F461938

General Info

Members Datasets Scaffolds Average Seq Length
546 263 538 299

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10018527|JGI24739J22299_100185273
Length 359
Sequence MRSNLLTLDTVAFELVPPNADLGPEQAVEEARKVLRFSKETGIDGRIRHVMIPGMIEEDDDRPVEMKPRLDVLEFWNIIKPELRGLKGLCTQVTAFMNEESLRHRLSDLRDAGFDGIAFVGVPRTLNDGEGSGVAPTDALSIYDQIVPNRGAILIPTRDGEQGRFNFKCNQGATYGMTQLLYSDAIVGFLTEFAKTTDYRPEILLSFGFVPKVETRIGLISWLIQDPGNAAVADEQAFVAQLAETEPAQKRKLMIDLYKRVIDGVAGLGFPLSVHLEAAYGASVPAFETFAEMLDYWSPPTRADFAQTHVCPLCQAGCESVGGQQGAWWCQLVRVLPRQRWWSWFMSITCNRMVRRRRG

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
7 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.84
Nodule 0.18
Rhizoplane 12.45
Rhizosphere 62.82
Stem 0
Stem Tuber 0
Unclassified 9.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1005051 3300001977 Bacteria 2067
2 JGI24739J22299_10018527 3300001989 Bacteria 2500
3 JGI24737J22298_10012126 3300001990 Bacteria 2813
4 JGI24750J21931_1011196 3300002070 Bacteria 1177
5 JGI24745J21846_1003206 3300002073 Bacteria 1701
6 JGI24745J21846_1004105 3300002073 Bacteria 1547
7 JGI24738J21930_10005296 3300002075 Bacteria 3103
8 JGI24738J21930_10026115 3300002075 Bacteria 1199
9 JGI24749J21850_1007037 3300002076 Bacteria 1564
10 JGI24744J21845_10000685 3300002077 Bacteria 6231
11 JGI24744J21845_10005686 3300002077 Bacteria 2582
12 JGI24034J26672_10001882 3300002239 Bacteria 2833
13 JGI24742J22300_10002031 3300002244 Bacteria 3232
14 JGI24742J22300_10003629 3300002244 Bacteria 2505
15 JGI24751J29686_10005699 3300002459 Bacteria 2538
16 Ga0055540_1000038 3300003792 Bacteria 161988
17 Ga0055540_1003856 3300003792 Bacteria 7039
18 Ga0055540_1004409 3300003792 Bacteria 6363
19 Ga0055540_1004593 3300003792 Bacteria 6135
20 Ga0070676_10049573 3300005328 Bacteria 2458
21 Ga0070676_10180572 3300005328 Bacteria 1372
22 Ga0070690_100021936 3300005330 Bacteria 3904
23 Ga0070670_100076851 3300005331 Bacteria 2869
24 Ga0068869_100024844 3300005334 Bacteria 4153
25 Ga0068869_100124776 3300005334 Bacteria 1973
26 Ga0070666_10067141 3300005335 Bacteria 2435
27 Ga0070666_10072923 3300005335 Bacteria 2338
28 Ga0070682_100017032 3300005337 Bacteria 4232
29 Ga0070682_100047840 3300005337 Bacteria 2660
30 Ga0068868_100007434 3300005338 Bacteria 7800
31 Ga0070660_100272852 3300005339 Bacteria 1383
32 Ga0070689_100043556 3300005340 Bacteria 3450
33 Ga0070689_100358513 3300005340 Bacteria 1224
34 Ga0070691_10010715 3300005341 Bacteria 4185
35 Ga0070692_10089997 3300005345 Bacteria 1667
36 Ga0070668_100001595 3300005347 Bacteria 16415
37 Ga0070668_100002321 3300005347 Bacteria 14003
38 Ga0070668_100079887 3300005347 Bacteria 2561
39 Ga0070669_100002101 3300005353 Bacteria 14412
40 Ga0070671_100000697 3300005355 Bacteria 24114
41 Ga0070674_100006289 3300005356 Bacteria 6916
42 Ga0070674_100040873 3300005356 Bacteria 3139
43 Ga0070673_100259787 3300005364 Bacteria 1517
44 Ga0070688_100004228 3300005365 Bacteria 7463
45 Ga0070659_100044272 3300005366 Bacteria 3484
46 Ga0070659_100235580 3300005366 Bacteria 1513
47 Ga0070667_100000139 3300005367 Bacteria 92556
48 Ga0070667_100003263 3300005367 Bacteria 13867
49 Ga0070667_100074582 3300005367 Bacteria 2894
50 Ga0070667_100147021 3300005367 Bacteria 2068
51 Ga0070709_10005248 3300005434 Bacteria 7010
52 Ga0070714_100391600 3300005435 Bacteria 1312
53 Ga0070713_100628179 3300005436 Bacteria 1022
54 Ga0070710_10005512 3300005437 Bacteria 6017
55 Ga0070710_10130268 3300005437 Bacteria 1533
56 Ga0070701_10014062 3300005438 Bacteria 3660
57 Ga0070711_100000871 3300005439 Bacteria 15864
58 Ga0070711_100007678 3300005439 Bacteria 6570
59 Ga0070700_100016761 3300005441 Bacteria 4177
60 Ga0070700_100115152 3300005441 Bacteria 1793
61 Ga0070694_100029835 3300005444 Bacteria 3563
62 Ga0070694_100259866 3300005444 Bacteria 1317
63 Ga0070663_100007745 3300005455 Bacteria 6560
64 Ga0070663_100254625 3300005455 Bacteria 1391
65 Ga0070678_100285982 3300005456 Bacteria 1396
66 Ga0070662_100037127 3300005457 Bacteria 3452
67 Ga0068867_100009327 3300005459 Bacteria 6925
68 Ga0068867_100192646 3300005459 Bacteria 1627
69 Ga0070685_10006150 3300005466 Bacteria 6112
70 Ga0070685_10008783 3300005466 Bacteria 5204
71 Ga0070685_10093956 3300005466 Bacteria 1820
72 Ga0070685_10108213 3300005466 Bacteria 1708
73 Ga0070684_100371159 3300005535 Bacteria 1317
74 Ga0068853_100002406 3300005539 Bacteria 13990
75 Ga0068853_100025519 3300005539 Bacteria 4960
76 Ga0070672_100428822 3300005543 Bacteria 1136
77 Ga0070695_100037965 3300005545 Bacteria 3037
78 Ga0070696_100127153 3300005546 Bacteria 1850
79 Ga0070693_100070969 3300005547 Bacteria 2051
80 Ga0070665_100003237 3300005548 Bacteria 17500
81 Ga0070665_100056805 3300005548 Bacteria 3924
82 Ga0070665_100119384 3300005548 Bacteria 2639
83 Ga0070704_100013310 3300005549 Bacteria 5102
84 Ga0068855_100117852 3300005563 Bacteria 3041
85 Ga0068854_100008040 3300005578 Bacteria 6759
86 Ga0068854_100010870 3300005578 Bacteria 5906
87 Ga0070702_100013513 3300005615 Bacteria 4122
88 Ga0070702_100126533 3300005615 Bacteria 1608
89 Ga0068852_100154003 3300005616 Bacteria 2140
90 Ga0068859_100001411 3300005617 Bacteria 24387
91 Ga0068859_100018889 3300005617 Bacteria 6926
92 Ga0068866_10000748 3300005718 Bacteria 14682
93 Ga0068866_10034040 3300005718 Bacteria 2478
94 Ga0068861_100001350 3300005719 Bacteria 15412
95 Ga0068861_100036165 3300005719 Bacteria 3663
96 Ga0068863_100002122 3300005841 Bacteria 19666
97 Ga0068863_100002757 3300005841 Bacteria 17400
98 Ga0068863_100016988 3300005841 Bacteria 6979
99 Ga0068858_100002402 3300005842 Bacteria 18936
100 Ga0068858_100029305 3300005842 Bacteria 5110
101 Ga0068858_100080184 3300005842 Bacteria 3033
102 Ga0068860_100000025 3300005843 Bacteria 271553
103 Ga0068860_100010382 3300005843 Bacteria 9212
104 Ga0068862_100000045 3300005844 Bacteria 155641
105 Ga0068862_100002207 3300005844 Bacteria 17459
106 Ga0068862_100003468 3300005844 Bacteria 13566
107 Ga0081455_10201060 3300005937 Bacteria 1492
108 Ga0075365_10004758 3300006038 Bacteria 7236
109 Ga0075365_10016933 3300006038 Bacteria 4449
110 Ga0075365_10022256 3300006038 Bacteria 3970
111 Ga0075365_10043457 3300006038 Bacteria 2942
112 Ga0075368_10057667 3300006042 Bacteria 1551
113 Ga0075363_100000267 3300006048 Bacteria 15005
114 Ga0075363_100001639 3300006048 Bacteria 8636
115 Ga0075363_100013378 3300006048 Bacteria 3975
116 Ga0075363_100017439 3300006048 Bacteria 3561
117 Ga0075363_100033732 3300006048 Bacteria 2668
118 Ga0075363_100047607 3300006048 Bacteria 2278
119 Ga0075363_100141564 3300006048 Bacteria 1354
120 Ga0075364_10006428 3300006051 Bacteria 6900
121 Ga0075364_10017292 3300006051 Bacteria 4502
122 Ga0075364_10038296 3300006051 Bacteria 3106
123 Ga0075364_10066661 3300006051 Bacteria 2365
124 Ga0075364_10070267 3300006051 Bacteria 2305
125 Ga0070715_10000504 3300006163 Bacteria 10181
126 Ga0070715_10081796 3300006163 Bacteria 1468
127 Ga0070716_100033607 3300006173 Bacteria 2806
128 Ga0070716_100048679 3300006173 Bacteria 2397
129 Ga0070712_100014966 3300006175 Bacteria 4987
130 Ga0070712_100128546 3300006175 Bacteria 1917
131 Ga0075362_10014243 3300006177 Bacteria 3205
132 Ga0075362_10070783 3300006177 Bacteria 1593
133 Ga0075367_10015426 3300006178 Bacteria 4152
134 Ga0075369_10006348 3300006186 Bacteria 4466
135 Ga0075369_10016660 3300006186 Bacteria 2968
136 Ga0075369_10021380 3300006186 Bacteria 2658
137 Ga0075369_10034247 3300006186 Bacteria 2155
138 Ga0075369_10116711 3300006186 Bacteria 1206
139 Ga0097621_100240404 3300006237 Bacteria 1583
140 Ga0075370_10000603 3300006353 Bacteria 13887
141 Ga0075370_10003322 3300006353 Bacteria 7638
142 Ga0075370_10121526 3300006353 Bacteria 1521
143 Ga0068871_100221417 3300006358 Bacteria 1640
144 Ga0068871_100323295 3300006358 Bacteria 1359
145 Ga0075428_100404744 3300006844 Bacteria 1462
146 Ga0075430_100052704 3300006846 Bacteria 3427
147 Ga0075430_100237313 3300006846 Bacteria 1511
148 Ga0075431_100060256 3300006847 Bacteria 3916
149 Ga0068865_100005062 3300006881 Bacteria 7977
150 Ga0068865_100086397 3300006881 Bacteria 2264
151 Ga0068865_100162458 3300006881 Bacteria 1705
152 Ga0097620_100001411 3300006931 Bacteria 24387
153 Ga0097620_100018887 3300006931 Bacteria 6926
154 Ga0105250_10069455 3300009092 Bacteria 1422
155 Ga0105240_10340484 3300009093 Bacteria 1704
156 Ga0105245_10010623 3300009098 Bacteria 8010
157 Ga0105245_10164949 3300009098 Bacteria 2105
158 Ga0105247_10000010 3300009101 Bacteria 302475
159 Ga0105247_10001034 3300009101 Bacteria 20938
160 Ga0105247_10081533 3300009101 Bacteria 2040
161 Ga0114129_10017451 3300009147 Bacteria 10220
162 Ga0105243_10080607 3300009148 Bacteria 2655
163 Ga0105243_10108866 3300009148 Bacteria 2314
164 Ga0105243_10233581 3300009148 Bacteria 1633
165 Ga0105242_10007030 3300009176 Bacteria 8689
166 Ga0105242_10171026 3300009176 Bacteria 1910
167 Ga0105248_10000100 3300009177 Bacteria 95523
168 Ga0105248_10010526 3300009177 Bacteria 10188
169 Ga0105248_10228312 3300009177 Bacteria 2095
170 Ga0105248_10445367 3300009177 Bacteria 1459
171 Ga0105237_10011565 3300009545 Bacteria 9334
172 Ga0105237_10012451 3300009545 Bacteria 8966
173 Ga0105237_10032181 3300009545 Bacteria 5311
174 Ga0105237_10122657 3300009545 Bacteria 2593
175 Ga0105238_10097872 3300009551 Bacteria 2919
176 Ga0105238_10688334 3300009551 Bacteria 1034
177 Ga0105249_10000010 3300009553 Bacteria 306939
178 Ga0105249_10002925 3300009553 Bacteria 14729
179 Ga0105239_10009913 3300010375 Bacteria 10699
180 Ga0105239_10014716 3300010375 Bacteria 8676
181 Ga0105239_10034420 3300010375 Bacteria 5563
182 Ga0105239_10203940 3300010375 Bacteria 2216
183 Ga0105246_10018825 3300011119 Bacteria 4403
184 Ga0157374_10274894 3300013296 Bacteria 1662
185 Ga0157378_10006641 3300013297 Bacteria 10106
186 Ga0163162_10003092 3300013306 Bacteria 15895
187 Ga0163162_10101835 3300013306 Bacteria 2964
188 Ga0163162_10107796 3300013306 Bacteria 2881
189 Ga0163162_10310569 3300013306 Bacteria 1709
190 Ga0163162_10366837 3300013306 Bacteria 1573
191 Ga0157372_10006186 3300013307 Bacteria 12725
192 Ga0157372_10617369 3300013307 Bacteria 1263
193 Ga0157375_10011102 3300013308 Bacteria 7943
194 Ga0157375_10315651 3300013308 Bacteria 1727
195 Ga0163163_10017211 3300014325 Bacteria 6735
196 Ga0163163_10180899 3300014325 Bacteria 2156
197 Ga0157380_10010025 3300014326 Bacteria 6800
198 Ga0157379_10093701 3300014968 Bacteria 2694
199 Ga0157379_10127586 3300014968 Bacteria 2289
200 Ga0157379_10279083 3300014968 Bacteria 1520
201 Ga0163161_10060626 3300017792 Bacteria 2754
202 Ga0163161_10125691 3300017792 Bacteria 1931
203 Ga0213876_10000655 3300021384 Bacteria 24852
204 Ga0213876_10076871 3300021384 Bacteria 1763
205 Ga0213875_10001791 3300021388 Bacteria 13421
206 Ga0213875_10046302 3300021388 Bacteria 2041
207 Ga0213875_10054070 3300021388 Bacteria 1881
208 Ga0209673_1016162 3300025273 Bacteria 2803
209 Ga0209051_1000014 3300025303 Bacteria 552732
210 Ga0209051_1000421 3300025303 Bacteria 58306
211 Ga0209051_1014493 3300025303 Bacteria 3674
212 Ga0209051_1027818 3300025303 Bacteria 2245
213 Ga0207692_10006942 3300025898 Bacteria 4616
214 Ga0207692_10159538 3300025898 Bacteria 1298
215 Ga0207642_10003427 3300025899 Bacteria 5006
216 Ga0207710_10000028 3300025900 Bacteria 304525
217 Ga0207710_10032231 3300025900 Bacteria 2295
218 Ga0207688_10009880 3300025901 Bacteria 5193
219 Ga0207688_10019736 3300025901 Bacteria 3674
220 Ga0207680_10005811 3300025903 Bacteria 5922
221 Ga0207647_10047851 3300025904 Bacteria 2658
222 Ga0207647_10187552 3300025904 Bacteria 1199
223 Ga0207685_10001479 3300025905 Bacteria 4954
224 Ga0207699_10060374 3300025906 Bacteria 2276
225 Ga0207643_10099106 3300025908 Bacteria 1707
226 Ga0207671_10017021 3300025914 Bacteria 5623
227 Ga0207671_10021095 3300025914 Bacteria 4948
228 Ga0207671_10078009 3300025914 Bacteria 2480
229 Ga0207693_10002371 3300025915 Bacteria 16366
230 Ga0207693_10002564 3300025915 Bacteria 15793
231 Ga0207663_10011426 3300025916 Bacteria 4769
232 Ga0207663_10245034 3300025916 Bacteria 1316
233 Ga0207660_10235431 3300025917 Bacteria 1441
234 Ga0207694_10042377 3300025924 Bacteria 3511
235 Ga0207694_10165678 3300025924 Bacteria 1787
236 Ga0207650_10078691 3300025925 Bacteria 2495
237 Ga0207659_10148867 3300025926 Bacteria 1826
238 Ga0207687_10006621 3300025927 Bacteria 7645
239 Ga0207687_10021285 3300025927 Bacteria 4308
240 Ga0207644_10010964 3300025931 Bacteria 5987
241 Ga0207706_10004955 3300025933 Bacteria 12442
242 Ga0207706_10132111 3300025933 Bacteria 2196
243 Ga0207686_10010464 3300025934 Bacteria 5053
244 Ga0207709_10011103 3300025935 Bacteria 4967
245 Ga0207670_10044458 3300025936 Bacteria 2938
246 Ga0207669_10000814 3300025937 Bacteria 13385
247 Ga0207669_10030727 3300025937 Bacteria 2989
248 Ga0207665_10048441 3300025939 Bacteria 2852
249 Ga0207691_10283216 3300025940 Bacteria 1426
250 Ga0207711_10001077 3300025941 Bacteria 26072
251 Ga0207711_10043424 3300025941 Bacteria 3834
252 Ga0207711_10093960 3300025941 Bacteria 2642
253 Ga0207711_10316232 3300025941 Bacteria 1442
254 Ga0207689_10002815 3300025942 Bacteria 16076
255 Ga0207689_10111490 3300025942 Bacteria 2249
256 Ga0207661_10264190 3300025944 Bacteria 1534
257 Ga0207712_10000016 3300025961 Bacteria 343014
258 Ga0207712_10014364 3300025961 Bacteria 5094
259 Ga0207712_10096635 3300025961 Bacteria 2187
260 Ga0207668_10000567 3300025972 Bacteria 23220
261 Ga0207668_10021724 3300025972 Bacteria 4097
262 Ga0207668_10045360 3300025972 Bacteria 2997
263 Ga0207640_10009069 3300025981 Bacteria 5553
264 Ga0207640_10197525 3300025981 Bacteria 1521
265 Ga0207658_10000675 3300025986 Bacteria 29755
266 Ga0207658_10002758 3300025986 Bacteria 12660
267 Ga0207658_10094353 3300025986 Bacteria 2328
268 Ga0207658_10350517 3300025986 Bacteria 1285
269 Ga0207677_10016824 3300026023 Bacteria 4343
270 Ga0207703_10078423 3300026035 Bacteria 2744
271 Ga0207703_10153180 3300026035 Bacteria 2012
272 Ga0207639_10123996 3300026041 Bacteria 2127
273 Ga0207639_10314105 3300026041 Bacteria 1389
274 Ga0207678_10012370 3300026067 Bacteria 7491
275 Ga0207678_10028368 3300026067 Bacteria 4886
276 Ga0207678_10074159 3300026067 Bacteria 2916
277 Ga0207708_10003698 3300026075 Bacteria 11291
278 Ga0207641_10006568 3300026088 Bacteria 9775
279 Ga0207641_10025907 3300026088 Bacteria 4837
280 Ga0207641_10026500 3300026088 Bacteria 4784
281 Ga0207648_10003795 3300026089 Bacteria 15793
282 Ga0207648_10007973 3300026089 Bacteria 10330
283 Ga0207675_100003299 3300026118 Bacteria 15793
284 Ga0207675_100042594 3300026118 Bacteria 4239
285 Ga0207675_100059229 3300026118 Bacteria 3573
286 Ga0207683_10002471 3300026121 Bacteria 16127
287 Ga0207683_10346971 3300026121 Bacteria 1362
288 Ga0207698_10063187 3300026142 Bacteria 2896
289 Ga0209813_10017644 3300027866 Bacteria 1962
290 Ga0268266_10012581 3300028379 Bacteria 7312
291 Ga0268266_10104227 3300028379 Bacteria 2504
292 Ga0268266_10124600 3300028379 Bacteria 2297
293 Ga0268266_10167539 3300028379 Bacteria 1992
294 Ga0268265_10000056 3300028380 Bacteria 155720
295 Ga0268265_10000147 3300028380 Bacteria 88026
296 Ga0268265_10015117 3300028380 Bacteria 5274
297 Ga0268265_10101276 3300028380 Bacteria 2327
298 Ga0268264_10000053 3300028381 Bacteria 320368
299 Ga0268264_10060159 3300028381 Bacteria 3183
300 Ga0265327_10000230 3300031251 Bacteria 113245
301 Ga0307413_10074011 3300031824 Bacteria 2156
302 Ga0307410_10047635 3300031852 Bacteria 2866
303 Ga0307416_100183381 3300032002 Bacteria 1964
304 Ga0307415_100043256 3300032126 Bacteria 3004
305 Ga0373931_0050427 3300035691 Bacteria 2214
306 Ga0373931_0192174 3300035691 Bacteria 1215
307 Ga0373947_0081869 3300035725 Bacteria 2000
308 Ga0316582_0138667 3300036647 Bacteria 1639
309 Ga0316584_0096967 3300036712 Bacteria 2208
310 Ga0436364_0488279 3300037853 Bacteria 58970
311 Ga0436364_0797903 3300037853 Bacteria 12284
312 Ga0436364_1254277 3300037853 Bacteria 3015
313 Ga0436364_1395195 3300037853 Bacteria 2460
314 Ga0436365_0634291 3300039437 Bacteria 58106
315 Ga0436365_0900994 3300039437 Bacteria 3280
316 Ga0436365_1472485 3300039437 Bacteria 19466
317 Ga0439466_0001544 3300041411 Bacteria 8995
318 Ga0439466_0048412 3300041411 Bacteria 1398
319 Ga0439465_0009904 3300041413 Bacteria 3001
320 Ga0439465_0024795 3300041413 Bacteria 1891
321 Ga0451789_0462202 3300041443 Bacteria 1128
322 Ga0451793_1540142 3300041452 Bacteria 1744
323 Ga0439431_0022463 3300041997 Bacteria 1521
324 Ga0439448_0016321 3300042005 Bacteria 2259
325 Ga0466972_0007423 3300044658 Bacteria 5512
326 Ga0466972_0019757 3300044658 Bacteria 3368
327 Ga0466972_0062128 3300044658 Bacteria 1790
328 Ga0466965_0001962 3300044683 Bacteria 8607
329 Ga0466965_0019697 3300044683 Bacteria 3240
330 Ga0466965_0025806 3300044683 Bacteria 2846
331 Ga0466965_0048220 3300044683 Bacteria 2110
332 Ga0466966_0039531 3300044684 Bacteria 3038
333 Ga0466966_0048013 3300044684 Bacteria 2720
334 Ga0466966_0071389 3300044684 Bacteria 2175
335 Ga0466961_0101121 3300044693 Bacteria 1816
336 Ga0466961_0132578 3300044693 Bacteria 1561
337 Ga0466963_0002687 3300044694 Bacteria 10012
338 Ga0466964_0054176 3300044706 Bacteria 1653
339 Ga0466971_0025554 3300044719 Bacteria 2637
340 Ga0466968_0001495 3300044735 Bacteria 8375
341 Ga0466968_0001675 3300044735 Bacteria 7991
342 Ga0466968_0004479 3300044735 Bacteria 5223
343 Ga0466970_0027999 3300044765 Bacteria 2959
344 Ga0466970_0087673 3300044765 Bacteria 1688
345 Ga0466970_0131168 3300044765 Bacteria 1376
346 Ga0466957_0000750 3300044842 Bacteria 16545
347 Ga0466957_0273669 3300044842 Bacteria 1128
348 Ga0466960_0003397 3300044901 Bacteria 6120
349 Ga0466960_0018297 3300044901 Bacteria 3067
350 Ga0466960_0028812 3300044901 Bacteria 2543
351 Ga0466959_0015088 3300045049 Bacteria 5628
352 Ga0466959_0044274 3300045049 Bacteria 3280
353 Ga0466958_0043286 3300045836 Bacteria 2711
354 Ga0466958_0068516 3300045836 Bacteria 2169
355 Ga0466967_0003036 3300045976 Bacteria 10771
356 Ga0466967_0020486 3300045976 Bacteria 5347
357 Ga0466967_0034308 3300045976 Bacteria 4305
358 Ga0466967_0040607 3300045976 Bacteria 4007
359 Ga0466967_0080505 3300045976 Bacteria 2939
360 Ga0495629_0144474 3300046459 Bacteria 1655
361 Ga0495638_0001007 3300046460 Bacteria 28225
362 Ga0495638_0037849 3300046460 Bacteria 3068
363 Ga0495641_0107737 3300046461 Bacteria 1243
364 Ga0495582_0144023 3300046473 Bacteria 1351
365 Ga0495606_0011235 3300046507 Bacteria 7328
366 Ga0495634_0088348 3300046642 Bacteria 2016
367 Ga0495625_0131967 3300046660 Bacteria 1691
368 Ga0495658_0044260 3300046683 Bacteria 2494
369 Ga0495672_0000976 3300047320 Bacteria 29616
370 Ga0495676_0159485 3300047321 Bacteria 1597
371 Ga0495673_0002357 3300047469 Bacteria 13410
372 Ga0495686_0000377 3300047472 Bacteria 71657
373 Ga0495686_0078781 3300047472 Bacteria 2016
374 Ga0495593_0003750 3300047673 Bacteria 9073
375 Ga0496100_0000082 3300048903 Bacteria 53775
376 Ga0496100_0029684 3300048903 Bacteria 3384
377 Ga0496100_0145829 3300048903 Bacteria 1683
378 Ga0496101_0000034 3300048904 Bacteria 178045
379 Ga0496101_0000056 3300048904 Bacteria 135446
380 Ga0496101_0020084 3300048904 Bacteria 4568
381 Ga0496101_0020501 3300048904 Bacteria 4528
382 Ga0496101_0028492 3300048904 Bacteria 3899
383 Ga0496101_0054529 3300048904 Bacteria 2886
384 Ga0496102_0000177 3300048905 Bacteria 86724
385 Ga0496102_0000480 3300048905 Bacteria 44338
386 Ga0496102_0005023 3300048905 Bacteria 11203
387 Ga0496102_0006853 3300048905 Bacteria 9723
388 Ga0496102_0059128 3300048905 Bacteria 3504
389 Ga0496102_0095165 3300048905 Bacteria 2760
390 Ga0496102_0215274 3300048905 Bacteria 1811
391 Ga0496103_0000003 3300048906 Bacteria 603967
392 Ga0496103_0001644 3300048906 Bacteria 14642
393 Ga0496103_0003624 3300048906 Bacteria 9413
394 Ga0496103_0028034 3300048906 Bacteria 3416
395 Ga0496104_0007296 3300048907 Bacteria 9754
396 Ga0496104_0024727 3300048907 Bacteria 5529
397 Ga0496104_0044416 3300048907 Bacteria 4175
398 Ga0496104_0482457 3300048907 Bacteria 1151
399 Ga0496105_0080963 3300048908 Bacteria 2682
400 Ga0496105_0131602 3300048908 Bacteria 2062
401 Ga0496106_0004124 3300048909 Bacteria 10828
402 Ga0496106_0053130 3300048909 Bacteria 3059
403 Ga0496106_0065850 3300048909 Bacteria 2758
404 Ga0496106_0073369 3300048909 Bacteria 2618
405 Ga0496106_0088098 3300048909 Bacteria 2392
406 Ga0496107_0000668 3300048910 Bacteria 19437
407 Ga0496107_0001486 3300048910 Bacteria 14519
408 Ga0496107_0023756 3300048910 Bacteria 4333
409 Ga0496107_0088060 3300048910 Bacteria 2266
410 Ga0496108_0000645 3300048911 Bacteria 27126
411 Ga0496108_0005048 3300048911 Bacteria 10662
412 Ga0496108_0015142 3300048911 Bacteria 6292
413 Ga0496108_0083668 3300048911 Bacteria 2707
414 Ga0496108_0522730 3300048911 Bacteria 1036
415 Ga0496109_0000368 3300048912 Bacteria 41931
416 Ga0496109_0014439 3300048912 Bacteria 6872
417 Ga0496109_0064474 3300048912 Bacteria 3353
418 Ga0496109_0081956 3300048912 Bacteria 2973
419 Ga0496109_0086930 3300048912 Bacteria 2887
420 Ga0496109_0116291 3300048912 Bacteria 2489
421 Ga0496110_0006536 3300048913 Bacteria 9252
422 Ga0496110_0016305 3300048913 Bacteria 6201
423 Ga0496110_0056655 3300048913 Bacteria 3449
424 Ga0496110_0414331 3300048913 Bacteria 1228
425 Ga0496111_0002684 3300048914 Bacteria 10809
426 Ga0496111_0059075 3300048914 Bacteria 2778
427 Ga0496112_0009781 3300048915 Bacteria 8660
428 Ga0496112_0013158 3300048915 Bacteria 7635
429 Ga0496112_0022763 3300048915 Bacteria 5978
430 Ga0496112_0285114 3300048915 Bacteria 1598
431 Ga0496113_0052831 3300048916 Bacteria 3036
432 Ga0496113_0126378 3300048916 Bacteria 2003
433 Ga0496114_0000081 3300048917 Bacteria 68644
434 Ga0496114_0006902 3300048917 Bacteria 8945
435 Ga0496114_0019021 3300048917 Bacteria 5564
436 Ga0496114_0047751 3300048917 Bacteria 3561
437 Ga0496115_0021213 3300048918 Bacteria 5016
438 Ga0496115_0146732 3300048918 Bacteria 1947
439 Ga0496115_0184130 3300048918 Bacteria 1726
440 Ga0496115_0375369 3300048918 Bacteria 1157
441 Ga0496116_0000013 3300048919 Bacteria 603993
442 Ga0496116_0011253 3300048919 Bacteria 7427
443 Ga0496116_0024486 3300048919 Bacteria 4463
444 Ga0496117_0000013 3300048920 Bacteria 603995
445 Ga0496117_0001513 3300048920 Bacteria 33283
446 Ga0496117_0016133 3300048920 Bacteria 6318
447 Ga0496117_0026553 3300048920 Bacteria 4530
448 Ga0496118_0000011 3300048921 Bacteria 603995
449 Ga0496118_0001679 3300048921 Bacteria 32406
450 Ga0496118_0028174 3300048921 Bacteria 4738
451 Ga0496118_0171803 3300048921 Bacteria 1323
452 Ga0496119_0001902 3300048922 Bacteria 23939
453 Ga0496119_0003917 3300048922 Bacteria 15117
454 Ga0496119_0005542 3300048922 Bacteria 12027
455 Ga0496120_0001381 3300048923 Bacteria 29595
456 Ga0496120_0008982 3300048923 Bacteria 7150
457 Ga0496120_0025130 3300048923 Bacteria 3701
458 Ga0496121_0000048 3300048924 Bacteria 330242
459 Ga0496121_0000060 3300048924 Bacteria 276682
460 Ga0496121_0009711 3300048924 Bacteria 11015
461 Ga0496121_0085393 3300048924 Bacteria 2485
462 Ga0496122_0000234 3300048925 Bacteria 125042
463 Ga0496122_0064292 3300048925 Bacteria 2670
464 Ga0496123_0009232 3300048926 Bacteria 8915
465 Ga0496123_0069543 3300048926 Bacteria 2209
466 Ga0496124_0000044 3300048927 Bacteria 289064
467 Ga0496124_0270561 3300048927 Bacteria 1244
468 Ga0496125_0000037 3300048928 Bacteria 330242
469 Ga0496125_0025425 3300048928 Bacteria 5421
470 Ga0496125_0074493 3300048928 Bacteria 2632
471 Ga0496126_0000046 3300048929 Bacteria 330242
472 Ga0496126_0003501 3300048929 Bacteria 19807
473 Ga0496126_0004075 3300048929 Bacteria 17728
474 Ga0496126_0166618 3300048929 Bacteria 1880
475 Ga0501032_0002329 3300049569 Bacteria 14895
476 Ga0501034_0003289 3300049571 Bacteria 18460
477 Ga0501034_0125057 3300049571 Bacteria 2557
478 Ga0501034_0272889 3300049571 Bacteria 1632
479 Ga0501037_0003337 3300049573 Bacteria 11661
480 Ga0501038_0002600 3300049574 Bacteria 16867
481 Ga0501039_0001344 3300049575 Bacteria 17994
482 Ga0501043_0000538 3300049579 Bacteria 34146
483 Ga0501047_0068277 3300049581 Bacteria 3424
484 Ga0501067_0050367 3300049583 Bacteria 2308
485 Ga0501069_0035611 3300049585 Bacteria 2743
486 Ga0501070_0000945 3300049586 Bacteria 26235
487 Ga0501073_0111302 3300049589 Bacteria 1899
488 Ga0501080_0194222 3300049742 Bacteria 1865
489 Ga0501044_0002856 3300049823 Bacteria 19659
490 Ga0501044_0149933 3300049823 Bacteria 2315
491 Ga0501044_0329759 3300049823 Bacteria 1449
492 nmdc:mga03683_131938_c1 3300050489 Bacteria 1118
493 nmdc:mga03n38_13493_c1 3300050490 Bacteria 3106
494 nmdc:mga03n38_286_c1 3300050490 Bacteria 12040
495 nmdc:mga03n38_36485_c1 3300050490 Bacteria 2114
496 nmdc:mga03n38_507_c1 3300050490 Bacteria 9812
497 nmdc:mga03n38_62611_c1 3300050490 Bacteria 1698
498 nmdc:mga03n38_83578_c1 3300050490 Bacteria 1506
499 nmdc:mga00v17_10362_c1 3300050491 Bacteria 5086
500 nmdc:mga00v17_232234_c1 3300050491 Bacteria 1195
501 nmdc:mga00v17_2324_c1 3300050491 Bacteria 9736
502 nmdc:mga00v17_23513_c1 3300050491 Bacteria 3564
503 nmdc:mga00v17_2426_c1 3300050491 Bacteria 9531
504 nmdc:mga00v17_31383_c1 3300050491 Bacteria 2438
505 nmdc:mga00v17_45385_c1 3300050491 Bacteria 2655
506 nmdc:mga00v17_46011_c1 3300050491 Bacteria 2639
507 nmdc:mga0yw44_111326_c1 3300050492 Bacteria 1754
508 nmdc:mga0yw44_19855_c1 3300050492 Bacteria 3715
509 nmdc:mga0yw44_28826_c1 3300050492 Bacteria 3198
510 nmdc:mga0yw44_678_c1 3300050492 Bacteria 12428
511 nmdc:mga07m45_102957_c1 3300050496 Bacteria 1640
512 nmdc:mga07m45_10782_c1 3300050496 Bacteria 4785
513 nmdc:mga07m45_118989_c1 3300050496 Bacteria 1525
514 nmdc:mga07m45_1646_c1 3300050496 Bacteria 10292
515 nmdc:mga07m45_29161_c1 3300050496 Bacteria 3049
516 nmdc:mga07m45_761_c3 3300050496 Bacteria 10454
517 nmdc:mga05p37_11484_c1 3300050507 Bacteria 10549
518 nmdc:mga0qj67_130319_c1 3300050509 Bacteria 2037
519 nmdc:mga0qj67_207777_c1 3300050509 Bacteria 1590
520 nmdc:mga0sz30_13356_c1 3300050516 Bacteria 3214
521 nmdc:mga0sz30_17079_c1 3300050516 Bacteria 2890
522 nmdc:mga0sz30_39676_c1 3300050516 Bacteria 1976
523 nmdc:mga0sz30_55550_c1 3300050516 Bacteria 1685
524 nmdc:mga0sz30_5930_c1 3300050516 Bacteria 4507
525 nmdc:mga0sz30_63502_c1 3300050516 Bacteria 1581
526 Ga0500610_0005942 3300053079 Bacteria 5063
527 Ga0500635_0001144 3300053080 Bacteria 6358
528 Ga0500643_000986 3300053087 Bacteria 17489
529 Ga0500643_011228 3300053087 Bacteria 3280
530 Ga0500652_000426 3300053131 Bacteria 15009
531 Ga0500652_004430 3300053131 Bacteria 4350
532 Ga0500658_0106076 3300053134 Bacteria 1232
533 Ga0500559_0037544 3300053136 Bacteria 2100
534 Ga0500568_0053452 3300053139 Bacteria 1583
535 Ga0500616_0005815 3300053153 Bacteria 8275
536 Ga0500645_000112 3300053730 Bacteria 64943
537 Ga0500645_016782 3300053730 Bacteria 2302
538 Ga0466962_0016385 3300061719 Bacteria 3574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0101121 Ga0466961_0101121_688_1635 275
2 3300044735 Ga0466968_0004479 Ga0466968_0004479_4093_5040 275
3 3300044842 Ga0466957_0273669 Ga0466957_0273669_146_1093 275
4 3300044684 Ga0466966_0039531 Ga0466966_0039531_1504_2436 280
5 iso_pu_bacteria 2643221715 2644636789 291
6 iso_pu_bacteria 2902799365 2902799448 291
7 iso_pu_bacteria 2643221687 2644490320 292
8 iso_pu_bacteria 2902837492 2902839871 292
9 iso_pu_bacteria 2643221687 2644489480 293
10 iso_pu_bacteria 2738541274 2738704444 293
11 iso_pu_bacteria 2738543028 2739331073 293
12 iso_pu_bacteria 2842134933 2842135984 293
13 3300006038 Ga0075365_10043457 Ga0075365_100434575 294
14 3300006186 Ga0075369_10021380 Ga0075369_100213802 294
15 3300031824 Ga0307413_10074011 Ga0307413_100740112 294
16 3300048920 Ga0496117_0026553 Ga0496117_0026553_724_1632 294
17 3300048921 Ga0496118_0028174 Ga0496118_0028174_124_1032 294
18 3300050516 nmdc:mga0sz30_39676_c1 nmdc:mga0sz30_39676_c1_283_1248 294
19 3300005841 Ga0068863_100002757 Ga0068863_1000027573 295
20 3300005844 Ga0068862_100002207 Ga0068862_10000220719 295
21 3300006051 Ga0075364_10038296 Ga0075364_100382963 295
22 3300021384 Ga0213876_10000655 Ga0213876_100006552 295
23 3300026035 Ga0207703_10153180 Ga0207703_101531801 295
24 3300026088 Ga0207641_10025907 Ga0207641_100259075 295
25 3300028379 Ga0268266_10167539 Ga0268266_101675392 295
26 3300028380 Ga0268265_10000147 Ga0268265_1000014772 295
27 3300037853 Ga0436364_1395195 Ga0436364_1395195_883_1821 295
28 3300039437 Ga0436365_0634291 Ga0436365_0634291_30110_31048 295
29 3300044658 Ga0466972_0019757 Ga0466972_0019757_1238_2125 295
30 3300044683 Ga0466965_0025806 Ga0466965_0025806_385_1272 295
31 3300044735 Ga0466968_0001495 Ga0466968_0001495_6179_7066 295
32 3300044765 Ga0466970_0027999 Ga0466970_0027999_1901_2788 295
33 3300044842 Ga0466957_0000750 Ga0466957_0000750_5448_6335 295
34 3300044901 Ga0466960_0028812 Ga0466960_0028812_1236_2123 295
35 3300045049 Ga0466959_0015088 Ga0466959_0015088_3194_4087 295
36 3300045976 Ga0466967_0080505 Ga0466967_0080505_567_1460 295
37 3300048903 Ga0496100_0145829 Ga0496100_0145829_335_1228 295
38 3300048904 Ga0496101_0020084 Ga0496101_0020084_1530_2435 295
39 3300048904 Ga0496101_0028492 Ga0496101_0028492_2251_3144 295
40 3300048909 Ga0496106_0073369 Ga0496106_0073369_1348_2241 295
41 3300048915 Ga0496112_0022763 Ga0496112_0022763_2198_3103 295
42 3300048916 Ga0496113_0052831 Ga0496113_0052831_1672_2577 295
43 3300048925 Ga0496122_0064292 Ga0496122_0064292_69_974 295
44 3300048926 Ga0496123_0069543 Ga0496123_0069543_567_1472 295
45 3300048928 Ga0496125_0074493 Ga0496125_0074493_1284_2189 295
46 3300048929 Ga0496126_0003501 Ga0496126_0003501_13722_14627 295
47 3300050491 nmdc:mga00v17_232234_c1 nmdc:mga00v17_232234_c1_261_1172 295
48 3300050491 nmdc:mga00v17_46011_c1 nmdc:mga00v17_46011_c1_1472_2422 295
49 3300003792 Ga0055540_1003856 Ga0055540_10038564 296
50 3300003792 Ga0055540_1004409 Ga0055540_10044093 296
51 3300003792 Ga0055540_1004593 Ga0055540_10045932 296
52 3300005337 Ga0070682_100017032 Ga0070682_1000170324 296
53 3300005539 Ga0068853_100025519 Ga0068853_1000255193 296
54 3300006048 Ga0075363_100017439 Ga0075363_1000174394 296
55 3300006186 Ga0075369_10016660 Ga0075369_100166602 296
56 3300009148 Ga0105243_10233581 Ga0105243_102335812 296
57 3300009551 Ga0105238_10097872 Ga0105238_100978724 296
58 3300021388 Ga0213875_10054070 Ga0213875_100540702 296
59 3300025273 Ga0209673_1016162 Ga0209673_10161622 296
60 3300025303 Ga0209051_1000421 Ga0209051_10004214 296
61 3300025303 Ga0209051_1014493 Ga0209051_10144933 296
62 3300025303 Ga0209051_1027818 Ga0209051_10278182 296
63 3300025924 Ga0207694_10042377 Ga0207694_100423773 296
64 3300025944 Ga0207661_10264190 Ga0207661_102641902 296
65 3300025981 Ga0207640_10197525 Ga0207640_101975252 296
66 3300026041 Ga0207639_10123996 Ga0207639_101239963 296
67 3300026067 Ga0207678_10012370 Ga0207678_100123706 296
68 3300035725 Ga0373947_0081869 Ga0373947_0081869_177_1067 296
69 3300037853 Ga0436364_1254277 Ga0436364_1254277_323_1213 296
70 3300041443 Ga0451789_0462202 Ga0451789_0462202_77_967 296
71 3300041452 Ga0451793_1540142 Ga0451793_1540142_530_1420 296
72 3300045976 Ga0466967_0020486 Ga0466967_0020486_54_944 296
73 3300046459 Ga0495629_0144474 Ga0495629_0144474_236_1126 296
74 3300046461 Ga0495641_0107737 Ga0495641_0107737_305_1195 296
75 3300046473 Ga0495582_0144023 Ga0495582_0144023_75_965 296
76 3300046642 Ga0495634_0088348 Ga0495634_0088348_947_1837 296
77 3300046683 Ga0495658_0044260 Ga0495658_0044260_1480_2370 296
78 3300047321 Ga0495676_0159485 Ga0495676_0159485_527_1417 296
79 3300047472 Ga0495686_0000377 Ga0495686_0000377_68843_69733 296
80 3300047673 Ga0495593_0003750 Ga0495593_0003750_1626_2516 296
81 3300048905 Ga0496102_0215274 Ga0496102_0215274_279_1169 296
82 3300048911 Ga0496108_0015142 Ga0496108_0015142_1291_2181 296
83 3300048911 Ga0496108_0522730 Ga0496108_0522730_81_971 296
84 3300048912 Ga0496109_0014439 Ga0496109_0014439_4100_4990 296
85 3300048912 Ga0496109_0116291 Ga0496109_0116291_1046_1936 296
86 3300048913 Ga0496110_0006536 Ga0496110_0006536_4002_4892 296
87 3300048915 Ga0496112_0009781 Ga0496112_0009781_3888_4778 296
88 3300048929 Ga0496126_0166618 Ga0496126_0166618_137_1027 296
89 3300049571 Ga0501034_0272889 Ga0501034_0272889_533_1441 296
90 3300049742 Ga0501080_0194222 Ga0501080_0194222_630_1538 296
91 3300049823 Ga0501044_0002856 Ga0501044_0002856_7338_8243 296
92 3300049823 Ga0501044_0329759 Ga0501044_0329759_333_1223 296
93 3300050490 nmdc:mga03n38_13493_c1 nmdc:mga03n38_13493_c1_901_1791 296
94 3300050496 nmdc:mga07m45_102957_c1 nmdc:mga07m45_102957_c1_572_1462 296
95 3300050516 nmdc:mga0sz30_17079_c1 nmdc:mga0sz30_17079_c1_1557_2447 296
96 3300053730 Ga0500645_000112 Ga0500645_000112_34576_35466 296
97 3300002073 JGI24745J21846_1003206 JGI24745J21846_10032062 297
98 3300002075 JGI24738J21930_10005296 JGI24738J21930_100052962 297
99 3300002076 JGI24749J21850_1007037 JGI24749J21850_10070372 297
100 3300002077 JGI24744J21845_10000685 JGI24744J21845_100006853 297
101 3300002239 JGI24034J26672_10001882 JGI24034J26672_100018822 297
102 3300002244 JGI24742J22300_10002031 JGI24742J22300_100020314 297
103 3300002244 JGI24742J22300_10003629 JGI24742J22300_100036293 297
104 3300002459 JGI24751J29686_10005699 JGI24751J29686_100056991 297
105 3300003792 Ga0055540_1000038 Ga0055540_100003847 297
106 3300005328 Ga0070676_10049573 Ga0070676_100495733 297
107 3300005330 Ga0070690_100021936 Ga0070690_1000219362 297
108 3300005331 Ga0070670_100076851 Ga0070670_1000768512 297
109 3300005334 Ga0068869_100024844 Ga0068869_1000248444 297
110 3300005335 Ga0070666_10067141 Ga0070666_100671412 297
111 3300005335 Ga0070666_10072923 Ga0070666_100729232 297
112 3300005338 Ga0068868_100007434 Ga0068868_1000074344 297
113 3300005340 Ga0070689_100043556 Ga0070689_1000435564 297
114 3300005340 Ga0070689_100358513 Ga0070689_1003585131 297
115 3300005341 Ga0070691_10010715 Ga0070691_100107152 297
116 3300005347 Ga0070668_100001595 Ga0070668_1000015954 297
117 3300005347 Ga0070668_100002321 Ga0070668_10000232113 297
118 3300005353 Ga0070669_100002101 Ga0070669_10000210110 297
119 3300005355 Ga0070671_100000697 Ga0070671_1000006975 297
120 3300005356 Ga0070674_100006289 Ga0070674_1000062894 297
121 3300005356 Ga0070674_100040873 Ga0070674_1000408734 297
122 3300005365 Ga0070688_100004228 Ga0070688_1000042283 297
123 3300005366 Ga0070659_100044272 Ga0070659_1000442724 297
124 3300005366 Ga0070659_100235580 Ga0070659_1002355802 297
125 3300005367 Ga0070667_100000139 Ga0070667_10000013994 297
126 3300005367 Ga0070667_100003263 Ga0070667_1000032636 297
127 3300005367 Ga0070667_100074582 Ga0070667_1000745822 297
128 3300005367 Ga0070667_100147021 Ga0070667_1001470213 297
129 3300005434 Ga0070709_10005248 Ga0070709_1000524810 297
130 3300005435 Ga0070714_100391600 Ga0070714_1003916001 297
131 3300005436 Ga0070713_100628179 Ga0070713_1006281791 297
132 3300005437 Ga0070710_10005512 Ga0070710_100055123 297
133 3300005437 Ga0070710_10130268 Ga0070710_101302681 297
134 3300005438 Ga0070701_10014062 Ga0070701_100140623 297
135 3300005439 Ga0070711_100000871 Ga0070711_1000008713 297
136 3300005439 Ga0070711_100007678 Ga0070711_1000076783 297
137 3300005441 Ga0070700_100016761 Ga0070700_1000167612 297
138 3300005444 Ga0070694_100029835 Ga0070694_1000298352 297
139 3300005444 Ga0070694_100259866 Ga0070694_1002598661 297
140 3300005455 Ga0070663_100007745 Ga0070663_1000077453 297
141 3300005456 Ga0070678_100285982 Ga0070678_1002859822 297
142 3300005457 Ga0070662_100037127 Ga0070662_1000371274 297
143 3300005459 Ga0068867_100009327 Ga0068867_1000093273 297
144 3300005459 Ga0068867_100192646 Ga0068867_1001926462 297
145 3300005466 Ga0070685_10006150 Ga0070685_100061504 297
146 3300005466 Ga0070685_10093956 Ga0070685_100939562 297
147 3300005466 Ga0070685_10108213 Ga0070685_101082131 297
148 3300005535 Ga0070684_100371159 Ga0070684_1003711592 297
149 3300005539 Ga0068853_100002406 Ga0068853_10000240613 297
150 3300005545 Ga0070695_100037965 Ga0070695_1000379654 297
151 3300005546 Ga0070696_100127153 Ga0070696_1001271531 297
152 3300005547 Ga0070693_100070969 Ga0070693_1000709692 297
153 3300005548 Ga0070665_100003237 Ga0070665_10000323711 297
154 3300005548 Ga0070665_100056805 Ga0070665_1000568052 297
155 3300005548 Ga0070665_100119384 Ga0070665_1001193842 297
156 3300005549 Ga0070704_100013310 Ga0070704_1000133102 297
157 3300005563 Ga0068855_100117852 Ga0068855_1001178523 297
158 3300005578 Ga0068854_100008040 Ga0068854_1000080403 297
159 3300005578 Ga0068854_100010870 Ga0068854_1000108702 297
160 3300005615 Ga0070702_100013513 Ga0070702_1000135132 297
161 3300005616 Ga0068852_100154003 Ga0068852_1001540032 297
162 3300005617 Ga0068859_100001411 Ga0068859_10000141121 297
163 3300005617 Ga0068859_100018889 Ga0068859_1000188893 297
164 3300005718 Ga0068866_10000748 Ga0068866_1000074814 297
165 3300005718 Ga0068866_10034040 Ga0068866_100340402 297
166 3300005719 Ga0068861_100001350 Ga0068861_10000135015 297
167 3300005719 Ga0068861_100036165 Ga0068861_1000361654 297
168 3300005841 Ga0068863_100002122 Ga0068863_1000021224 297
169 3300005841 Ga0068863_100016988 Ga0068863_1000169881 297
170 3300005842 Ga0068858_100002402 Ga0068858_10000240215 297
171 3300005842 Ga0068858_100080184 Ga0068858_1000801842 297
172 3300005843 Ga0068860_100000025 Ga0068860_10000002522 297
173 3300005843 Ga0068860_100010382 Ga0068860_1000103824 297
174 3300005844 Ga0068862_100000045 Ga0068862_10000004522 297
175 3300005844 Ga0068862_100003468 Ga0068862_1000034683 297
176 3300005937 Ga0081455_10201060 Ga0081455_102010602 297
177 3300006038 Ga0075365_10004758 Ga0075365_100047583 297
178 3300006038 Ga0075365_10016933 Ga0075365_100169333 297
179 3300006038 Ga0075365_10022256 Ga0075365_100222562 297
180 3300006042 Ga0075368_10057667 Ga0075368_100576672 297
181 3300006048 Ga0075363_100000267 Ga0075363_10000026710 297
182 3300006048 Ga0075363_100001639 Ga0075363_1000016393 297
183 3300006048 Ga0075363_100013378 Ga0075363_1000133783 297
184 3300006048 Ga0075363_100033732 Ga0075363_1000337322 297
185 3300006048 Ga0075363_100047607 Ga0075363_1000476072 297
186 3300006048 Ga0075363_100141564 Ga0075363_1001415642 297
187 3300006051 Ga0075364_10006428 Ga0075364_100064286 297
188 3300006051 Ga0075364_10017292 Ga0075364_100172926 297
189 3300006051 Ga0075364_10066661 Ga0075364_100666612 297
190 3300006051 Ga0075364_10070267 Ga0075364_100702672 297
191 3300006163 Ga0070715_10000504 Ga0070715_100005043 297
192 3300006163 Ga0070715_10081796 Ga0070715_100817962 297
193 3300006173 Ga0070716_100033607 Ga0070716_1000336071 297
194 3300006173 Ga0070716_100048679 Ga0070716_1000486793 297
195 3300006175 Ga0070712_100014966 Ga0070712_1000149662 297
196 3300006175 Ga0070712_100128546 Ga0070712_1001285463 297
197 3300006177 Ga0075362_10014243 Ga0075362_100142432 297
198 3300006177 Ga0075362_10070783 Ga0075362_100707832 297
199 3300006178 Ga0075367_10015426 Ga0075367_100154262 297
200 3300006186 Ga0075369_10006348 Ga0075369_100063485 297
201 3300006186 Ga0075369_10034247 Ga0075369_100342471 297
202 3300006186 Ga0075369_10116711 Ga0075369_101167112 297
203 3300006237 Ga0097621_100240404 Ga0097621_1002404041 297
204 3300006353 Ga0075370_10000603 Ga0075370_100006036 297
205 3300006353 Ga0075370_10003322 Ga0075370_100033225 297
206 3300006353 Ga0075370_10121526 Ga0075370_101215262 297
207 3300006358 Ga0068871_100221417 Ga0068871_1002214172 297
208 3300006358 Ga0068871_100323295 Ga0068871_1003232952 297
209 3300006844 Ga0075428_100404744 Ga0075428_1004047442 297
210 3300006846 Ga0075430_100052704 Ga0075430_1000527045 297
211 3300006846 Ga0075430_100237313 Ga0075430_1002373132 297
212 3300006847 Ga0075431_100060256 Ga0075431_1000602562 297
213 3300006881 Ga0068865_100005062 Ga0068865_1000050623 297
214 3300006881 Ga0068865_100162458 Ga0068865_1001624582 297
215 3300006931 Ga0097620_100001411 Ga0097620_10000141121 297
216 3300006931 Ga0097620_100018887 Ga0097620_1000188873 297
217 3300009092 Ga0105250_10069455 Ga0105250_100694551 297
218 3300009093 Ga0105240_10340484 Ga0105240_103404843 297
219 3300009098 Ga0105245_10010623 Ga0105245_100106234 297
220 3300009101 Ga0105247_10000010 Ga0105247_10000010307 297
221 3300009101 Ga0105247_10001034 Ga0105247_100010343 297
222 3300009101 Ga0105247_10081533 Ga0105247_100815332 297
223 3300009147 Ga0114129_10017451 Ga0114129_100174512 297
224 3300009148 Ga0105243_10080607 Ga0105243_100806073 297
225 3300009176 Ga0105242_10007030 Ga0105242_100070304 297
226 3300009177 Ga0105248_10000100 Ga0105248_1000010075 297
227 3300009177 Ga0105248_10010526 Ga0105248_100105263 297
228 3300009177 Ga0105248_10228312 Ga0105248_102283122 297
229 3300009177 Ga0105248_10445367 Ga0105248_104453672 297
230 3300009545 Ga0105237_10011565 Ga0105237_100115656 297
231 3300009545 Ga0105237_10012451 Ga0105237_1001245110 297
232 3300009545 Ga0105237_10032181 Ga0105237_100321813 297
233 3300009551 Ga0105238_10688334 Ga0105238_106883341 297
234 3300009553 Ga0105249_10000010 Ga0105249_10000010302 297
235 3300009553 Ga0105249_10002925 Ga0105249_1000292515 297
236 3300010375 Ga0105239_10009913 Ga0105239_100099135 297
237 3300010375 Ga0105239_10014716 Ga0105239_100147167 297
238 3300010375 Ga0105239_10034420 Ga0105239_100344202 297
239 3300013296 Ga0157374_10274894 Ga0157374_102748942 297
240 3300013297 Ga0157378_10006641 Ga0157378_100066418 297
241 3300013306 Ga0163162_10003092 Ga0163162_1000309215 297
242 3300013306 Ga0163162_10101835 Ga0163162_101018353 297
243 3300013306 Ga0163162_10107796 Ga0163162_101077962 297
244 3300013306 Ga0163162_10310569 Ga0163162_103105691 297
245 3300013306 Ga0163162_10366837 Ga0163162_103668372 297
246 3300013307 Ga0157372_10006186 Ga0157372_100061869 297
247 3300013307 Ga0157372_10617369 Ga0157372_106173691 297
248 3300013308 Ga0157375_10011102 Ga0157375_100111023 297
249 3300013308 Ga0157375_10315651 Ga0157375_103156511 297
250 3300014325 Ga0163163_10017211 Ga0163163_100172113 297
251 3300014325 Ga0163163_10180899 Ga0163163_101808992 297
252 3300014326 Ga0157380_10010025 Ga0157380_100100253 297
253 3300014968 Ga0157379_10093701 Ga0157379_100937012 297
254 3300014968 Ga0157379_10127586 Ga0157379_101275862 297
255 3300014968 Ga0157379_10279083 Ga0157379_102790831 297
256 3300017792 Ga0163161_10060626 Ga0163161_100606262 297
257 3300021384 Ga0213876_10076871 Ga0213876_100768711 297
258 3300021388 Ga0213875_10001791 Ga0213875_1000179114 297
259 3300021388 Ga0213875_10046302 Ga0213875_100463022 297
260 3300025303 Ga0209051_1000014 Ga0209051_1000014296 297
261 3300025898 Ga0207692_10006942 Ga0207692_100069422 297
262 3300025898 Ga0207692_10159538 Ga0207692_101595381 297
263 3300025899 Ga0207642_10003427 Ga0207642_100034273 297
264 3300025900 Ga0207710_10000028 Ga0207710_10000028309 297
265 3300025900 Ga0207710_10032231 Ga0207710_100322313 297
266 3300025901 Ga0207688_10009880 Ga0207688_100098803 297
267 3300025903 Ga0207680_10005811 Ga0207680_100058113 297
268 3300025904 Ga0207647_10047851 Ga0207647_100478512 297
269 3300025905 Ga0207685_10001479 Ga0207685_100014792 297
270 3300025906 Ga0207699_10060374 Ga0207699_100603743 297
271 3300025908 Ga0207643_10099106 Ga0207643_100991062 297
272 3300025914 Ga0207671_10017021 Ga0207671_100170213 297
273 3300025914 Ga0207671_10021095 Ga0207671_100210954 297
274 3300025914 Ga0207671_10078009 Ga0207671_100780092 297
275 3300025915 Ga0207693_10002371 Ga0207693_1000237119 297
276 3300025915 Ga0207693_10002564 Ga0207693_1000256416 297
277 3300025916 Ga0207663_10011426 Ga0207663_100114262 297
278 3300025916 Ga0207663_10245034 Ga0207663_102450341 297
279 3300025917 Ga0207660_10235431 Ga0207660_102354312 297
280 3300025924 Ga0207694_10165678 Ga0207694_101656782 297
281 3300025925 Ga0207650_10078691 Ga0207650_100786912 297
282 3300025926 Ga0207659_10148867 Ga0207659_101488672 297
283 3300025927 Ga0207687_10006621 Ga0207687_100066213 297
284 3300025931 Ga0207644_10010964 Ga0207644_100109644 297
285 3300025933 Ga0207706_10132111 Ga0207706_101321112 297
286 3300025934 Ga0207686_10010464 Ga0207686_100104643 297
287 3300025935 Ga0207709_10011103 Ga0207709_100111032 297
288 3300025936 Ga0207670_10044458 Ga0207670_100444583 297
289 3300025937 Ga0207669_10000814 Ga0207669_1000081412 297
290 3300025937 Ga0207669_10030727 Ga0207669_100307274 297
291 3300025939 Ga0207665_10048441 Ga0207665_100484411 297
292 3300025941 Ga0207711_10001077 Ga0207711_1000107720 297
293 3300025941 Ga0207711_10043424 Ga0207711_100434242 297
294 3300025941 Ga0207711_10093960 Ga0207711_100939602 297
295 3300025942 Ga0207689_10111490 Ga0207689_101114901 297
296 3300025961 Ga0207712_10000016 Ga0207712_10000016303 297
297 3300025961 Ga0207712_10014364 Ga0207712_100143642 297
298 3300025961 Ga0207712_10096635 Ga0207712_100966352 297
299 3300025972 Ga0207668_10000567 Ga0207668_1000056720 297
300 3300025972 Ga0207668_10045360 Ga0207668_100453602 297
301 3300025981 Ga0207640_10009069 Ga0207640_100090692 297
302 3300025986 Ga0207658_10000675 Ga0207658_100006752 297
303 3300025986 Ga0207658_10002758 Ga0207658_100027585 297
304 3300025986 Ga0207658_10094353 Ga0207658_100943533 297
305 3300025986 Ga0207658_10350517 Ga0207658_103505172 297
306 3300026023 Ga0207677_10016824 Ga0207677_100168242 297
307 3300026035 Ga0207703_10078423 Ga0207703_100784232 297
308 3300026041 Ga0207639_10314105 Ga0207639_103141052 297
309 3300026067 Ga0207678_10074159 Ga0207678_100741592 297
310 3300026075 Ga0207708_10003698 Ga0207708_100036988 297
311 3300026088 Ga0207641_10006568 Ga0207641_100065686 297
312 3300026088 Ga0207641_10026500 Ga0207641_100265004 297
313 3300026089 Ga0207648_10003795 Ga0207648_100037953 297
314 3300026089 Ga0207648_10007973 Ga0207648_100079731 297
315 3300026118 Ga0207675_100003299 Ga0207675_10000329916 297
316 3300026118 Ga0207675_100042594 Ga0207675_1000425942 297
317 3300026121 Ga0207683_10002471 Ga0207683_100024713 297
318 3300026121 Ga0207683_10346971 Ga0207683_103469711 297
319 3300026142 Ga0207698_10063187 Ga0207698_100631873 297
320 3300027866 Ga0209813_10017644 Ga0209813_100176442 297
321 3300028379 Ga0268266_10012581 Ga0268266_100125813 297
322 3300028379 Ga0268266_10104227 Ga0268266_101042273 297
323 3300028380 Ga0268265_10000056 Ga0268265_1000005620 297
324 3300028380 Ga0268265_10015117 Ga0268265_100151172 297
325 3300028380 Ga0268265_10101276 Ga0268265_101012763 297
326 3300028381 Ga0268264_10000053 Ga0268264_1000005350 297
327 3300028381 Ga0268264_10060159 Ga0268264_100601593 297
328 3300031251 Ga0265327_10000230 Ga0265327_1000023065 297
329 3300031852 Ga0307410_10047635 Ga0307410_100476352 297
330 3300032002 Ga0307416_100183381 Ga0307416_1001833812 297
331 3300032126 Ga0307415_100043256 Ga0307415_1000432562 297
332 3300035691 Ga0373931_0050427 Ga0373931_0050427_602_1495 297
333 3300035691 Ga0373931_0192174 Ga0373931_0192174_226_1134 297
334 3300036647 Ga0316582_0138667 Ga0316582_0138667_211_1113 297
335 3300036712 Ga0316584_0096967 Ga0316584_0096967_1171_2073 297
336 3300037853 Ga0436364_0488279 Ga0436364_0488279_57425_58318 297
337 3300037853 Ga0436364_0797903 Ga0436364_0797903_11082_11975 297
338 3300039437 Ga0436365_0900994 Ga0436365_0900994_1451_2350 297
339 3300039437 Ga0436365_1472485 Ga0436365_1472485_4735_5631 297
340 3300041411 Ga0439466_0001544 Ga0439466_0001544_4164_5072 297
341 3300041411 Ga0439466_0048412 Ga0439466_0048412_274_1248 297
342 3300041413 Ga0439465_0009904 Ga0439465_0009904_302_1210 297
343 3300041413 Ga0439465_0024795 Ga0439465_0024795_827_1801 297
344 3300041997 Ga0439431_0022463 Ga0439431_0022463_463_1437 297
345 3300042005 Ga0439448_0016321 Ga0439448_0016321_397_1290 297
346 3300044658 Ga0466972_0007423 Ga0466972_0007423_3862_4770 297
347 3300044658 Ga0466972_0062128 Ga0466972_0062128_365_1258 297
348 3300044683 Ga0466965_0001962 Ga0466965_0001962_269_1162 297
349 3300044683 Ga0466965_0019697 Ga0466965_0019697_2076_2969 297
350 3300044683 Ga0466965_0048220 Ga0466965_0048220_227_1135 297
351 3300044684 Ga0466966_0048013 Ga0466966_0048013_53_1024 297
352 3300044684 Ga0466966_0071389 Ga0466966_0071389_67_960 297
353 3300044693 Ga0466961_0132578 Ga0466961_0132578_75_968 297
354 3300044694 Ga0466963_0002687 Ga0466963_0002687_6312_7265 297
355 3300044706 Ga0466964_0054176 Ga0466964_0054176_568_1476 297
356 3300044719 Ga0466971_0025554 Ga0466971_0025554_19_912 297
357 3300044735 Ga0466968_0001675 Ga0466968_0001675_5199_6092 297
358 3300044765 Ga0466970_0087673 Ga0466970_0087673_596_1573 297
359 3300044765 Ga0466970_0131168 Ga0466970_0131168_41_934 297
360 3300044901 Ga0466960_0003397 Ga0466960_0003397_1588_2481 297
361 3300044901 Ga0466960_0018297 Ga0466960_0018297_1021_1974 297
362 3300045049 Ga0466959_0044274 Ga0466959_0044274_1657_2634 297
363 3300045836 Ga0466958_0043286 Ga0466958_0043286_1528_2421 297
364 3300045836 Ga0466958_0068516 Ga0466958_0068516_521_1432 297
365 3300045976 Ga0466967_0003036 Ga0466967_0003036_8720_9631 297
366 3300045976 Ga0466967_0034308 Ga0466967_0034308_992_1903 297
367 3300045976 Ga0466967_0040607 Ga0466967_0040607_2724_3617 297
368 3300046460 Ga0495638_0001007 Ga0495638_0001007_21868_22761 297
369 3300046460 Ga0495638_0037849 Ga0495638_0037849_159_1058 297
370 3300046507 Ga0495606_0011235 Ga0495606_0011235_2770_3690 297
371 3300046660 Ga0495625_0131967 Ga0495625_0131967_756_1649 297
372 3300047320 Ga0495672_0000976 Ga0495672_0000976_10809_11717 297
373 3300047469 Ga0495673_0002357 Ga0495673_0002357_1109_2017 297
374 3300047472 Ga0495686_0078781 Ga0495686_0078781_1027_1920 297
375 3300048903 Ga0496100_0000082 Ga0496100_0000082_50837_51730 297
376 3300048903 Ga0496100_0029684 Ga0496100_0029684_1799_2692 297
377 3300048904 Ga0496101_0000034 Ga0496101_0000034_41929_42822 297
378 3300048904 Ga0496101_0000056 Ga0496101_0000056_20637_21530 297
379 3300048904 Ga0496101_0020501 Ga0496101_0020501_716_1612 297
380 3300048904 Ga0496101_0054529 Ga0496101_0054529_1104_2066 297
381 3300048905 Ga0496102_0000177 Ga0496102_0000177_20863_21756 297
382 3300048905 Ga0496102_0000480 Ga0496102_0000480_35133_36029 297
383 3300048905 Ga0496102_0005023 Ga0496102_0005023_6309_7202 297
384 3300048905 Ga0496102_0006853 Ga0496102_0006853_6766_7659 297
385 3300048905 Ga0496102_0059128 Ga0496102_0059128_500_1408 297
386 3300048905 Ga0496102_0095165 Ga0496102_0095165_1278_2171 297
387 3300048906 Ga0496103_0000003 Ga0496103_0000003_64969_65862 297
388 3300048906 Ga0496103_0001644 Ga0496103_0001644_2186_3082 297
389 3300048906 Ga0496103_0003624 Ga0496103_0003624_4888_5781 297
390 3300048906 Ga0496103_0028034 Ga0496103_0028034_2166_3059 297
391 3300048907 Ga0496104_0007296 Ga0496104_0007296_3591_4484 297
392 3300048907 Ga0496104_0044416 Ga0496104_0044416_1388_2350 297
393 3300048907 Ga0496104_0482457 Ga0496104_0482457_182_1081 297
394 3300048908 Ga0496105_0080963 Ga0496105_0080963_343_1251 297
395 3300048908 Ga0496105_0131602 Ga0496105_0131602_145_1107 297
396 3300048909 Ga0496106_0004124 Ga0496106_0004124_4748_5641 297
397 3300048909 Ga0496106_0053130 Ga0496106_0053130_327_1220 297
398 3300048909 Ga0496106_0065850 Ga0496106_0065850_818_1711 297
399 3300048909 Ga0496106_0088098 Ga0496106_0088098_494_1456 297
400 3300048910 Ga0496107_0000668 Ga0496107_0000668_13679_14572 297
401 3300048910 Ga0496107_0001486 Ga0496107_0001486_1630_2523 297
402 3300048910 Ga0496107_0023756 Ga0496107_0023756_1785_2678 297
403 3300048910 Ga0496107_0088060 Ga0496107_0088060_130_1038 297
404 3300048911 Ga0496108_0005048 Ga0496108_0005048_7719_8612 297
405 3300048911 Ga0496108_0083668 Ga0496108_0083668_122_1030 297
406 3300048912 Ga0496109_0000368 Ga0496109_0000368_9409_10302 297
407 3300048912 Ga0496109_0064474 Ga0496109_0064474_2329_3222 297
408 3300048912 Ga0496109_0081956 Ga0496109_0081956_50_958 297
409 3300048913 Ga0496110_0016305 Ga0496110_0016305_329_1222 297
410 3300048913 Ga0496110_0056655 Ga0496110_0056655_263_1156 297
411 3300048913 Ga0496110_0414331 Ga0496110_0414331_36_944 297
412 3300048914 Ga0496111_0002684 Ga0496111_0002684_1050_1943 297
413 3300048914 Ga0496111_0059075 Ga0496111_0059075_1351_2244 297
414 3300048915 Ga0496112_0013158 Ga0496112_0013158_5507_6400 297
415 3300048915 Ga0496112_0285114 Ga0496112_0285114_349_1257 297
416 3300048916 Ga0496113_0126378 Ga0496113_0126378_13_906 297
417 3300048917 Ga0496114_0000081 Ga0496114_0000081_30089_30982 297
418 3300048917 Ga0496114_0006902 Ga0496114_0006902_1325_2287 297
419 3300048917 Ga0496114_0019021 Ga0496114_0019021_4047_4940 297
420 3300048917 Ga0496114_0047751 Ga0496114_0047751_436_1332 297
421 3300048918 Ga0496115_0021213 Ga0496115_0021213_855_1817 297
422 3300048918 Ga0496115_0146732 Ga0496115_0146732_103_996 297
423 3300048918 Ga0496115_0184130 Ga0496115_0184130_678_1586 297
424 3300048918 Ga0496115_0375369 Ga0496115_0375369_167_1102 297
425 3300048919 Ga0496116_0000013 Ga0496116_0000013_538132_539025 297
426 3300048919 Ga0496116_0011253 Ga0496116_0011253_2078_2971 297
427 3300048919 Ga0496116_0024486 Ga0496116_0024486_3224_4120 297
428 3300048920 Ga0496117_0000013 Ga0496117_0000013_64969_65862 297
429 3300048920 Ga0496117_0001513 Ga0496117_0001513_5160_6056 297
430 3300048920 Ga0496117_0016133 Ga0496117_0016133_516_1409 297
431 3300048921 Ga0496118_0000011 Ga0496118_0000011_538134_539027 297
432 3300048921 Ga0496118_0001679 Ga0496118_0001679_26198_27094 297
433 3300048921 Ga0496118_0171803 Ga0496118_0171803_149_1057 297
434 3300048922 Ga0496119_0001902 Ga0496119_0001902_20935_21828 297
435 3300048922 Ga0496119_0003917 Ga0496119_0003917_10660_11556 297
436 3300048922 Ga0496119_0005542 Ga0496119_0005542_9982_10875 297
437 3300048923 Ga0496120_0001381 Ga0496120_0001381_7538_8431 297
438 3300048923 Ga0496120_0008982 Ga0496120_0008982_2218_3111 297
439 3300048923 Ga0496120_0025130 Ga0496120_0025130_840_1736 297
440 3300048924 Ga0496121_0000048 Ga0496121_0000048_225403_226296 297
441 3300048924 Ga0496121_0000060 Ga0496121_0000060_161739_162632 297
442 3300048924 Ga0496121_0009711 Ga0496121_0009711_8551_9447 297
443 3300048924 Ga0496121_0085393 Ga0496121_0085393_142_1050 297
444 3300048925 Ga0496122_0000234 Ga0496122_0000234_82215_83108 297
445 3300048926 Ga0496123_0009232 Ga0496123_0009232_6902_7795 297
446 3300048927 Ga0496124_0000044 Ga0496124_0000044_103947_104840 297
447 3300048927 Ga0496124_0270561 Ga0496124_0270561_147_1043 297
448 3300048928 Ga0496125_0000037 Ga0496125_0000037_225403_226296 297
449 3300048928 Ga0496125_0025425 Ga0496125_0025425_2456_3352 297
450 3300048929 Ga0496126_0000046 Ga0496126_0000046_225403_226296 297
451 3300048929 Ga0496126_0004075 Ga0496126_0004075_6590_7483 297
452 3300049569 Ga0501032_0002329 Ga0501032_0002329_9081_9989 297
453 3300049571 Ga0501034_0003289 Ga0501034_0003289_11604_12512 297
454 3300049571 Ga0501034_0125057 Ga0501034_0125057_993_1901 297
455 3300049573 Ga0501037_0003337 Ga0501037_0003337_20_928 297
456 3300049574 Ga0501038_0002600 Ga0501038_0002600_9697_10605 297
457 3300049575 Ga0501039_0001344 Ga0501039_0001344_7990_8898 297
458 3300049579 Ga0501043_0000538 Ga0501043_0000538_14702_15610 297
459 3300049581 Ga0501047_0068277 Ga0501047_0068277_2185_3165 297
460 3300049583 Ga0501067_0050367 Ga0501067_0050367_200_1108 297
461 3300049585 Ga0501069_0035611 Ga0501069_0035611_1778_2686 297
462 3300049586 Ga0501070_0000945 Ga0501070_0000945_21320_22228 297
463 3300049589 Ga0501073_0111302 Ga0501073_0111302_789_1697 297
464 3300049823 Ga0501044_0149933 Ga0501044_0149933_143_1051 297
465 3300050489 nmdc:mga03683_131938_c1 nmdc:mga03683_131938_c1_61_954 297
466 3300050490 nmdc:mga03n38_286_c1 nmdc:mga03n38_286_c1_7422_8315 297
467 3300050490 nmdc:mga03n38_36485_c1 nmdc:mga03n38_36485_c1_630_1523 297
468 3300050490 nmdc:mga03n38_507_c1 nmdc:mga03n38_507_c1_7392_8285 297
469 3300050490 nmdc:mga03n38_62611_c1 nmdc:mga03n38_62611_c1_483_1376 297
470 3300050490 nmdc:mga03n38_83578_c1 nmdc:mga03n38_83578_c1_464_1360 297
471 3300050491 nmdc:mga00v17_10362_c1 nmdc:mga00v17_10362_c1_2227_3120 297
472 3300050491 nmdc:mga00v17_2324_c1 nmdc:mga00v17_2324_c1_7462_8358 297
473 3300050491 nmdc:mga00v17_23513_c1 nmdc:mga00v17_23513_c1_2044_2937 297
474 3300050491 nmdc:mga00v17_2426_c1 nmdc:mga00v17_2426_c1_6110_7003 297
475 3300050491 nmdc:mga00v17_31383_c1 nmdc:mga00v17_31383_c1_46_939 297
476 3300050491 nmdc:mga00v17_45385_c1 nmdc:mga00v17_45385_c1_441_1334 297
477 3300050492 nmdc:mga0yw44_111326_c1 nmdc:mga0yw44_111326_c1_179_1087 297
478 3300050492 nmdc:mga0yw44_19855_c1 nmdc:mga0yw44_19855_c1_1910_2803 297
479 3300050492 nmdc:mga0yw44_28826_c1 nmdc:mga0yw44_28826_c1_2034_2927 297
480 3300050492 nmdc:mga0yw44_678_c1 nmdc:mga0yw44_678_c1_1087_1980 297
481 3300050496 nmdc:mga07m45_10782_c1 nmdc:mga07m45_10782_c1_703_1596 297
482 3300050496 nmdc:mga07m45_118989_c1 nmdc:mga07m45_118989_c1_135_1043 297
483 3300050496 nmdc:mga07m45_1646_c1 nmdc:mga07m45_1646_c1_9135_10043 297
484 3300050496 nmdc:mga07m45_29161_c1 nmdc:mga07m45_29161_c1_1578_2471 297
485 3300050496 nmdc:mga07m45_761_c3 nmdc:mga07m45_761_c3_49_942 297
486 3300050507 nmdc:mga05p37_11484_c1 nmdc:mga05p37_11484_c1_112_1005 297
487 3300050509 nmdc:mga0qj67_130319_c1 nmdc:mga0qj67_130319_c1_117_1010 297
488 3300050509 nmdc:mga0qj67_207777_c1 nmdc:mga0qj67_207777_c1_360_1268 297
489 3300050516 nmdc:mga0sz30_13356_c1 nmdc:mga0sz30_13356_c1_482_1375 297
490 3300050516 nmdc:mga0sz30_55550_c1 nmdc:mga0sz30_55550_c1_284_1177 297
491 3300050516 nmdc:mga0sz30_5930_c1 nmdc:mga0sz30_5930_c1_2222_3118 297
492 3300050516 nmdc:mga0sz30_63502_c1 nmdc:mga0sz30_63502_c1_152_1045 297
493 3300053079 Ga0500610_0005942 Ga0500610_0005942_981_1874 297
494 3300053080 Ga0500635_0001144 Ga0500635_0001144_843_1739 297
495 3300053087 Ga0500643_000986 Ga0500643_000986_2262_3155 297
496 3300053087 Ga0500643_011228 Ga0500643_011228_697_1596 297
497 3300053131 Ga0500652_000426 Ga0500652_000426_2709_3605 297
498 3300053131 Ga0500652_004430 Ga0500652_004430_204_1103 297
499 3300053134 Ga0500658_0106076 Ga0500658_0106076_155_1054 297
500 3300053136 Ga0500559_0037544 Ga0500559_0037544_1066_1965 297
501 3300053139 Ga0500568_0053452 Ga0500568_0053452_596_1495 297
502 3300053153 Ga0500616_0005815 Ga0500616_0005815_2234_3142 297
503 3300053730 Ga0500645_016782 Ga0500645_016782_1130_2029 297
504 3300061719 Ga0466962_0016385 Ga0466962_0016385_2189_3082 297
505 3300001977 JGI24746J21847_1005051 JGI24746J21847_10050511 298
506 3300001989 JGI24739J22299_10018527 JGI24739J22299_100185273 298
507 3300001990 JGI24737J22298_10012126 JGI24737J22298_100121264 298
508 3300002070 JGI24750J21931_1011196 JGI24750J21931_10111962 298
509 3300002073 JGI24745J21846_1004105 JGI24745J21846_10041051 298
510 3300002075 JGI24738J21930_10026115 JGI24738J21930_100261151 298
511 3300002077 JGI24744J21845_10005686 JGI24744J21845_100056862 298
512 3300005328 Ga0070676_10180572 Ga0070676_101805721 298
513 3300005334 Ga0068869_100124776 Ga0068869_1001247764 298
514 3300005337 Ga0070682_100047840 Ga0070682_1000478404 298
515 3300005339 Ga0070660_100272852 Ga0070660_1002728521 298
516 3300005345 Ga0070692_10089997 Ga0070692_100899971 298
517 3300005347 Ga0070668_100079887 Ga0070668_1000798872 298
518 3300005364 Ga0070673_100259787 Ga0070673_1002597872 298
519 3300005441 Ga0070700_100115152 Ga0070700_1001151522 298
520 3300005455 Ga0070663_100254625 Ga0070663_1002546251 298
521 3300005466 Ga0070685_10008783 Ga0070685_100087837 298
522 3300005543 Ga0070672_100428822 Ga0070672_1004288221 298
523 3300005615 Ga0070702_100126533 Ga0070702_1001265331 298
524 3300005842 Ga0068858_100029305 Ga0068858_1000293054 298
525 3300006881 Ga0068865_100086397 Ga0068865_1000863972 298
526 3300009098 Ga0105245_10164949 Ga0105245_101649492 298
527 3300009148 Ga0105243_10108866 Ga0105243_101088662 298
528 3300009176 Ga0105242_10171026 Ga0105242_101710262 298
529 3300009545 Ga0105237_10122657 Ga0105237_101226573 298
530 3300010375 Ga0105239_10203940 Ga0105239_102039402 298
531 3300011119 Ga0105246_10018825 Ga0105246_100188252 298
532 3300017792 Ga0163161_10125691 Ga0163161_101256912 298
533 3300025901 Ga0207688_10019736 Ga0207688_100197364 298
534 3300025904 Ga0207647_10187552 Ga0207647_101875521 298
535 3300025927 Ga0207687_10021285 Ga0207687_100212851 298
536 3300025933 Ga0207706_10004955 Ga0207706_100049552 298
537 3300025940 Ga0207691_10283216 Ga0207691_102832161 298
538 3300025941 Ga0207711_10316232 Ga0207711_103162322 298
539 3300025942 Ga0207689_10002815 Ga0207689_100028155 298
540 3300025972 Ga0207668_10021724 Ga0207668_100217245 298
541 3300026067 Ga0207678_10028368 Ga0207678_100283682 298
542 3300026118 Ga0207675_100059229 Ga0207675_1000592292 298
543 3300028379 Ga0268266_10124600 Ga0268266_101246002 298
544 3300048907 Ga0496104_0024727 Ga0496104_0024727_4085_4996 298
545 3300048911 Ga0496108_0000645 Ga0496108_0000645_2078_2989 298
546 3300048912 Ga0496109_0086930 Ga0496109_0086930_1065_1976 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19345

MTHFR_2

Mycobacterial methylenetetrahydrofolate reductase

7

301

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wmw-assembly1.cif.gz_A crystal structure of methylenetetrahydrofolate reductase msmeg_6649 from mycobacterium smegmatis 0.9537 1 291
7wmy-assembly1.cif.gz_A crystal structure of methylenetetrahydrofolate reductase msmeg_6649 from mycobacterium smegmatis with 5-methyltetrahydrofolate 0.952 1 293
7wmz-assembly5.cif.gz_D crystal structure of methylenetetrahydrofolate reductase msmeg_6649 from mycobacterium smegmatis with nadh 0.9447 1 291
7wmz-assembly3.cif.gz_B crystal structure of methylenetetrahydrofolate reductase msmeg_6649 from mycobacterium smegmatis with nadh 0.9431 1 293
7wmy-assembly1.cif.gz_A crystal structure of methylenetetrahydrofolate reductase msmeg_6649 from mycobacterium smegmatis with 5-methyltetrahydrofolate 0.9426 1 293
ID Description Score Start End Superfamily
af_O53506_2_293_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9684 2 292 3.20.20.220
af_O53506_2_293_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9619 2 292 3.20.20.220
3ijdB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.7464 5 291 3.20.20.220
3ijdB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.7115 5 291 3.20.20.220
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.6898 5 293 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A2S8KYL2-F1-model_v4 deleted 0.9654 1 293
AF-Q7D7F2-F1-model_v4 5,10-methylenetetrahydrofolate reductase 0.9558 1 297
AF-Q7D7F2-F1-model_v4 5,10-methylenetetrahydrofolate reductase 0.9527 1 297
AF-A0A2S8KYL2-F1-model_v4 deleted 0.9527 1 293
AF-A0A6J4SQ62-F1-model_v4 Uncharacterized protein 0.9492 3 84

Feature Viewer

pLDDT pTM Quality
87.63 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map