F462023

General Info

Members Datasets Scaffolds Average Seq Length
546 245 1092 212

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0271868|Ga0466964_0271868_56_784
Length 242
Sequence MAHFRRLSLHAISNSQAGKHSPGQDGDMKSHFRFIFAAVLLVATAVFLQARRSNEVFPARRPLASFPAQLNDWSSTEVPIPQDVRDVLGAGDFLLRVYRNDIVRQPYVDLFVAYFPSQRAGDTIHSPKNCLPGAGWSPVDSTRIQVSVPGHKPFVANRYIIAKGSDRQLVLYWYWAHDRAVASEYWAKFYLVTDSMRLNRSDGSLVRVTTPIGTGEKVETAQQRLLSFAGNVVPIINDYVPR

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.55
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.23
Rhizosphere 93.22
Stem 0
Stem Tuber 0
Unclassified 18.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0271868 3300044706 Bacteria 844
2 MBSR1b_contig_1819181 2162886012 Bacteria 1810
3 MBSR1b_contig_9596287 2162886012 Bacteria 3230
4 JGI24748J21848_1002446 3300002074 Bacteria 2095
5 rootH1_10316799 3300003323 Unclassified 3757
6 Ga0058863_10117812 3300004799 Bacteria 1668
7 Ga0065715_10093129 3300005293 Bacteria 4794
8 Ga0065715_10106120 3300005293 Bacteria 2850
9 Ga0070683_100014470 3300005329 Bacteria 6901
10 Ga0070683_100046144 3300005329 Unclassified 4024
11 Ga0070683_100106934 3300005329 Unclassified 2638
12 Ga0070690_100083628 3300005330 Bacteria 2091
13 Ga0070670_100015937 3300005331 Bacteria 6449
14 Ga0070670_100023731 3300005331 Bacteria 5278
15 Ga0070677_10006436 3300005333 Bacteria 3903
16 Ga0068869_100004740 3300005334 Bacteria 8485
17 Ga0068869_100068568 3300005334 Bacteria 2620
18 Ga0070666_10551428 3300005335 Bacteria 838
19 Ga0070680_100027984 3300005336 Unclassified 4519
20 Ga0070680_100039531 3300005336 Bacteria 3817
21 Ga0070680_100059082 3300005336 Bacteria 3136
22 Ga0070682_100029531 3300005337 Bacteria 3302
23 Ga0068868_100003992 3300005338 Bacteria 10302
24 Ga0068868_100015995 3300005338 Bacteria 5563
25 Ga0068868_100030209 3300005338 Unclassified 4155
26 Ga0068868_100040599 3300005338 Bacteria 3622
27 Ga0068868_100325588 3300005338 Unclassified 1310
28 Ga0070689_100005917 3300005340 Bacteria 8412
29 Ga0070689_100067621 3300005340 Bacteria 2786
30 Ga0070689_100070322 3300005340 Bacteria 2732
31 Ga0070687_100010826 3300005343 Bacteria 3966
32 Ga0070687_100044294 3300005343 Bacteria 2266
33 Ga0070661_100128983 3300005344 Bacteria 1898
34 Ga0070692_10159972 3300005345 Bacteria 1289
35 Ga0070668_100014230 3300005347 Bacteria 5944
36 Ga0070669_100023560 3300005353 Bacteria 4407
37 Ga0070675_100014129 3300005354 Bacteria 6292
38 Ga0070671_100047948 3300005355 Bacteria 3552
39 Ga0070671_100087618 3300005355 Bacteria 2605
40 Ga0070673_100001892 3300005364 Bacteria 12558
41 Ga0070688_100000291 3300005365 Bacteria 25754
42 Ga0070659_100020726 3300005366 Bacteria 4998
43 Ga0070659_100099071 3300005366 Bacteria 2344
44 Ga0070709_10008949 3300005434 Bacteria 5513
45 Ga0070709_10028307 3300005434 Bacteria 3341
46 Ga0070709_10294041 3300005434 Unclassified 1184
47 Ga0070709_10618924 3300005434 Unclassified 835
48 Ga0070714_100005420 3300005435 Bacteria 9734
49 Ga0070714_100006203 3300005435 Bacteria 9194
50 Ga0070714_100050099 3300005435 Bacteria 3556
51 Ga0070714_100057862 3300005435 Bacteria 3319
52 Ga0070714_100104665 3300005435 Unclassified 2497
53 Ga0070714_100109681 3300005435 Bacteria 2442
54 Ga0070714_100228359 3300005435 Unclassified 1714
55 Ga0070714_100866781 3300005435 Unclassified 876
56 Ga0070713_100002746 3300005436 Bacteria 11500
57 Ga0070713_100035332 3300005436 Unclassified 4022
58 Ga0070713_100046283 3300005436 Bacteria 3569
59 Ga0070713_100070913 3300005436 Unclassified 2943
60 Ga0070713_100110699 3300005436 Bacteria 2394
61 Ga0070713_100136291 3300005436 Bacteria 2170
62 Ga0070713_100262714 3300005436 Bacteria 1578
63 Ga0070710_10063901 3300005437 Unclassified 2104
64 Ga0070711_100032486 3300005439 Bacteria 3470
65 Ga0070711_100035324 3300005439 Bacteria 3341
66 Ga0070711_100067613 3300005439 Bacteria 2508
67 Ga0070711_100153610 3300005439 Unclassified 1738
68 Ga0070705_100078698 3300005440 Bacteria 2017
69 Ga0070700_100150343 3300005441 Bacteria 1592
70 Ga0070708_100000862 3300005445 Bacteria 22861
71 Ga0070708_100003295 3300005445 Bacteria 12613
72 Ga0070708_100048469 3300005445 Bacteria 3755
73 Ga0070708_100300335 3300005445 Bacteria 1512
74 Ga0070708_100635498 3300005445 Unclassified 1006
75 Ga0070663_100022702 3300005455 Bacteria 4198
76 Ga0070678_100225020 3300005456 Bacteria 1561
77 Ga0070678_100262744 3300005456 Unclassified 1452
78 Ga0070662_100020933 3300005457 Bacteria 4461
79 Ga0070662_100277078 3300005457 Bacteria 1356
80 Ga0070681_10000331 3300005458 Bacteria 38433
81 Ga0070681_10036552 3300005458 Unclassified 4932
82 Ga0070681_10041415 3300005458 Bacteria 4616
83 Ga0070681_10244844 3300005458 Unclassified 1706
84 Ga0068867_100001551 3300005459 Bacteria 15964
85 Ga0068867_100003250 3300005459 Bacteria 11456
86 Ga0070685_10004801 3300005466 Bacteria 6844
87 Ga0070706_100005942 3300005467 Bacteria 11540
88 Ga0070706_100148933 3300005467 Bacteria 2185
89 Ga0070707_100001024 3300005468 Bacteria 27715
90 Ga0070707_100074341 3300005468 Bacteria 3277
91 Ga0070707_100337398 3300005468 Unclassified 1464
92 Ga0070707_100678279 3300005468 Bacteria 993
93 Ga0070698_100000007 3300005471 Bacteria 123996
94 Ga0070698_100097862 3300005471 Bacteria 2909
95 Ga0070698_100118319 3300005471 Bacteria 2611
96 Ga0070699_100001930 3300005518 Bacteria 18705
97 Ga0070699_100035214 3300005518 Bacteria 4327
98 Ga0070679_100008261 3300005530 Bacteria 9792
99 Ga0070679_100015951 3300005530 Bacteria 7233
100 Ga0070679_100016021 3300005530 Bacteria 7220
101 Ga0070679_100020224 3300005530 Bacteria 6488
102 Ga0070679_100033162 3300005530 Bacteria 5113
103 Ga0070684_100003101 3300005535 Bacteria 12409
104 Ga0070684_100003738 3300005535 Bacteria 11481
105 Ga0070684_100072874 3300005535 Bacteria 3025
106 Ga0070697_100000126 3300005536 Bacteria 60796
107 Ga0070697_100012182 3300005536 Bacteria 6736
108 Ga0070697_100013881 3300005536 Bacteria 6324
109 Ga0070697_100087507 3300005536 Bacteria 2572
110 Ga0068853_100058428 3300005539 Bacteria 3329
111 Ga0068853_100206531 3300005539 Unclassified 1789
112 Ga0068853_100781867 3300005539 Unclassified 913
113 Ga0070672_100000501 3300005543 Bacteria 22813
114 Ga0070672_100273718 3300005543 Bacteria 1426
115 Ga0070696_100055852 3300005546 Bacteria 2754
116 Ga0070693_100068343 3300005547 Bacteria 2085
117 Ga0070693_100084267 3300005547 Unclassified 1902
118 Ga0068855_100003709 3300005563 Bacteria 18674
119 Ga0068855_100014036 3300005563 Bacteria 9657
120 Ga0068855_100014203 3300005563 Bacteria 9593
121 Ga0068855_100014552 3300005563 Bacteria 9476
122 Ga0068855_100025519 3300005563 Bacteria 7070
123 Ga0068855_100086034 3300005563 Bacteria 3636
124 Ga0070664_100001789 3300005564 Bacteria 17248
125 Ga0070664_100009974 3300005564 Bacteria 7698
126 Ga0070664_100095318 3300005564 Bacteria 2581
127 Ga0068857_100000154 3300005577 Bacteria 42680
128 Ga0068857_100020520 3300005577 Bacteria 5812
129 Ga0068857_100024772 3300005577 Bacteria 5285
130 Ga0068854_100013693 3300005578 Bacteria 5329
131 Ga0068854_100044672 3300005578 Unclassified 3146
132 Ga0068854_100108548 3300005578 Bacteria 2090
133 Ga0068856_100000612 3300005614 Bacteria 39134
134 Ga0068856_100001311 3300005614 Bacteria 26186
135 Ga0068856_100006576 3300005614 Bacteria 11400
136 Ga0068856_100008973 3300005614 Bacteria 9730
137 Ga0068856_100037452 3300005614 Bacteria 4759
138 Ga0070702_100012598 3300005615 Bacteria 4242
139 Ga0068852_100009503 3300005616 Bacteria 7225
140 Ga0068852_100252159 3300005616 Bacteria 1691
141 Ga0068852_100303156 3300005616 Bacteria 1547
142 Ga0068859_100001314 3300005617 Bacteria 25344
143 Ga0068859_100022694 3300005617 Bacteria 6292
144 Ga0068864_100000518 3300005618 Bacteria 33120
145 Ga0068864_100018566 3300005618 Bacteria 5812
146 Ga0068864_100021601 3300005618 Bacteria 5390
147 Ga0068866_10019748 3300005718 Bacteria 3074
148 Ga0068861_100008896 3300005719 Bacteria 6921
149 Ga0068861_100142714 3300005719 Bacteria 1956
150 Ga0068851_10000317 3300005834 Bacteria 21816
151 Ga0068870_10007782 3300005840 Bacteria 4792
152 Ga0068863_100016294 3300005841 Bacteria 7133
153 Ga0068863_100025741 3300005841 Bacteria 5612
154 Ga0068858_100000491 3300005842 Bacteria 41299
155 Ga0068858_100040131 3300005842 Bacteria 4340
156 Ga0068858_100165577 3300005842 Bacteria 2083
157 Ga0068858_100321381 3300005842 Bacteria 1479
158 Ga0068860_100054556 3300005843 Unclassified 3799
159 Ga0068860_100139857 3300005843 Bacteria 2326
160 Ga0068860_100982065 3300005843 Unclassified 862
161 Ga0068862_100007844 3300005844 Bacteria 8831
162 Ga0070717_10000142 3300006028 Bacteria 53568
163 Ga0070717_10002325 3300006028 Bacteria 13367
164 Ga0070717_10002532 3300006028 Bacteria 12872
165 Ga0070717_10076828 3300006028 Bacteria 2795
166 Ga0070717_10093274 3300006028 Bacteria 2545
167 Ga0070717_10221024 3300006028 Bacteria 1665
168 Ga0070717_10231691 3300006028 Bacteria 1626
169 Ga0070717_10232896 3300006028 Bacteria 1622
170 Ga0070717_10744285 3300006028 Unclassified 891
171 Ga0070716_100000043 3300006173 Bacteria 50574
172 Ga0070716_100025023 3300006173 Bacteria 3180
173 Ga0070716_100093755 3300006173 Bacteria 1824
174 Ga0070716_100409668 3300006173 Unclassified 977
175 Ga0070712_100002359 3300006175 Bacteria 11629
176 Ga0070712_100029602 3300006175 Bacteria 3672
177 Ga0097621_100001345 3300006237 Bacteria 16902
178 Ga0097621_100004782 3300006237 Bacteria 9476
179 Ga0097621_100030243 3300006237 Bacteria 4285
180 Ga0068871_100000369 3300006358 Bacteria 31455
181 Ga0068871_100004688 3300006358 Bacteria 9555
182 Ga0068871_100022322 3300006358 Bacteria 4879
183 Ga0075428_100177847 3300006844 Bacteria 2304
184 Ga0075431_100101036 3300006847 Bacteria 2976
185 Ga0075433_10036555 3300006852 Unclassified 4231
186 Ga0075433_10266908 3300006852 Bacteria 1517
187 Ga0075434_100087549 3300006871 Bacteria 3115
188 Ga0075434_100176930 3300006871 Unclassified 2154
189 Ga0075429_100062069 3300006880 Bacteria 3256
190 Ga0068865_100026371 3300006881 Bacteria 3831
191 Ga0068865_100039177 3300006881 Bacteria 3213
192 Ga0068865_100063262 3300006881 Bacteria 2600
193 Ga0075436_100001638 3300006914 Bacteria 15295
194 Ga0075436_100013902 3300006914 Bacteria 5512
195 Ga0075436_100108433 3300006914 Bacteria 1937
196 Ga0097620_100001314 3300006931 Bacteria 25344
197 Ga0097620_100022697 3300006931 Bacteria 6292
198 Ga0099794_10034368 3300007265 Unclassified 2388
199 Ga0099794_10614729 3300007265 Bacteria 576
200 Ga0099795_10100981 3300007788 Unclassified 1132
201 Ga0105240_10003635 3300009093 Bacteria 23888
202 Ga0105240_10024373 3300009093 Bacteria 7976
203 Ga0105240_10042216 3300009093 Bacteria 5813
204 Ga0105240_10063610 3300009093 Bacteria 4588
205 Ga0105240_10103191 3300009093 Unclassified 3465
206 Ga0105240_10131485 3300009093 Bacteria 3001
207 Ga0105240_10351827 3300009093 Unclassified 1671
208 Ga0105240_10616105 3300009093 Unclassified 1193
209 Ga0105245_10217677 3300009098 Bacteria 1841
210 Ga0105245_10293715 3300009098 Bacteria 1593
211 Ga0105247_10001660 3300009101 Bacteria 15704
212 Ga0114129_10000435 3300009147 Bacteria 49624
213 Ga0114129_11274458 3300009147 Bacteria 912
214 Ga0105241_10008803 3300009174 Bacteria 7417
215 Ga0105241_10012707 3300009174 Bacteria 6178
216 Ga0105241_10029642 3300009174 Bacteria 4085
217 Ga0105242_10069099 3300009176 Bacteria 2925
218 Ga0105248_10266435 3300009177 Bacteria 1928
219 Ga0105248_10892310 3300009177 Unclassified 1004
220 Ga0105237_10051637 3300009545 Unclassified 4129
221 Ga0105237_10083215 3300009545 Bacteria 3192
222 Ga0105237_10097608 3300009545 Bacteria 2929
223 Ga0105237_10325328 3300009545 Bacteria 1541
224 Ga0105238_10000339 3300009551 Bacteria 51013
225 Ga0105238_10076364 3300009551 Unclassified 3341
226 Ga0105249_10021168 3300009553 Bacteria 5822
227 Ga0105249_10413979 3300009553 Bacteria 1380
228 Ga0105239_10013506 3300010375 Bacteria 9067
229 Ga0105239_10046902 3300010375 Bacteria 4734
230 Ga0105239_10061856 3300010375 Bacteria 4110
231 Ga0105239_10081485 3300010375 Bacteria 3562
232 Ga0105246_10003366 3300011119 Bacteria 9679
233 Ga0105246_10025266 3300011119 Unclassified 3871
234 Ga0105246_10417008 3300011119 Unclassified 1119
235 Ga0157373_10006904 3300013100 Bacteria 8450
236 Ga0157373_10029404 3300013100 Unclassified 3958
237 Ga0157371_10003096 3300013102 Bacteria 15415
238 Ga0157371_10249254 3300013102 Bacteria 1278
239 Ga0157370_10114760 3300013104 Bacteria 2516
240 Ga0157369_10001152 3300013105 Bacteria 33000
241 Ga0157369_10026594 3300013105 Bacteria 6418
242 Ga0157369_10064469 3300013105 Bacteria 3945
243 Ga0157369_10077974 3300013105 Bacteria 3550
244 Ga0157374_10000322 3300013296 Bacteria 44575
245 Ga0157374_10000384 3300013296 Bacteria 40618
246 Ga0157374_10016973 3300013296 Bacteria 6409
247 Ga0157374_10023174 3300013296 Bacteria 5548
248 Ga0157374_10026152 3300013296 Bacteria 5249
249 Ga0157378_10000121 3300013297 Bacteria 75263
250 Ga0157378_10000188 3300013297 Bacteria 59526
251 Ga0157378_10003142 3300013297 Bacteria 14677
252 Ga0157378_10010666 3300013297 Bacteria 8029
253 Ga0157378_10122780 3300013297 Bacteria 2396
254 Ga0157378_10369946 3300013297 Bacteria 1405
255 Ga0163162_10286893 3300013306 Unclassified 1778
256 Ga0163162_11185286 3300013306 Unclassified 866
257 Ga0157372_10000752 3300013307 Bacteria 35111
258 Ga0157372_10000798 3300013307 Bacteria 34229
259 Ga0157372_10003104 3300013307 Bacteria 17899
260 Ga0157372_10006231 3300013307 Bacteria 12683
261 Ga0157372_10007275 3300013307 Bacteria 11788
262 Ga0157372_10015143 3300013307 Bacteria 8253
263 Ga0157372_10036144 3300013307 Bacteria 5443
264 Ga0157372_10052306 3300013307 Unclassified 4547
265 Ga0157372_10068209 3300013307 Unclassified 3998
266 Ga0157375_10159842 3300013308 Bacteria 2394
267 Ga0163163_10005248 3300014325 Bacteria 11171
268 Ga0163163_10037143 3300014325 Unclassified 4737
269 Ga0163163_10729903 3300014325 Unclassified 1054
270 Ga0157380_10006198 3300014326 Bacteria 8392
271 Ga0157377_10009232 3300014745 Bacteria 4831
272 Ga0157379_10526122 3300014968 Unclassified 1098
273 Ga0163161_10002149 3300017792 Bacteria 14219
274 Ga0224572_1014940 3300024225 Unclassified 1484
275 Ga0228598_1000584 3300024227 Bacteria 7640
276 Ga0228598_1002748 3300024227 Bacteria 3809
277 Ga0207697_10005116 3300025315 Bacteria 6138
278 Ga0207682_10004646 3300025893 Bacteria 5706
279 Ga0207692_10040000 3300025898 Bacteria 2311
280 Ga0207692_10069581 3300025898 Bacteria 1850
281 Ga0207642_10013700 3300025899 Bacteria 2967
282 Ga0207710_10006201 3300025900 Bacteria 5115
283 Ga0207688_10000432 3300025901 Bacteria 19791
284 Ga0207680_10010733 3300025903 Bacteria 4595
285 Ga0207680_10234930 3300025903 Unclassified 1261
286 Ga0207647_10001819 3300025904 Bacteria 16370
287 Ga0207647_10017026 3300025904 Unclassified 4948
288 Ga0207699_10020573 3300025906 Bacteria 3540
289 Ga0207699_10125050 3300025906 Bacteria 1669
290 Ga0207699_10213119 3300025906 Unclassified 1314
291 Ga0207645_10000054 3300025907 Bacteria 83043
292 Ga0207643_10000357 3300025908 Bacteria 30643
293 Ga0207684_10004933 3300025910 Bacteria 12450
294 Ga0207684_10107798 3300025910 Bacteria 2383
295 Ga0207654_10016926 3300025911 Bacteria 3804
296 Ga0207654_10023809 3300025911 Bacteria 3285
297 Ga0207654_10038108 3300025911 Bacteria 2695
298 Ga0207707_10002233 3300025912 Bacteria 17498
299 Ga0207707_10008169 3300025912 Bacteria 9081
300 Ga0207707_10012978 3300025912 Bacteria 7254
301 Ga0207707_10932663 3300025912 Unclassified 716
302 Ga0207695_10003189 3300025913 Bacteria 23369
303 Ga0207695_10064777 3300025913 Bacteria 3761
304 Ga0207695_10103413 3300025913 Bacteria 2840
305 Ga0207695_10210630 3300025913 Bacteria 1854
306 Ga0207695_10318413 3300025913 Bacteria 1445
307 Ga0207695_10408030 3300025913 Unclassified 1243
308 Ga0207671_10105835 3300025914 Bacteria 2135
309 Ga0207671_10333073 3300025914 Bacteria 1202
310 Ga0207693_10008765 3300025915 Bacteria 8268
311 Ga0207693_10038523 3300025915 Bacteria 3764
312 Ga0207663_10024426 3300025916 Bacteria 3481
313 Ga0207663_10057082 3300025916 Bacteria 2458
314 Ga0207663_10331860 3300025916 Unclassified 1146
315 Ga0207663_10397911 3300025916 Unclassified 1053
316 Ga0207660_10007390 3300025917 Bacteria 7108
317 Ga0207660_10043593 3300025917 Bacteria 3153
318 Ga0207660_10139208 3300025917 Bacteria 1854
319 Ga0207660_10151981 3300025917 Bacteria 1779
320 Ga0207662_10033180 3300025918 Bacteria 3007
321 Ga0207662_10113876 3300025918 Bacteria 1689
322 Ga0207657_10000255 3300025919 Bacteria 56523
323 Ga0207649_10000754 3300025920 Bacteria 21137
324 Ga0207652_10001085 3300025921 Bacteria 24651
325 Ga0207652_10024384 3300025921 Bacteria 5018
326 Ga0207652_10058081 3300025921 Bacteria 3333
327 Ga0207646_10001163 3300025922 Bacteria 33392
328 Ga0207646_10060990 3300025922 Bacteria 3367
329 Ga0207646_10227530 3300025922 Unclassified 1685
330 Ga0207646_10563676 3300025922 Bacteria 1023
331 Ga0207650_10000042 3300025925 Bacteria 191592
332 Ga0207650_10090468 3300025925 Bacteria 2337
333 Ga0207659_10017863 3300025926 Bacteria 4641
334 Ga0207659_10949143 3300025926 Bacteria 740
335 Ga0207687_11023430 3300025927 Bacteria 708
336 Ga0207700_10003196 3300025928 Bacteria 9456
337 Ga0207700_10030733 3300025928 Bacteria 3807
338 Ga0207700_10048486 3300025928 Unclassified 3154
339 Ga0207700_10056923 3300025928 Bacteria 2946
340 Ga0207700_10110750 3300025928 Unclassified 2209
341 Ga0207700_10135368 3300025928 Unclassified 2017
342 Ga0207700_10224994 3300025928 Bacteria 1592
343 Ga0207700_10362265 3300025928 Unclassified 1264
344 Ga0207664_10002128 3300025929 Bacteria 13041
345 Ga0207664_10016114 3300025929 Bacteria 5445
346 Ga0207664_10023111 3300025929 Unclassified 4654
347 Ga0207664_10039412 3300025929 Unclassified 3668
348 Ga0207664_10139996 3300025929 Bacteria 2046
349 Ga0207664_10211094 3300025929 Unclassified 1680
350 Ga0207664_10747170 3300025929 Unclassified 880
351 Ga0207644_10012550 3300025931 Bacteria 5630
352 Ga0207690_10146418 3300025932 Bacteria 1747
353 Ga0207706_10000945 3300025933 Bacteria 29679
354 Ga0207686_10526860 3300025934 Unclassified 920
355 Ga0207670_10056233 3300025936 Bacteria 2663
356 Ga0207670_10155935 3300025936 Bacteria 1700
357 Ga0207669_10006447 3300025937 Bacteria 5364
358 Ga0207704_10016610 3300025938 Bacteria 3788
359 Ga0207704_10055613 3300025938 Bacteria 2419
360 Ga0207665_10000209 3300025939 Bacteria 39512
361 Ga0207665_10008318 3300025939 Bacteria 6848
362 Ga0207665_10114879 3300025939 Bacteria 1896
363 Ga0207665_10207276 3300025939 Unclassified 1430
364 Ga0207665_10233585 3300025939 Unclassified 1352
365 Ga0207691_10000051 3300025940 Bacteria 94390
366 Ga0207711_10092035 3300025941 Bacteria 2668
367 Ga0207711_10429749 3300025941 Unclassified 1229
368 Ga0207689_10000288 3300025942 Bacteria 45755
369 Ga0207689_10018257 3300025942 Bacteria 5919
370 Ga0207661_10000084 3300025944 Bacteria 65203
371 Ga0207661_10116734 3300025944 Bacteria 2266
372 Ga0207661_10239211 3300025944 Bacteria 1610
373 Ga0207679_10000050 3300025945 Bacteria 112411
374 Ga0207679_10032490 3300025945 Bacteria 3664
375 Ga0207679_10242615 3300025945 Bacteria 1527
376 Ga0207667_10000646 3300025949 Bacteria 45220
377 Ga0207667_10006050 3300025949 Bacteria 14711
378 Ga0207667_10009731 3300025949 Bacteria 11303
379 Ga0207667_10063374 3300025949 Bacteria 3862
380 Ga0207651_10087623 3300025960 Bacteria 2266
381 Ga0207712_10047101 3300025961 Bacteria 2992
382 Ga0207668_10030286 3300025972 Bacteria 3555
383 Ga0207640_10009871 3300025981 Bacteria 5358
384 Ga0207640_10058954 3300025981 Bacteria 2531
385 Ga0207640_10089382 3300025981 Bacteria 2129
386 Ga0207658_10462833 3300025986 Unclassified 1124
387 Ga0207677_10004056 3300026023 Bacteria 7823
388 Ga0207677_10014919 3300026023 Bacteria 4551
389 Ga0207677_10099521 3300026023 Unclassified 2136
390 Ga0207703_10003004 3300026035 Bacteria 14303
391 Ga0207703_10014978 3300026035 Bacteria 6052
392 Ga0207703_10142916 3300026035 Bacteria 2079
393 Ga0207703_10956689 3300026035 Bacteria 821
394 Ga0207639_10017913 3300026041 Bacteria 5024
395 Ga0207639_10092817 3300026041 Bacteria 2420
396 Ga0207639_10322560 3300026041 Bacteria 1372
397 Ga0207678_10000023 3300026067 Bacteria 126241
398 Ga0207708_10081465 3300026075 Bacteria 2488
399 Ga0207702_10000714 3300026078 Bacteria 35703
400 Ga0207702_10005341 3300026078 Bacteria 11261
401 Ga0207702_10024559 3300026078 Bacteria 5001
402 Ga0207702_10029900 3300026078 Bacteria 4536
403 Ga0207702_10048865 3300026078 Bacteria 3568
404 Ga0207641_10000059 3300026088 Bacteria 164728
405 Ga0207641_10075040 3300026088 Bacteria 2919
406 Ga0207648_10000041 3300026089 Bacteria 115866
407 Ga0207648_10053402 3300026089 Bacteria 3532
408 Ga0207676_10000080 3300026095 Bacteria 94513
409 Ga0207676_10014943 3300026095 Bacteria 5593
410 Ga0207676_10101352 3300026095 Unclassified 2387
411 Ga0207674_10000047 3300026116 Bacteria 120929
412 Ga0207674_10002045 3300026116 Bacteria 25609
413 Ga0207674_10004237 3300026116 Bacteria 17310
414 Ga0207675_100022360 3300026118 Bacteria 5889
415 Ga0207675_100373286 3300026118 Unclassified 1401
416 Ga0207683_10000017 3300026121 Bacteria 123119
417 Ga0207683_10829590 3300026121 Bacteria 858
418 Ga0207698_10135423 3300026142 Bacteria 2113
419 Ga0207698_10351931 3300026142 Bacteria 1392
420 Ga0209588_1061607 3300027671 Unclassified 1213
421 Ga0268266_10003183 3300028379 Bacteria 16640
422 Ga0268265_10004796 3300028380 Bacteria 9320
423 Ga0268264_10031922 3300028381 Bacteria 4321
424 Ga0268264_10124732 3300028381 Bacteria 2274
425 Ga0268264_11251464 3300028381 Unclassified 752
426 Ga0265760_10000414 3300031090 Bacteria 12005
427 Ga0265760_10052061 3300031090 Bacteria 1234
428 Ga0307408_100531330 3300031548 Bacteria 1035
429 Ga0307413_10023202 3300031824 Bacteria 3359
430 Ga0307410_10035940 3300031852 Bacteria 3222
431 Ga0307412_10636896 3300031911 Bacteria 908
432 Ga0307409_100036548 3300031995 Bacteria 3612
433 Ga0307416_100694501 3300032002 Bacteria 1106
434 Ga0307411_10342975 3300032005 Bacteria 1215
435 Ga0307415_100249204 3300032126 Bacteria 1442
436 Ga0373926_0004258 3300035083 Bacteria 4679
437 Ga0373936_0019657 3300035113 Bacteria 2618
438 Ga0373936_0041314 3300035113 Bacteria 1850
439 Ga0373936_0269092 3300035113 Unclassified 764
440 Ga0373943_0148726 3300035170 Unclassified 1267
441 Ga0373931_0068046 3300035691 Bacteria 1937
442 Ga0373935_0002156 3300035692 Bacteria 11170
443 Ga0373935_0034382 3300035692 Unclassified 3159
444 Ga0373935_0305816 3300035692 Bacteria 1125
445 Ga0373935_0334942 3300035692 Unclassified 1076
446 Ga0373927_0034704 3300035695 Bacteria 3280
447 Ga0373927_0046984 3300035695 Unclassified 2792
448 Ga0373927_0122026 3300035695 Unclassified 1701
449 Ga0373927_0131304 3300035695 Bacteria 1636
450 Ga0373927_0138196 3300035695 Unclassified 1593
451 Ga0373933_0056628 3300035724 Bacteria 2354
452 Ga0373933_0201811 3300035724 Unclassified 1273
453 Ga0373947_0054390 3300035725 Unclassified 2416
454 Ga0373947_0253998 3300035725 Unclassified 1163
455 Ga0373937_0406402 3300036401 Bacteria 1292
456 Ga0373937_0613835 3300036401 Bacteria 1032
457 Ga0373925_0001230 3300037068 Bacteria 22647
458 Ga0373925_0004239 3300037068 Bacteria 10867
459 Ga0373925_0085408 3300037068 Bacteria 2406
460 Ga0373925_0253210 3300037068 Bacteria 1413
461 Ga0395905_0018653 3300037471 Bacteria 6581
462 Ga0436363_0902602 3300039450 Bacteria 1944
463 Ga0453683_0018586 3300044673 Bacteria 4461
464 Ga0466961_0069047 3300044693 Unclassified 2244
465 Ga0466963_0055426 3300044694 Bacteria 2636
466 Ga0466964_0103962 3300044706 Bacteria 1256
467 Ga0453684_0010627 3300044712 Bacteria 15683
468 Ga0466970_0236809 3300044765 Bacteria 1021
469 Ga0466959_0225569 3300045049 Bacteria 1298
470 Ga0466958_0028494 3300045836 Bacteria 3312
471 Ga0466967_0008923 3300045976 Bacteria 7401
472 Ga0466967_0336272 3300045976 Bacteria 1459
473 Ga0495651_0055917 3300046462 Bacteria 3031
474 Ga0495580_0002918 3300046472 Bacteria 14688
475 Ga0495580_0003913 3300046472 Bacteria 12579
476 Ga0495580_0053640 3300046472 Bacteria 2844
477 Ga0495580_0065686 3300046472 Unclassified 2541
478 Ga0495580_0095993 3300046472 Bacteria 2062
479 Ga0495580_0172907 3300046472 Bacteria 1493
480 Ga0495582_0000571 3300046473 Bacteria 20379
481 Ga0495664_0093690 3300046477 Unclassified 1807
482 Ga0495664_0143460 3300046477 Bacteria 1448
483 Ga0495630_0818312 3300046517 Unclassified 711
484 Ga0495665_0002493 3300046531 Bacteria 9936
485 Ga0495586_0184494 3300046535 Unclassified 1181
486 Ga0495645_0146221 3300046543 Bacteria 1646
487 Ga0495645_0222171 3300046543 Unclassified 1270
488 Ga0495646_0437250 3300046680 Unclassified 677
489 Ga0495669_0082282 3300046684 Bacteria 1479
490 Ga0495581_0005459 3300047315 Bacteria 7356
491 Ga0495674_0237514 3300047319 Unclassified 1503
492 Ga0495680_0002344 3300047322 Bacteria 19427
493 Ga0495675_0021019 3300047444 Bacteria 4156
494 Ga0495602_0037938 3300048088 Unclassified 4462
495 Ga0495602_0101350 3300048088 Unclassified 2362
496 Ga0495602_0249967 3300048088 Bacteria 1322
497 Ga0495602_0276176 3300048088 Unclassified 1240
498 Ga0495602_0375730 3300048088 Bacteria 1019
499 Ga0496100_0044574 3300048903 Bacteria 2842
500 Ga0496100_0195908 3300048903 Bacteria 1470
501 Ga0496102_0016904 3300048905 Bacteria 6384
502 Ga0496102_0073398 3300048905 Bacteria 3145
503 Ga0496102_0189129 3300048905 Bacteria 1940
504 Ga0496102_0468261 3300048905 Bacteria 1181
505 Ga0496103_0012168 3300048906 Bacteria 5112
506 Ga0496104_0003959 3300048907 Bacteria 12818
507 Ga0496104_0055528 3300048907 Unclassified 3745
508 Ga0496104_0230972 3300048907 Bacteria 1762
509 Ga0496104_0456522 3300048907 Unclassified 1189
510 Ga0496105_0193767 3300048908 Bacteria 1661
511 Ga0496105_0222724 3300048908 Bacteria 1535
512 Ga0496106_0259454 3300048909 Bacteria 1390
513 Ga0496106_0945879 3300048909 Unclassified 679
514 Ga0496107_0200556 3300048910 Bacteria 1483
515 Ga0496108_0000557 3300048911 Bacteria 29188
516 Ga0496108_0126976 3300048911 Bacteria 2190
517 Ga0496109_0000059 3300048912 Bacteria 118169
518 Ga0496109_0001940 3300048912 Bacteria 17189
519 Ga0496109_0502169 3300048912 Bacteria 1145
520 Ga0496110_0000974 3300048913 Bacteria 20065
521 Ga0496110_0156773 3300048913 Bacteria 2062
522 Ga0496111_0053841 3300048914 Bacteria 2908
523 Ga0496111_0135862 3300048914 Bacteria 1821
524 Ga0496112_0000027 3300048915 Bacteria 139514
525 Ga0496112_0001500 3300048915 Bacteria 17969
526 Ga0496112_0003197 3300048915 Bacteria 13479
527 Ga0496112_0027293 3300048915 Bacteria 5505
528 Ga0496112_0031414 3300048915 Bacteria 5151
529 Ga0496113_0000115 3300048916 Bacteria 34616
530 Ga0496113_0051282 3300048916 Bacteria 3079
531 Ga0496113_1029448 3300048916 Unclassified 648
532 Ga0496115_0093730 3300048918 Bacteria 2456
533 Ga0501041_0463248 3300049577 Bacteria 805
534 Ga0501072_0185660 3300049588 Bacteria 1659
535 Ga0501075_0325697 3300049591 Bacteria 1171
536 Ga0501076_0407816 3300049592 Bacteria 1118
537 nmdc:mga05p37_1510953_c1 3300050507 Bacteria 668
538 nmdc:mga09592_790702_c1 3300050508 Bacteria 803
539 nmdc:mga0n895_104952_c1 3300050512 Bacteria 2838
540 nmdc:mga0n895_134061_c1 3300050512 Bacteria 2502
541 nmdc:mga08x19_136591_c1 3300050514 Bacteria 1653
542 nmdc:mga08x19_676_c1 3300050514 Bacteria 21865
543 nmdc:mga0a205_140189_c1 3300050515 Bacteria 2318
544 nmdc:mga0a205_162306_c1 3300050515 Bacteria 2130
545 Ga0501082_0000020 3300060353 Bacteria 109889
546 2740994345 2740891818 Bacteria 6711283
547 Ga0466964_0271868
548 MBSR1b_contig_1819181
549 MBSR1b_contig_9596287
550 JGI24748J21848_1002446
551 rootH1_10316799
552 Ga0058863_10117812
553 Ga0065715_10093129
554 Ga0065715_10106120
555 Ga0070683_100014470
556 Ga0070683_100046144
557 Ga0070683_100106934
558 Ga0070690_100083628
559 Ga0070670_100015937
560 Ga0070670_100023731
561 Ga0070677_10006436
562 Ga0068869_100004740
563 Ga0068869_100068568
564 Ga0070666_10551428
565 Ga0070680_100027984
566 Ga0070680_100039531
567 Ga0070680_100059082
568 Ga0070682_100029531
569 Ga0068868_100003992
570 Ga0068868_100015995
571 Ga0068868_100030209
572 Ga0068868_100040599
573 Ga0068868_100325588
574 Ga0070689_100005917
575 Ga0070689_100067621
576 Ga0070689_100070322
577 Ga0070687_100010826
578 Ga0070687_100044294
579 Ga0070661_100128983
580 Ga0070692_10159972
581 Ga0070668_100014230
582 Ga0070669_100023560
583 Ga0070675_100014129
584 Ga0070671_100047948
585 Ga0070671_100087618
586 Ga0070673_100001892
587 Ga0070688_100000291
588 Ga0070659_100020726
589 Ga0070659_100099071
590 Ga0070709_10008949
591 Ga0070709_10028307
592 Ga0070709_10294041
593 Ga0070709_10618924
594 Ga0070714_100005420
595 Ga0070714_100006203
596 Ga0070714_100050099
597 Ga0070714_100057862
598 Ga0070714_100104665
599 Ga0070714_100109681
600 Ga0070714_100228359
601 Ga0070714_100866781
602 Ga0070713_100002746
603 Ga0070713_100035332
604 Ga0070713_100046283
605 Ga0070713_100070913
606 Ga0070713_100110699
607 Ga0070713_100136291
608 Ga0070713_100262714
609 Ga0070710_10063901
610 Ga0070711_100032486
611 Ga0070711_100035324
612 Ga0070711_100067613
613 Ga0070711_100153610
614 Ga0070705_100078698
615 Ga0070700_100150343
616 Ga0070708_100000862
617 Ga0070708_100003295
618 Ga0070708_100048469
619 Ga0070708_100300335
620 Ga0070708_100635498
621 Ga0070663_100022702
622 Ga0070678_100225020
623 Ga0070678_100262744
624 Ga0070662_100020933
625 Ga0070662_100277078
626 Ga0070681_10000331
627 Ga0070681_10036552
628 Ga0070681_10041415
629 Ga0070681_10244844
630 Ga0068867_100001551
631 Ga0068867_100003250
632 Ga0070685_10004801
633 Ga0070706_100005942
634 Ga0070706_100148933
635 Ga0070707_100001024
636 Ga0070707_100074341
637 Ga0070707_100337398
638 Ga0070707_100678279
639 Ga0070698_100000007
640 Ga0070698_100097862
641 Ga0070698_100118319
642 Ga0070699_100001930
643 Ga0070699_100035214
644 Ga0070679_100008261
645 Ga0070679_100015951
646 Ga0070679_100016021
647 Ga0070679_100020224
648 Ga0070679_100033162
649 Ga0070684_100003101
650 Ga0070684_100003738
651 Ga0070684_100072874
652 Ga0070697_100000126
653 Ga0070697_100012182
654 Ga0070697_100013881
655 Ga0070697_100087507
656 Ga0068853_100058428
657 Ga0068853_100206531
658 Ga0068853_100781867
659 Ga0070672_100000501
660 Ga0070672_100273718
661 Ga0070696_100055852
662 Ga0070693_100068343
663 Ga0070693_100084267
664 Ga0068855_100003709
665 Ga0068855_100014036
666 Ga0068855_100014203
667 Ga0068855_100014552
668 Ga0068855_100025519
669 Ga0068855_100086034
670 Ga0070664_100001789
671 Ga0070664_100009974
672 Ga0070664_100095318
673 Ga0068857_100000154
674 Ga0068857_100020520
675 Ga0068857_100024772
676 Ga0068854_100013693
677 Ga0068854_100044672
678 Ga0068854_100108548
679 Ga0068856_100000612
680 Ga0068856_100001311
681 Ga0068856_100006576
682 Ga0068856_100008973
683 Ga0068856_100037452
684 Ga0070702_100012598
685 Ga0068852_100009503
686 Ga0068852_100252159
687 Ga0068852_100303156
688 Ga0068859_100001314
689 Ga0068859_100022694
690 Ga0068864_100000518
691 Ga0068864_100018566
692 Ga0068864_100021601
693 Ga0068866_10019748
694 Ga0068861_100008896
695 Ga0068861_100142714
696 Ga0068851_10000317
697 Ga0068870_10007782
698 Ga0068863_100016294
699 Ga0068863_100025741
700 Ga0068858_100000491
701 Ga0068858_100040131
702 Ga0068858_100165577
703 Ga0068858_100321381
704 Ga0068860_100054556
705 Ga0068860_100139857
706 Ga0068860_100982065
707 Ga0068862_100007844
708 Ga0070717_10000142
709 Ga0070717_10002325
710 Ga0070717_10002532
711 Ga0070717_10076828
712 Ga0070717_10093274
713 Ga0070717_10221024
714 Ga0070717_10231691
715 Ga0070717_10232896
716 Ga0070717_10744285
717 Ga0070716_100000043
718 Ga0070716_100025023
719 Ga0070716_100093755
720 Ga0070716_100409668
721 Ga0070712_100002359
722 Ga0070712_100029602
723 Ga0097621_100001345
724 Ga0097621_100004782
725 Ga0097621_100030243
726 Ga0068871_100000369
727 Ga0068871_100004688
728 Ga0068871_100022322
729 Ga0075428_100177847
730 Ga0075431_100101036
731 Ga0075433_10036555
732 Ga0075433_10266908
733 Ga0075434_100087549
734 Ga0075434_100176930
735 Ga0075429_100062069
736 Ga0068865_100026371
737 Ga0068865_100039177
738 Ga0068865_100063262
739 Ga0075436_100001638
740 Ga0075436_100013902
741 Ga0075436_100108433
742 Ga0097620_100001314
743 Ga0097620_100022697
744 Ga0099794_10034368
745 Ga0099794_10614729
746 Ga0099795_10100981
747 Ga0105240_10003635
748 Ga0105240_10024373
749 Ga0105240_10042216
750 Ga0105240_10063610
751 Ga0105240_10103191
752 Ga0105240_10131485
753 Ga0105240_10351827
754 Ga0105240_10616105
755 Ga0105245_10217677
756 Ga0105245_10293715
757 Ga0105247_10001660
758 Ga0114129_10000435
759 Ga0114129_11274458
760 Ga0105241_10008803
761 Ga0105241_10012707
762 Ga0105241_10029642
763 Ga0105242_10069099
764 Ga0105248_10266435
765 Ga0105248_10892310
766 Ga0105237_10051637
767 Ga0105237_10083215
768 Ga0105237_10097608
769 Ga0105237_10325328
770 Ga0105238_10000339
771 Ga0105238_10076364
772 Ga0105249_10021168
773 Ga0105249_10413979
774 Ga0105239_10013506
775 Ga0105239_10046902
776 Ga0105239_10061856
777 Ga0105239_10081485
778 Ga0105246_10003366
779 Ga0105246_10025266
780 Ga0105246_10417008
781 Ga0157373_10006904
782 Ga0157373_10029404
783 Ga0157371_10003096
784 Ga0157371_10249254
785 Ga0157370_10114760
786 Ga0157369_10001152
787 Ga0157369_10026594
788 Ga0157369_10064469
789 Ga0157369_10077974
790 Ga0157374_10000322
791 Ga0157374_10000384
792 Ga0157374_10016973
793 Ga0157374_10023174
794 Ga0157374_10026152
795 Ga0157378_10000121
796 Ga0157378_10000188
797 Ga0157378_10003142
798 Ga0157378_10010666
799 Ga0157378_10122780
800 Ga0157378_10369946
801 Ga0163162_10286893
802 Ga0163162_11185286
803 Ga0157372_10000752
804 Ga0157372_10000798
805 Ga0157372_10003104
806 Ga0157372_10006231
807 Ga0157372_10007275
808 Ga0157372_10015143
809 Ga0157372_10036144
810 Ga0157372_10052306
811 Ga0157372_10068209
812 Ga0157375_10159842
813 Ga0163163_10005248
814 Ga0163163_10037143
815 Ga0163163_10729903
816 Ga0157380_10006198
817 Ga0157377_10009232
818 Ga0157379_10526122
819 Ga0163161_10002149
820 Ga0224572_1014940
821 Ga0228598_1000584
822 Ga0228598_1002748
823 Ga0207697_10005116
824 Ga0207682_10004646
825 Ga0207692_10040000
826 Ga0207692_10069581
827 Ga0207642_10013700
828 Ga0207710_10006201
829 Ga0207688_10000432
830 Ga0207680_10010733
831 Ga0207680_10234930
832 Ga0207647_10001819
833 Ga0207647_10017026
834 Ga0207699_10020573
835 Ga0207699_10125050
836 Ga0207699_10213119
837 Ga0207645_10000054
838 Ga0207643_10000357
839 Ga0207684_10004933
840 Ga0207684_10107798
841 Ga0207654_10016926
842 Ga0207654_10023809
843 Ga0207654_10038108
844 Ga0207707_10002233
845 Ga0207707_10008169
846 Ga0207707_10012978
847 Ga0207707_10932663
848 Ga0207695_10003189
849 Ga0207695_10064777
850 Ga0207695_10103413
851 Ga0207695_10210630
852 Ga0207695_10318413
853 Ga0207695_10408030
854 Ga0207671_10105835
855 Ga0207671_10333073
856 Ga0207693_10008765
857 Ga0207693_10038523
858 Ga0207663_10024426
859 Ga0207663_10057082
860 Ga0207663_10331860
861 Ga0207663_10397911
862 Ga0207660_10007390
863 Ga0207660_10043593
864 Ga0207660_10139208
865 Ga0207660_10151981
866 Ga0207662_10033180
867 Ga0207662_10113876
868 Ga0207657_10000255
869 Ga0207649_10000754
870 Ga0207652_10001085
871 Ga0207652_10024384
872 Ga0207652_10058081
873 Ga0207646_10001163
874 Ga0207646_10060990
875 Ga0207646_10227530
876 Ga0207646_10563676
877 Ga0207650_10000042
878 Ga0207650_10090468
879 Ga0207659_10017863
880 Ga0207659_10949143
881 Ga0207687_11023430
882 Ga0207700_10003196
883 Ga0207700_10030733
884 Ga0207700_10048486
885 Ga0207700_10056923
886 Ga0207700_10110750
887 Ga0207700_10135368
888 Ga0207700_10224994
889 Ga0207700_10362265
890 Ga0207664_10002128
891 Ga0207664_10016114
892 Ga0207664_10023111
893 Ga0207664_10039412
894 Ga0207664_10139996
895 Ga0207664_10211094
896 Ga0207664_10747170
897 Ga0207644_10012550
898 Ga0207690_10146418
899 Ga0207706_10000945
900 Ga0207686_10526860
901 Ga0207670_10056233
902 Ga0207670_10155935
903 Ga0207669_10006447
904 Ga0207704_10016610
905 Ga0207704_10055613
906 Ga0207665_10000209
907 Ga0207665_10008318
908 Ga0207665_10114879
909 Ga0207665_10207276
910 Ga0207665_10233585
911 Ga0207691_10000051
912 Ga0207711_10092035
913 Ga0207711_10429749
914 Ga0207689_10000288
915 Ga0207689_10018257
916 Ga0207661_10000084
917 Ga0207661_10116734
918 Ga0207661_10239211
919 Ga0207679_10000050
920 Ga0207679_10032490
921 Ga0207679_10242615
922 Ga0207667_10000646
923 Ga0207667_10006050
924 Ga0207667_10009731
925 Ga0207667_10063374
926 Ga0207651_10087623
927 Ga0207712_10047101
928 Ga0207668_10030286
929 Ga0207640_10009871
930 Ga0207640_10058954
931 Ga0207640_10089382
932 Ga0207658_10462833
933 Ga0207677_10004056
934 Ga0207677_10014919
935 Ga0207677_10099521
936 Ga0207703_10003004
937 Ga0207703_10014978
938 Ga0207703_10142916
939 Ga0207703_10956689
940 Ga0207639_10017913
941 Ga0207639_10092817
942 Ga0207639_10322560
943 Ga0207678_10000023
944 Ga0207708_10081465
945 Ga0207702_10000714
946 Ga0207702_10005341
947 Ga0207702_10024559
948 Ga0207702_10029900
949 Ga0207702_10048865
950 Ga0207641_10000059
951 Ga0207641_10075040
952 Ga0207648_10000041
953 Ga0207648_10053402
954 Ga0207676_10000080
955 Ga0207676_10014943
956 Ga0207676_10101352
957 Ga0207674_10000047
958 Ga0207674_10002045
959 Ga0207674_10004237
960 Ga0207675_100022360
961 Ga0207675_100373286
962 Ga0207683_10000017
963 Ga0207683_10829590
964 Ga0207698_10135423
965 Ga0207698_10351931
966 Ga0209588_1061607
967 Ga0268266_10003183
968 Ga0268265_10004796
969 Ga0268264_10031922
970 Ga0268264_10124732
971 Ga0268264_11251464
972 Ga0265760_10000414
973 Ga0265760_10052061
974 Ga0307408_100531330
975 Ga0307413_10023202
976 Ga0307410_10035940
977 Ga0307412_10636896
978 Ga0307409_100036548
979 Ga0307416_100694501
980 Ga0307411_10342975
981 Ga0307415_100249204
982 Ga0373926_0004258
983 Ga0373936_0019657
984 Ga0373936_0041314
985 Ga0373936_0269092
986 Ga0373943_0148726
987 Ga0373931_0068046
988 Ga0373935_0002156
989 Ga0373935_0034382
990 Ga0373935_0305816
991 Ga0373935_0334942
992 Ga0373927_0034704
993 Ga0373927_0046984
994 Ga0373927_0122026
995 Ga0373927_0131304
996 Ga0373927_0138196
997 Ga0373933_0056628
998 Ga0373933_0201811
999 Ga0373947_0054390
1000 Ga0373947_0253998
1001 Ga0373937_0406402
1002 Ga0373937_0613835
1003 Ga0373925_0001230
1004 Ga0373925_0004239
1005 Ga0373925_0085408
1006 Ga0373925_0253210
1007 Ga0395905_0018653
1008 Ga0436363_0902602
1009 Ga0453683_0018586
1010 Ga0466961_0069047
1011 Ga0466963_0055426
1012 Ga0466964_0103962
1013 Ga0453684_0010627
1014 Ga0466970_0236809
1015 Ga0466959_0225569
1016 Ga0466958_0028494
1017 Ga0466967_0008923
1018 Ga0466967_0336272
1019 Ga0495651_0055917
1020 Ga0495580_0002918
1021 Ga0495580_0003913
1022 Ga0495580_0053640
1023 Ga0495580_0065686
1024 Ga0495580_0095993
1025 Ga0495580_0172907
1026 Ga0495582_0000571
1027 Ga0495664_0093690
1028 Ga0495664_0143460
1029 Ga0495630_0818312
1030 Ga0495665_0002493
1031 Ga0495586_0184494
1032 Ga0495645_0146221
1033 Ga0495645_0222171
1034 Ga0495646_0437250
1035 Ga0495669_0082282
1036 Ga0495581_0005459
1037 Ga0495674_0237514
1038 Ga0495680_0002344
1039 Ga0495675_0021019
1040 Ga0495602_0037938
1041 Ga0495602_0101350
1042 Ga0495602_0249967
1043 Ga0495602_0276176
1044 Ga0495602_0375730
1045 Ga0496100_0044574
1046 Ga0496100_0195908
1047 Ga0496102_0016904
1048 Ga0496102_0073398
1049 Ga0496102_0189129
1050 Ga0496102_0468261
1051 Ga0496103_0012168
1052 Ga0496104_0003959
1053 Ga0496104_0055528
1054 Ga0496104_0230972
1055 Ga0496104_0456522
1056 Ga0496105_0193767
1057 Ga0496105_0222724
1058 Ga0496106_0259454
1059 Ga0496106_0945879
1060 Ga0496107_0200556
1061 Ga0496108_0000557
1062 Ga0496108_0126976
1063 Ga0496109_0000059
1064 Ga0496109_0001940
1065 Ga0496109_0502169
1066 Ga0496110_0000974
1067 Ga0496110_0156773
1068 Ga0496111_0053841
1069 Ga0496111_0135862
1070 Ga0496112_0000027
1071 Ga0496112_0001500
1072 Ga0496112_0003197
1073 Ga0496112_0027293
1074 Ga0496112_0031414
1075 Ga0496113_0000115
1076 Ga0496113_0051282
1077 Ga0496113_1029448
1078 Ga0496115_0093730
1079 Ga0501041_0463248
1080 Ga0501072_0185660
1081 Ga0501075_0325697
1082 Ga0501076_0407816
1083 nmdc:mga05p37_1510953_c1
1084 nmdc:mga09592_790702_c1
1085 nmdc:mga0n895_104952_c1
1086 nmdc:mga0n895_134061_c1
1087 nmdc:mga08x19_136591_c1
1088 nmdc:mga08x19_676_c1
1089 nmdc:mga0a205_140189_c1
1090 nmdc:mga0a205_162306_c1
1091 Ga0501082_0000020
1092 2740994345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11984

DUF3485

Protein of unknown function (DUF3485)

35

239

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yh2-assembly1.cif.gz_C pyrobaculum calidifontis esterase monoclinic form 0.7647 79 100
2ofj-assembly3.cif.gz_C crystal structure of the e190a mutant of o-succinylbenzoate synthase from escherichia coli 0.6401 78 112
7k3m-assembly1.cif.gz_A crystal structure of the beta lactamase class d from chitinophaga pinensis by serial crystallography 0.6375 94 175
4v3p-assembly1.cif.gz_SE the molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes 0.5826 75 104
4i14-assembly1.cif.gz_A crystal structure of mtb-riba2 (rv1415) 0.5648 77 114
ID Description Score Start End Superfamily
af_A0A0R4IVP6_260_438_2.30.29.230 Mainly Beta;Roll;PH-domain like; 0.7758 75 112 2.30.29.230
4ypvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.722 79 100 3.40.50.1820
af_Q6NVF0_1_119_2.30.29.110 Mainly Beta;Roll;PH-domain like; 0.7163 75 121 2.30.29.110
af_Q9M122_104_225_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7092 70 113 2.30.29.30
af_Q4DS60_382_537_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6457 76 122 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2V7IZK5-F1-model_v4 EpsI family protein 0.9679 1 181
AF-A0A7V8XCD3-F1-model_v4 EpsI family protein 0.9653 1 180 GO:0016020
AF-A0A1Q7E060-F1-model_v4 EpsI family protein 0.9639 1 181
AF-A0A2V7IZK5-F1-model_v4 EpsI family protein 0.9627 1 181
AF-A0A1Q7E060-F1-model_v4 EpsI family protein 0.9587 1 181

Map