019132 300
277 3300005563 Ga0068855_100059668 Ga0068855_1000596684 300
278 3300005563 Ga0068855_100248761 Ga0068855_1002487612 300
279 3300005564 Ga0070664_100021785 Ga0070664_1000217853 300
280 3300005577 Ga0068857_100001889 Ga0068857_1000018893 300
281 3300005577 Ga0068857_100300798 Ga0068857_1003007982 300
282 3300005578 Ga0068854_100003939 Ga0068854_1000039394 300
283 3300005614 Ga0068856_100007263 Ga0068856_1000072633 300
284 3300005614 Ga0068856_100016465 Ga0068856_1000164652 300
285 3300005615 Ga0070702_100045462 Ga0070702_1000454621 300
286 3300005616 Ga0068852_100007091 Ga0068852_1000070914 300
287 3300005616 Ga0068852_100031817 Ga0068852_1000318173 300
288 3300005618 Ga0068864_100025183 Ga0068864_1000251834 300
289 3300005618 Ga0068864_100405582 Ga0068864_1004055821 300
290 3300005718 Ga0068866_10001986 Ga0068866_100019863 300
291 3300005719 Ga0068861_100091639 Ga0068861_1000916392 300
292 3300005834 Ga0068851_10008850 Ga0068851_100088504 300
293 3300005834 Ga0068851_10037081 Ga0068851_100370812 300
294 3300005834 Ga0068851_10159664 Ga0068851_101596642 300
295 3300005840 Ga0068870_10038906 Ga0068870_100389062 300
296 3300005841 Ga0068863_100022772 Ga0068863_1000227724 300
297 3300005841 Ga0068863_100175890 Ga0068863_1001758902 300
298 3300005841 Ga0068863_100408047 Ga0068863_1004080471 300
299 3300005842 Ga0068858_100027491 Ga0068858_1000274914 300
300 3300005843 Ga0068860_100012949 Ga0068860_1000129494 300
301 3300005844 Ga0068862_100002740 Ga0068862_1000027404 300
302 3300005844 Ga0068862_100336674 Ga0068862_1003366742 300
303 3300005937 Ga0081455_10163505 Ga0081455_101635051 300
304 3300006028 Ga0070717_10001411 Ga0070717_100014118 300
305 3300006028 Ga0070717_10003358 Ga0070717_100033582 300
306 3300006028 Ga0070717_10012530 Ga0070717_100125301 300
307 3300006028 Ga0070717_10033032 Ga0070717_100330324 300
308 3300006028 Ga0070717_10238846 Ga0070717_102388462 300
309 3300006028 Ga0070717_10257874 Ga0070717_102578742 300
310 3300006028 Ga0070717_10392086 Ga0070717_103920861 300
311 3300006173 Ga0070716_100004995 Ga0070716_1000049954 300
312 3300006173 Ga0070716_100208506 Ga0070716_1002085061 300
313 3300006175 Ga0070712_100000421 Ga0070712_1000004218 300
314 3300006175 Ga0070712_100001386 Ga0070712_10000138611 300
315 3300006175 Ga0070712_100008837 Ga0070712_1000088372 300
316 3300006175 Ga0070712_100009254 Ga0070712_1000092545 300
317 3300006175 Ga0070712_100058249 Ga0070712_1000582492 300
318 3300006175 Ga0070712_100105143 Ga0070712_1001051431 300
319 3300006175 Ga0070712_100236588 Ga0070712_1002365881 300
320 3300006237 Ga0097621_100190467 Ga0097621_1001904672 300
321 3300006358 Ga0068871_100032798 Ga0068871_1000327984 300
322 3300006871 Ga0075434_100018310 Ga0075434_1000183107 300
323 3300006881 Ga0068865_100015438 Ga0068865_1000154385 300
324 3300006881 Ga0068865_100024708 Ga0068865_1000247081 300
325 3300006914 Ga0075436_100004055 Ga0075436_1000040555 300
326 3300006914 Ga0075436_100068453 Ga0075436_1000684531 300
327 3300007076 Ga0075435_100000718 Ga0075435_10000071810 300
328 3300007076 Ga0075435_100043947 Ga0075435_1000439473 300
329 3300009011 Ga0105251_10048706 Ga0105251_100487062 300
330 3300009093 Ga0105240_10291959 Ga0105240_102919591 300
331 3300009098 Ga0105245_10076452 Ga0105245_100764522 300
332 3300009174 Ga0105241_10021088 Ga0105241_100210884 300
333 3300009174 Ga0105241_10378038 Ga0105241_103780382 300
334 3300009176 Ga0105242_10011471 Ga0105242_100114715 300
335 3300009177 Ga0105248_10025955 Ga0105248_100259553 300
336 3300009177 Ga0105248_10109729 Ga0105248_101097292 300
337 3300009551 Ga0105238_10199502 Ga0105238_101995022 300
338 3300009551 Ga0105238_10468574 Ga0105238_104685742 300
339 3300009553 Ga0105249_10012681 Ga0105249_100126815 300
340 3300009553 Ga0105249_10098445 Ga0105249_100984453 300
341 3300009553 Ga0105249_10555019 Ga0105249_105550192 300
342 3300010159 Ga0099796_10032670 Ga0099796_100326702 300
343 3300010375 Ga0105239_10002009 Ga0105239_100020094 300
344 3300010375 Ga0105239_10399945 Ga0105239_103999451 300
345 3300011119 Ga0105246_10001305 Ga0105246_100013053 300
346 3300013100 Ga0157373_10003038 Ga0157373_100030387 300
347 3300013100 Ga0157373_10036572 Ga0157373_100365723 300
348 3300013102 Ga0157371_10003428 Ga0157371_100034289 300
349 3300013102 Ga0157371_10058269 Ga0157371_100582692 300
350 3300013104 Ga0157370_10142444 Ga0157370_101424442 300
351 3300013105 Ga0157369_10015571 Ga0157369_100155717 300
352 3300013105 Ga0157369_10087680 Ga0157369_100876804 300
353 3300013105 Ga0157369_10148613 Ga0157369_101486132 300
354 3300013105 Ga0157369_10468985 Ga0157369_104689852 300
355 3300013296 Ga0157374_10002559 Ga0157374_1000255913 300
356 3300013296 Ga0157374_10070584 Ga0157374_100705843 300
357 3300013297 Ga0157378_10002739 Ga0157378_100027398 300
358 3300013307 Ga0157372_10000287 Ga0157372_1000028743 300
359 3300013307 Ga0157372_10002160 Ga0157372_100021608 300
360 3300013307 Ga0157372_10011370 Ga0157372_100113707 300
361 3300013308 Ga0157375_10060569 Ga0157375_100605692 300
362 3300014325 Ga0163163_10000476 Ga0163163_1000047619 300
363 3300014325 Ga0163163_10304743 Ga0163163_103047432 300
364 3300014497 Ga0182008_10018929 Ga0182008_100189292 300
365 3300014745 Ga0157377_10002501 Ga0157377_100025015 300
366 3300014968 Ga0157379_10032622 Ga0157379_100326223 300
367 3300014969 Ga0157376_10056994 Ga0157376_100569943 300
368 3300014969 Ga0157376_10072757 Ga0157376_100727572 300
369 3300014969 Ga0157376_10108864 Ga0157376_101088641 300
370 3300015261 Ga0182006_1026521 Ga0182006_10265212 300
371 3300017792 Ga0163161_10011074 Ga0163161_100110745 300
372 3300022732 Ga0224569_100115 Ga0224569_1001153 300
373 3300024227 Ga0228598_1017005 Ga0228598_10170052 300
374 3300025315 Ga0207697_10086353 Ga0207697_100863531 300
375 3300025321 Ga0207656_10078645 Ga0207656_100786452 300
376 3300025901 Ga0207688_10005473 Ga0207688_100054734 300
377 3300025904 Ga0207647_10031744 Ga0207647_100317442 300
378 3300025906 Ga0207699_10033457 Ga0207699_100334572 300
379 3300025907 Ga0207645_10000029 Ga0207645_1000002946 300
380 3300025908 Ga0207643_10000140 Ga0207643_1000014023 300
381 3300025909 Ga0207705_10115864 Ga0207705_101158643 300
382 3300025911 Ga0207654_10063814 Ga0207654_100638142 300
383 3300025912 Ga0207707_10012523 Ga0207707_100125236 300
384 3300025912 Ga0207707_10014857 Ga0207707_100148577 300
385 3300025912 Ga0207707_10025206 Ga0207707_100252064 300
386 3300025913 Ga0207695_10045564 Ga0207695_100455646 300
387 3300025915 Ga0207693_10000260 Ga0207693_1000026016 300
388 3300025915 Ga0207693_10007612 Ga0207693_100076125 300
389 3300025915 Ga0207693_10009048 Ga0207693_100090486 300
390 3300025915 Ga0207693_10014248 Ga0207693_100142486 300
391 3300025915 Ga0207693_10019547 Ga0207693_100195475 300
392 3300025915 Ga0207693_10435198 Ga0207693_104351981 300
393 3300025916 Ga0207663_10008000 Ga0207663_100080002 300
394 3300025916 Ga0207663_10086196 Ga0207663_100861962 300
395 3300025916 Ga0207663_10120479 Ga0207663_101204792 300
396 3300025916 Ga0207663_10125018 Ga0207663_101250182 300
397 3300025916 Ga0207663_10241084 Ga0207663_102410842 300
398 3300025917 Ga0207660_10005222 Ga0207660_100052225 300
399 3300025917 Ga0207660_10057593 Ga0207660_100575933 300
400 3300025918 Ga0207662_10002389 Ga0207662_100023894 300
401 3300025919 Ga0207657_10000197 Ga0207657_1000019731 300
402 3300025919 Ga0207657_10001658 Ga0207657_100016584 300
403 3300025920 Ga0207649_10003051 Ga0207649_100030514 300
404 3300025921 Ga0207652_10003920 Ga0207652_100039207 300
405 3300025921 Ga0207652_10088194 Ga0207652_100881942 300
406 3300025922 Ga0207646_10000405 Ga0207646_1000040533 300
407 3300025924 Ga0207694_10093325 Ga0207694_100933251 300
408 3300025925 Ga0207650_10000040 Ga0207650_1000004033 300
409 3300025926 Ga0207659_10056370 Ga0207659_100563702 300
410 3300025927 Ga0207687_10085026 Ga0207687_100850262 300
411 3300025928 Ga0207700_10000885 Ga0207700_1000088515 300
412 3300025928 Ga0207700_10030948 Ga0207700_100309482 300
413 3300025928 Ga0207700_10051176 Ga0207700_100511763 300
414 3300025928 Ga0207700_10074352 Ga0207700_100743522 300
415 3300025929 Ga0207664_10051920 Ga0207664_100519203 300
416 3300025929 Ga0207664_10174193 Ga0207664_101741932 300
417 3300025931 Ga0207644_10193637 Ga0207644_101936372 300
418 3300025933 Ga0207706_10003524 Ga0207706_100035247 300
419 3300025933 Ga0207706_10033945 Ga0207706_100339454 300
420 3300025933 Ga0207706_10078448 Ga0207706_100784482 300
421 3300025936 Ga0207670_10013711 Ga0207670_100137112 300
422 3300025938 Ga0207704_10012134 Ga0207704_100121342 300
423 3300025939 Ga0207665_10000527 Ga0207665_1000052715 300
424 3300025939 Ga0207665_10027202 Ga0207665_100272022 300
425 3300025939 Ga0207665_10039947 Ga0207665_100399472 300
426 3300025939 Ga0207665_10079902 Ga0207665_100799022 300
427 3300025940 Ga0207691_10000120 Ga0207691_100001204 300
428 3300025941 Ga0207711_10008332 Ga0207711_100083324 300
429 3300025942 Ga0207689_10000172 Ga0207689_1000017240 300
430 3300025942 Ga0207689_10415206 Ga0207689_104152061 300
431 3300025944 Ga0207661_10006617 Ga0207661_100066172 300
432 3300025944 Ga0207661_10127783 Ga0207661_101277832 300
433 3300025945 Ga0207679_10007393 Ga0207679_100073933 300
434 3300025945 Ga0207679_10131562 Ga0207679_101315622 300
435 3300025949 Ga0207667_10021669 Ga0207667_100216694 300
436 3300025949 Ga0207667_10033122 Ga0207667_100331224 300
437 3300025960 Ga0207651_10002457 Ga0207651_100024574 300
438 3300025961 Ga0207712_10007601 Ga0207712_100076012 300
439 3300025972 Ga0207668_10146318 Ga0207668_101463182 300
440 3300025981 Ga0207640_10222122 Ga0207640_102221221 300
441 3300025986 Ga0207658_10012066 Ga0207658_100120662 300
442 3300026023 Ga0207677_10022233 Ga0207677_100222332 300
443 3300026023 Ga0207677_10263676 Ga0207677_102636762 300
444 3300026023 Ga0207677_10266021 Ga0207677_102660211 300
445 3300026041 Ga0207639_10070347 Ga0207639_100703472 300
446 3300026041 Ga0207639_10081985 Ga0207639_100819851 300
447 3300026041 Ga0207639_10192896 Ga0207639_101928962 300
448 3300026067 Ga0207678_10000058 Ga0207678_1000005865 300
449 3300026078 Ga0207702_10051310 Ga0207702_100513105 300
450 3300026088 Ga0207641_10000009 Ga0207641_10000009340 300
451 3300026088 Ga0207641_10216098 Ga0207641_102160982 300
452 3300026088 Ga0207641_10512196 Ga0207641_105121962 300
453 3300026089 Ga0207648_10000158 Ga0207648_1000015818 300
454 3300026095 Ga0207676_10000058 Ga0207676_1000005812 300
455 3300026095 Ga0207676_10208845 Ga0207676_102088451 300
456 3300026116 Ga0207674_10000010 Ga0207674_10000010166 300
457 3300026116 Ga0207674_10120563 Ga0207674_101205632 300
458 3300026116 Ga0207674_10153506 Ga0207674_101535062 300
459 3300026116 Ga0207674_10158821 Ga0207674_101588212 300
460 3300026118 Ga0207675_100044215 Ga0207675_1000442152 300
461 3300026121 Ga0207683_10000134 Ga0207683_1000013416 300
462 3300026142 Ga0207698_10018455 Ga0207698_100184554 300
463 3300026142 Ga0207698_10111325 Ga0207698_101113252 300
464 3300028017 Ga0265356_1000280 Ga0265356_10002805 300
465 3300028379 Ga0268266_10020010 Ga0268266_100200102 300
466 3300028380 Ga0268265_10005587 Ga0268265_100055875 300
467 3300028380 Ga0268265_10200737 Ga0268265_102007372 300
468 3300028381 Ga0268264_10009970 Ga0268264_100099703 300
469 3300028381 Ga0268264_10046866 Ga0268264_100468662 300
470 3300028800 Ga0265338_10007328 Ga0265338_100073282 300
471 3300028800 Ga0265338_10127315 Ga0265338_101273151 300
472 3300030760 Ga0265762_1008239 Ga0265762_10082392 300
473 3300031090 Ga0265760_10005843 Ga0265760_100058432 300
474 3300031090 Ga0265760_10018216 Ga0265760_100182162 300
475 3300031235 Ga0265330_10017554 Ga0265330_100175542 300
476 3300031241 Ga0265325_10020220 Ga0265325_100202203 300
477 3300031249 Ga0265339_10016565 Ga0265339_100165653 300
478 3300031344 Ga0265316_10061828 Ga0265316_100618281 300
479 3300031711 Ga0265314_10174490 Ga0265314_101744901 300
480 3300035083 Ga0373926_0085869 Ga0373926_0085869_81_983 300
481 3300035111 Ga0373923_0014763 Ga0373923_0014763_289_1194 300
482 3300035113 Ga0373936_0108180 Ga0373936_0108180_208_1110 300
483 3300035116 Ga0373945_0001345 Ga0373945_0001345_1922_2824 300
484 3300035116 Ga0373945_0010675 Ga0373945_0010675_1851_2753 300
485 3300035170 Ga0373943_0006331 Ga0373943_0006331_3447_4349 300
486 3300035170 Ga0373943_0061772 Ga0373943_0061772_775_1677 300
487 3300035171 Ga0373946_0041386 Ga0373946_0041386_913_1815 300
488 3300035171 Ga0373946_0211765 Ga0373946_0211765_14_916 300
489 3300035172 Ga0373955_0020095 Ga0373955_0020095_1652_2557 300
490 3300035410 Ga0373924_0000125 Ga0373924_0000125_14426_15328 300
491 3300035692 Ga0373935_0040840 Ga0373935_0040840_1070_1975 300
492 3300035692 Ga0373935_0109846 Ga0373935_0109846_564_1466 300
493 3300035695 Ga0373927_0004487 Ga0373927_0004487_6076_6981 300
494 3300035695 Ga0373927_0007794 Ga0373927_0007794_3435_4337 300
495 3300035695 Ga0373927_0045291 Ga0373927_0045291_1409_2314 300
496 3300035725 Ga0373947_0046244 Ga0373947_0046244_13_915 300
497 3300035725 Ga0373947_0050523 Ga0373947_0050523_695_1597 300
498 3300035725 Ga0373947_0065614 Ga0373947_0065614_551_1456 300
499 3300036401 Ga0373937_0000791 Ga0373937_0000791_10010_10918 300
500 3300036401 Ga0373937_0039151 Ga0373937_0039151_2442_3347 300
501 3300036401 Ga0373937_0069701 Ga0373937_0069701_2272_3174 300
502 3300037068 Ga0373925_0007422 Ga0373925_0007422_584_1489 300
503 3300037068 Ga0373925_0051009 Ga0373925_0051009_838_1743 300
504 3300037068 Ga0373925_0095482 Ga0373925_0095482_180_1082 300
505 3300037068 Ga0373925_0328539 Ga0373925_0328539_23_925 300
506 3300039438 Ga0436360_0071174 Ga0436360_0071174_38_967 300
507 3300039453 Ga0436362_0964093 Ga0436362_0964093_2913_3827 300
508 3300044842 Ga0466957_0060550 Ga0466957_0060550_296_1201 300
509 3300045976 Ga0466967_0312840 Ga0466967_0312840_261_1166 300
510 3300046459 Ga0495629_0055197 Ga0495629_0055197_921_1823 300
511 3300046472 Ga0495580_0000491 Ga0495580_0000491_23545_24447 300
512 3300046472 Ga0495580_0000747 Ga0495580_0000747_18011_18916 300
513 3300046472 Ga0495580_0021454 Ga0495580_0021454_2016_2954 300
514 3300046491 Ga0495584_0037264 Ga0495584_0037264_822_1760 300
515 3300046516 Ga0495628_0372160 Ga0495628_0372160_111_1016 300
516 3300046517 Ga0495630_0009870 Ga0495630_0009870_1946_2848 300
517 3300046517 Ga0495630_0031060 Ga0495630_0031060_2879_3784 300
518 3300046663 Ga0495635_0221261 Ga0495635_0221261_28_933 300
519 3300046678 Ga0495599_0188087 Ga0495599_0188087_35_937 300
520 3300046679 Ga0495623_0010574 Ga0495623_0010574_3488_4393 300
521 3300046684 Ga0495669_0083602 Ga0495669_0083602_192_1097 300
522 3300047673 Ga0495593_0091238 Ga0495593_0091238_571_1473 300
523 3300048905 Ga0496102_0075409 Ga0496102_0075409_1678_2580 300
524 3300048907 Ga0496104_0047569 Ga0496104_0047569_1422_2324 300
525 3300048907 Ga0496104_0332965 Ga0496104_0332965_335_1243 300
526 3300048908 Ga0496105_0006687 Ga0496105_0006687_787_1695 300
527 3300048908 Ga0496105_0161792 Ga0496105_0161792_837_1742 300
528 3300048911 Ga0496108_0009941 Ga0496108_0009941_1154_2056 300
529 3300048912 Ga0496109_0000345 Ga0496109_0000345_9610_10512 300
530 3300048913 Ga0496110_0000352 Ga0496110_0000352_21811_22713 300
531 3300048913 Ga0496110_0055685 Ga0496110_0055685_392_1351 300
532 3300048915 Ga0496112_0000352 Ga0496112_0000352_1237_2139 300
533 3300048915 Ga0496112_0004479 Ga0496112_0004479_685_1590 300
534 3300048916 Ga0496113_0007545 Ga0496113_0007545_3687_4589 300
535 3300048916 Ga0496113_0024991 Ga0496113_0024991_1118_2023 300
536 3300048916 Ga0496113_0349352 Ga0496113_0349352_195_1100 300
537 3300048917 Ga0496114_0325966 Ga0496114_0325966_33_935 300
538 3300048918 Ga0496115_0006715 Ga0496115_0006715_4940_5842 300
539 3300048918 Ga0496115_0062142 Ga0496115_0062142_602_1504 300
540 3300048918 Ga0496115_0501490 Ga0496115_0501490_59_961 300
541 3300049521 Ga0501298_033619 Ga0501298_033619_65_967 300
542 3300049585 Ga0501069_0123657 Ga0501069_0123657_106_1014 300
543 3300050513 nmdc:mga0rr50_116054_c1 nmdc:mga0rr50_116054_c1_66_1001 300
544 3300050514 nmdc:mga08x19_1807_c1 nmdc:mga08x19_1807_c1_9451_10356 300
545 3300050515 nmdc:mga0a205_2439_c1 nmdc:mga0a205_2439_c1_3191_4096 300
546 3300053077 Ga0495601_0011719 Ga0495601_0011719_4103_5005 300
547 3300053085 Ga0495619_0353233 Ga0495619_0353233_63_968 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

9

131

0.95

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

129

251

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h8j-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9281 4 291
5h8i-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine 0.9248 5 291
5h8i-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine 0.9234 5 291
5h8k-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant 0.9207 5 291
5h8l-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine 0.9204 5 291
ID Description Score Start End Superfamily
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.91 4 297 3.60.110.10
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8948 5 291 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8836 4 297 3.60.110.10
af_Q47679_3_256_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8829 6 285 3.60.110.10
af_Q94JV5_26_305_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8739 3 286 3.60.110.10
ID Description Score Start End GO Terms
AF-X1GFJ0-F1-model_v4 CN hydrolase domain-containing protein 0.9856 8 119 GO:0016811
AF-A0A2W0A4A6-F1-model_v4 Acyltransferase 0.9824 6 104 GO:0016746
GO:0033388
GO:0050126
AF-A0A5S3QQQ3-F1-model_v4 deleted 0.9707 8 110
AF-A0A7J4VEW5-F1-model_v4 Acyltransferase 0.9604 1 103 GO:0016746
GO:0033388
GO:0050126
AF-A0A2N1XU79-F1-model_v4 deleted 0.9602 8 103

Feature Viewer

pLDDT pTM Quality
87.88 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map