F461826

General Info

Members Datasets Scaffolds Average Seq Length
545 193 1090 216

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10406448|Ga0070692_104064481
Length 255
Sequence MLTGELHLGYCDTLLSDTGAGLNERWARSVGYHAWNMTATRFCIFDMDGVLIDSGAHHRNAWQTLLEELEVTPDEPEYWRLTIGRPAEEAVPLLLGRAVSGAEARHLALRKRELYAGFARRGTLTVAGVSAFVVSLARQGVPRAVGTSASRWDVDTLLGELGLRRHFDVIVTAEDVRMGKPDPEVYLEAARRLGAPPPDCLVFEDSLVGVEAARRAGMRAVGVTTAHSDAELRASGAESTIPHFEGLEWTALARR

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.37
Rhizosphere 99.63
Stem 0
Stem Tuber 0
Unclassified 11.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10406448 3300005345 Bacteria 861
2 JGI25406J46586_10009429 3300003203 Bacteria 4371
3 JGI26129J50193_1001005 3300003349 Bacteria 1865
4 JGI26141J51220_1002462 3300003503 Bacteria 1132
5 Ga0070670_100018470 3300005331 Bacteria 5983
6 Ga0068869_100001057 3300005334 Bacteria 16053
7 Ga0068869_100021307 3300005334 Bacteria 4457
8 Ga0068869_100433480 3300005334 Unclassified 1087
9 Ga0070666_10067898 3300005335 Bacteria 2421
10 Ga0070680_100194396 3300005336 Bacteria 1710
11 Ga0070680_100231722 3300005336 Unclassified 1560
12 Ga0070682_100000454 3300005337 Bacteria 25914
13 Ga0068868_100110592 3300005338 Bacteria 2232
14 Ga0070689_100553986 3300005340 Bacteria 991
15 Ga0070691_10008148 3300005341 Bacteria 4799
16 Ga0070691_10242186 3300005341 Unclassified 964
17 Ga0070691_10277536 3300005341 Unclassified 908
18 Ga0070661_100027616 3300005344 Bacteria 4088
19 Ga0070692_10006190 3300005345 Bacteria 5177
20 Ga0070692_10017424 3300005345 Bacteria 3435
21 Ga0070669_100027223 3300005353 Bacteria 4114
22 Ga0070669_100068468 3300005353 Bacteria 2620
23 Ga0070675_100760703 3300005354 Bacteria 884
24 Ga0070671_100057122 3300005355 Bacteria 3247
25 Ga0070659_100008947 3300005366 Bacteria 7340
26 Ga0070703_10010658 3300005406 Unclassified 2592
27 Ga0070703_10010734 3300005406 Bacteria 2584
28 Ga0070703_10020426 3300005406 Bacteria 1927
29 Ga0070713_100381393 3300005436 Bacteria 1313
30 Ga0070705_100000399 3300005440 Bacteria 25036
31 Ga0070705_100045955 3300005440 Bacteria 2515
32 Ga0070705_100089598 3300005440 Bacteria 1913
33 Ga0070694_100003917 3300005444 Bacteria 8904
34 Ga0070694_100010251 3300005444 Bacteria 5771
35 Ga0070694_100020116 3300005444 Bacteria 4252
36 Ga0070694_100057964 3300005444 Bacteria 2634
37 Ga0070694_100181878 3300005444 Bacteria 1556
38 Ga0070694_100289490 3300005444 Unclassified 1251
39 Ga0070694_100415279 3300005444 Unclassified 1056
40 Ga0070708_100025693 3300005445 Bacteria 5036
41 Ga0070708_100034482 3300005445 Bacteria 4404
42 Ga0070708_100080427 3300005445 Bacteria 2949
43 Ga0070708_100102932 3300005445 Bacteria 2617
44 Ga0070708_100123635 3300005445 Bacteria 2389
45 Ga0070708_100129538 3300005445 Bacteria 2334
46 Ga0070708_100188285 3300005445 Bacteria 1930
47 Ga0070708_100216083 3300005445 Bacteria 1797
48 Ga0070708_100265173 3300005445 Unclassified 1615
49 Ga0070708_100581725 3300005445 Bacteria 1056
50 Ga0070708_100927103 3300005445 Bacteria 817
51 Ga0070663_100002902 3300005455 Bacteria 9744
52 Ga0070662_100046980 3300005457 Bacteria 3103
53 Ga0068867_100001599 3300005459 Bacteria 15735
54 Ga0068867_100054291 3300005459 Bacteria 2960
55 Ga0068867_100319825 3300005459 Unclassified 1285
56 Ga0070706_100020481 3300005467 Bacteria 6095
57 Ga0070706_100026146 3300005467 Bacteria 5371
58 Ga0070706_100068277 3300005467 Bacteria 3287
59 Ga0070706_100096283 3300005467 Unclassified 2748
60 Ga0070706_100106683 3300005467 Bacteria 2606
61 Ga0070706_100177389 3300005467 Bacteria 1989
62 Ga0070706_100189702 3300005467 Bacteria 1921
63 Ga0070706_100230354 3300005467 Bacteria 1729
64 Ga0070706_100272103 3300005467 Unclassified 1581
65 Ga0070706_100280533 3300005467 Bacteria 1555
66 Ga0070707_100006161 3300005468 Bacteria 11172
67 Ga0070707_100065219 3300005468 Unclassified 3498
68 Ga0070707_100071967 3300005468 Unclassified 3331
69 Ga0070707_100073503 3300005468 Bacteria 3296
70 Ga0070707_100183045 3300005468 Bacteria 2043
71 Ga0070707_100269272 3300005468 Bacteria 1656
72 Ga0070707_100379330 3300005468 Unclassified 1374
73 Ga0070698_100031811 3300005471 Bacteria 5468
74 Ga0070698_100071285 3300005471 Bacteria 3485
75 Ga0070698_100072053 3300005471 Bacteria 3463
76 Ga0070698_100080583 3300005471 Bacteria 3250
77 Ga0070698_100263381 3300005471 Bacteria 1656
78 Ga0070698_100733845 3300005471 Unclassified 930
79 Ga0070698_100765782 3300005471 Bacteria 909
80 Ga0070699_100001506 3300005518 Bacteria 21318
81 Ga0070699_100009031 3300005518 Bacteria 8635
82 Ga0070699_100013302 3300005518 Bacteria 7097
83 Ga0070699_100028648 3300005518 Bacteria 4803
84 Ga0070699_100032872 3300005518 Bacteria 4481
85 Ga0070699_100051958 3300005518 Bacteria 3548
86 Ga0070699_100084702 3300005518 Bacteria 2766
87 Ga0070699_100116019 3300005518 Bacteria 2353
88 Ga0070699_100283983 3300005518 Bacteria 1483
89 Ga0070699_100333277 3300005518 Unclassified 1365
90 Ga0070679_100001290 3300005530 Bacteria 22140
91 Ga0070684_100059438 3300005535 Bacteria 3342
92 Ga0070697_100007886 3300005536 Bacteria 8297
93 Ga0070697_100008411 3300005536 Bacteria 8051
94 Ga0070697_100045084 3300005536 Unclassified 3573
95 Ga0070697_100267485 3300005536 Bacteria 1465
96 Ga0070697_100657354 3300005536 Unclassified 923
97 Ga0068853_100008678 3300005539 Bacteria 8175
98 Ga0070672_100188305 3300005543 Bacteria 1722
99 Ga0070695_100000906 3300005545 Bacteria 15990
100 Ga0070695_100007124 3300005545 Bacteria 6628
101 Ga0070695_100033997 3300005545 Bacteria 3193
102 Ga0070695_100052172 3300005545 Bacteria 2627
103 Ga0070695_100099831 3300005545 Bacteria 1953
104 Ga0070695_100281283 3300005545 Bacteria 1222
105 Ga0070696_100000502 3300005546 Bacteria 24703
106 Ga0070696_100014089 3300005546 Bacteria 5367
107 Ga0070696_100026498 3300005546 Bacteria 3944
108 Ga0070696_100028035 3300005546 Bacteria 3841
109 Ga0070696_100044605 3300005546 Unclassified 3070
110 Ga0070696_100331245 3300005546 Bacteria 1174
111 Ga0070693_100000351 3300005547 Bacteria 20916
112 Ga0070693_100042738 3300005547 Bacteria 2555
113 Ga0070704_100182084 3300005549 Unclassified 1681
114 Ga0070704_100321863 3300005549 Bacteria 1296
115 Ga0070664_100019807 3300005564 Bacteria 5538
116 Ga0068857_100061516 3300005577 Bacteria 3336
117 Ga0068857_100164913 3300005577 Bacteria 2012
118 Ga0068857_100178720 3300005577 Bacteria 1931
119 Ga0068854_100002069 3300005578 Bacteria 12294
120 Ga0068854_100513063 3300005578 Bacteria 1011
121 Ga0068856_100003359 3300005614 Bacteria 16220
122 Ga0070702_100004438 3300005615 Bacteria 6408
123 Ga0068852_100164086 3300005616 Bacteria 2077
124 Ga0068859_100003524 3300005617 Bacteria 15933
125 Ga0068859_100147493 3300005617 Unclassified 2428
126 Ga0068859_100225855 3300005617 Unclassified 1960
127 Ga0068864_100004950 3300005618 Bacteria 10917
128 Ga0068866_10161687 3300005718 Bacteria 1306
129 Ga0068861_100161848 3300005719 Bacteria 1847
130 Ga0068870_10000979 3300005840 Bacteria 11262
131 Ga0068870_10088043 3300005840 Bacteria 1730
132 Ga0068863_100023340 3300005841 Bacteria 5909
133 Ga0068858_100318233 3300005842 Bacteria 1487
134 Ga0068860_100020850 3300005843 Bacteria 6349
135 Ga0068860_100097772 3300005843 Bacteria 2799
136 Ga0068860_100118828 3300005843 Bacteria 2530
137 Ga0068860_100183098 3300005843 Unclassified 2025
138 Ga0068860_100436438 3300005843 Unclassified 1300
139 Ga0068860_100826083 3300005843 Bacteria 941
140 Ga0068862_100012703 3300005844 Bacteria 6970
141 Ga0068862_100015463 3300005844 Bacteria 6338
142 Ga0068862_100021420 3300005844 Bacteria 5400
143 Ga0068862_100231410 3300005844 Bacteria 1677
144 Ga0068862_100238878 3300005844 Bacteria 1651
145 Ga0068862_100275674 3300005844 Bacteria 1540
146 Ga0081455_10007461 3300005937 Bacteria 11516
147 Ga0081455_10367356 3300005937 Bacteria 1010
148 Ga0081540_1002985 3300005983 Bacteria 13559
149 Ga0081539_10000702 3300005985 Bacteria 67205
150 Ga0070715_10104283 3300006163 Bacteria 1328
151 Ga0070712_100121895 3300006175 Bacteria 1963
152 Ga0075428_100001232 3300006844 Bacteria 27372
153 Ga0075428_100017257 3300006844 Bacteria 7977
154 Ga0075428_100071360 3300006844 Bacteria 3795
155 Ga0075428_100111801 3300006844 Bacteria 2976
156 Ga0075428_100571033 3300006844 Bacteria 1209
157 Ga0075430_100069051 3300006846 Bacteria 2965
158 Ga0075430_100074595 3300006846 Bacteria 2844
159 Ga0075430_100151685 3300006846 Bacteria 1930
160 Ga0075430_100814960 3300006846 Bacteria 769
161 Ga0075431_100000205 3300006847 Bacteria 43668
162 Ga0075431_100003849 3300006847 Bacteria 14594
163 Ga0075431_100006333 3300006847 Bacteria 11758
164 Ga0075431_100021499 3300006847 Bacteria 6599
165 Ga0075431_100029042 3300006847 Bacteria 5689
166 Ga0075431_100420897 3300006847 Bacteria 1335
167 Ga0075433_10000177 3300006852 Bacteria 35403
168 Ga0075433_10000880 3300006852 Bacteria 21092
169 Ga0075433_10001281 3300006852 Bacteria 18351
170 Ga0075433_10003175 3300006852 Bacteria 12660
171 Ga0075433_10007033 3300006852 Bacteria 8913
172 Ga0075433_10010312 3300006852 Bacteria 7494
173 Ga0075433_10043571 3300006852 Bacteria 3896
174 Ga0075433_10268524 3300006852 Unclassified 1512
175 Ga0075433_10530696 3300006852 Bacteria 1035
176 Ga0075434_100001282 3300006871 Bacteria 20957
177 Ga0075434_100003650 3300006871 Bacteria 13743
178 Ga0075434_100010268 3300006871 Bacteria 8774
179 Ga0075434_100022660 3300006871 Bacteria 6115
180 Ga0075434_100047677 3300006871 Bacteria 4252
181 Ga0075434_100065736 3300006871 Bacteria 3612
182 Ga0075434_100083250 3300006871 Bacteria 3197
183 Ga0075434_100085121 3300006871 Bacteria 3161
184 Ga0075434_100112785 3300006871 Bacteria 2730
185 Ga0075434_100130657 3300006871 Bacteria 2530
186 Ga0075434_100174662 3300006871 Unclassified 2168
187 Ga0075434_100206170 3300006871 Bacteria 1986
188 Ga0075434_100312940 3300006871 Bacteria 1590
189 Ga0075434_100317022 3300006871 Bacteria 1580
190 Ga0075429_100005792 3300006880 Bacteria 10663
191 Ga0075429_100007992 3300006880 Bacteria 9188
192 Ga0075429_100014807 3300006880 Bacteria 6758
193 Ga0075429_100022277 3300006880 Bacteria 5496
194 Ga0075429_100038187 3300006880 Bacteria 4181
195 Ga0075429_100058812 3300006880 Bacteria 3348
196 Ga0075429_100116052 3300006880 Bacteria 2341
197 Ga0075429_100140673 3300006880 Bacteria 2112
198 Ga0068865_100084957 3300006881 Bacteria 2282
199 Ga0068865_100120904 3300006881 Bacteria 1947
200 Ga0075436_100012472 3300006914 Bacteria 5824
201 Ga0075436_100019501 3300006914 Bacteria 4648
202 Ga0075436_100021017 3300006914 Bacteria 4478
203 Ga0075436_100022111 3300006914 Bacteria 4368
204 Ga0097620_100003524 3300006931 Bacteria 15933
205 Ga0097620_100147493 3300006931 Unclassified 2428
206 Ga0097620_100225852 3300006931 Unclassified 1960
207 Ga0075435_100021226 3300007076 Bacteria 4991
208 Ga0075435_100031203 3300007076 Bacteria 4196
209 Ga0075435_100038833 3300007076 Bacteria 3797
210 Ga0075435_100047179 3300007076 Bacteria 3458
211 Ga0075435_100109590 3300007076 Bacteria 2295
212 Ga0075435_100415489 3300007076 Bacteria 1158
213 Ga0075435_100439406 3300007076 Bacteria 1125
214 Ga0075435_100443138 3300007076 Bacteria 1120
215 Ga0099794_10012582 3300007265 Bacteria 3657
216 Ga0099794_10024573 3300007265 Bacteria 2767
217 Ga0111539_10001850 3300009094 Bacteria 28137
218 Ga0111539_10004531 3300009094 Bacteria 18166
219 Ga0111539_10010020 3300009094 Bacteria 11944
220 Ga0111539_10117916 3300009094 Bacteria 3111
221 Ga0105245_10196096 3300009098 Unclassified 1937
222 Ga0105245_10447421 3300009098 Unclassified 1300
223 Ga0105247_10253550 3300009101 Unclassified 1204
224 Ga0114129_10000003 3300009147 Bacteria 183186
225 Ga0114129_10000810 3300009147 Bacteria 40217
226 Ga0114129_10002160 3300009147 Bacteria 27095
227 Ga0114129_10008648 3300009147 Bacteria 14514
228 Ga0114129_10033618 3300009147 Bacteria 7245
229 Ga0114129_10075951 3300009147 Bacteria 4678
230 Ga0114129_10080870 3300009147 Bacteria 4517
231 Ga0114129_10096253 3300009147 Bacteria 4099
232 Ga0114129_10152841 3300009147 Bacteria 3158
233 Ga0114129_10197062 3300009147 Bacteria 2730
234 Ga0114129_10238454 3300009147 Bacteria 2446
235 Ga0114129_10262716 3300009147 Bacteria 2313
236 Ga0114129_10392433 3300009147 Unclassified 1830
237 Ga0114129_10962890 3300009147 Bacteria 1077
238 Ga0114129_11474398 3300009147 Bacteria 837
239 Ga0105243_10112309 3300009148 Bacteria 2283
240 Ga0105243_10313195 3300009148 Unclassified 1427
241 Ga0105241_10022066 3300009174 Bacteria 4713
242 Ga0105241_10514433 3300009174 Unclassified 1069
243 Ga0105241_10971507 3300009174 Bacteria 793
244 Ga0105242_10004360 3300009176 Bacteria 11011
245 Ga0105248_10210417 3300009177 Bacteria 2191
246 Ga0105249_10073694 3300009553 Bacteria 3159
247 Ga0105249_10261891 3300009553 Bacteria 1719
248 Ga0105249_10389793 3300009553 Bacteria 1421
249 Ga0105239_10521078 3300010375 Bacteria 1352
250 Ga0105246_10290853 3300011119 Bacteria 1314
251 Ga0105246_10333972 3300011119 Unclassified 1236
252 Ga0157370_10478149 3300013104 Bacteria 1145
253 Ga0157369_10029997 3300013105 Bacteria 6001
254 Ga0157378_10156762 3300013297 Bacteria 2126
255 Ga0157372_10002929 3300013307 Bacteria 18425
256 Ga0157375_10921153 3300013308 Bacteria 1017
257 Ga0163163_10038414 3300014325 Bacteria 4666
258 Ga0157380_10078805 3300014326 Bacteria 2689
259 Ga0207653_10007491 3300025885 Bacteria 3403
260 Ga0207642_10134842 3300025899 Bacteria 1294
261 Ga0207642_10323271 3300025899 Unclassified 901
262 Ga0207688_10016944 3300025901 Bacteria 3958
263 Ga0207645_10003316 3300025907 Bacteria 12284
264 Ga0207645_10067535 3300025907 Bacteria 2286
265 Ga0207645_10172578 3300025907 Bacteria 1418
266 Ga0207643_10001985 3300025908 Bacteria 11304
267 Ga0207643_10081888 3300025908 Bacteria 1871
268 Ga0207684_10001758 3300025910 Bacteria 22904
269 Ga0207684_10004199 3300025910 Bacteria 13680
270 Ga0207684_10011536 3300025910 Bacteria 7722
271 Ga0207684_10017333 3300025910 Bacteria 6179
272 Ga0207684_10018866 3300025910 Bacteria 5899
273 Ga0207684_10047378 3300025910 Bacteria 3645
274 Ga0207684_10048877 3300025910 Bacteria 3588
275 Ga0207684_10058103 3300025910 Bacteria 3282
276 Ga0207684_10142056 3300025910 Bacteria 2064
277 Ga0207684_10327852 3300025910 Bacteria 1319
278 Ga0207684_10401527 3300025910 Bacteria 1178
279 Ga0207654_10025786 3300025911 Bacteria 3176
280 Ga0207654_10352194 3300025911 Unclassified 1014
281 Ga0207707_10000197 3300025912 Bacteria 63923
282 Ga0207693_10101834 3300025915 Bacteria 2252
283 Ga0207660_10000625 3300025917 Bacteria 23831
284 Ga0207660_10008323 3300025917 Bacteria 6704
285 Ga0207660_10414735 3300025917 Unclassified 1085
286 Ga0207660_10551810 3300025917 Bacteria 937
287 Ga0207657_10000264 3300025919 Bacteria 55674
288 Ga0207649_10010305 3300025920 Bacteria 5131
289 Ga0207652_10000696 3300025921 Bacteria 32573
290 Ga0207646_10011830 3300025922 Bacteria 8423
291 Ga0207646_10012183 3300025922 Bacteria 8273
292 Ga0207646_10018347 3300025922 Bacteria 6527
293 Ga0207646_10018378 3300025922 Bacteria 6522
294 Ga0207646_10024326 3300025922 Bacteria 5548
295 Ga0207646_10030782 3300025922 Bacteria 4862
296 Ga0207646_10046725 3300025922 Bacteria 3883
297 Ga0207646_10154546 3300025922 Bacteria 2069
298 Ga0207646_10327846 3300025922 Unclassified 1383
299 Ga0207646_10390502 3300025922 Bacteria 1257
300 Ga0207681_10071516 3300025923 Bacteria 2420
301 Ga0207681_10190944 3300025923 Bacteria 1567
302 Ga0207687_10086992 3300025927 Bacteria 2270
303 Ga0207687_10244122 3300025927 Unclassified 1425
304 Ga0207690_10002038 3300025932 Bacteria 12389
305 Ga0207706_10019268 3300025933 Bacteria 6136
306 Ga0207686_10372954 3300025934 Unclassified 1080
307 Ga0207709_10345265 3300025935 Unclassified 1122
308 Ga0207704_10958813 3300025938 Unclassified 722
309 Ga0207665_10013977 3300025939 Bacteria 5281
310 Ga0207711_10024169 3300025941 Bacteria 5086
311 Ga0207689_10000141 3300025942 Bacteria 61620
312 Ga0207689_10019915 3300025942 Bacteria 5651
313 Ga0207689_10060774 3300025942 Bacteria 3108
314 Ga0207689_10686548 3300025942 Bacteria 863
315 Ga0207679_10001118 3300025945 Bacteria 17096
316 Ga0207667_10017008 3300025949 Bacteria 8203
317 Ga0207712_10068066 3300025961 Bacteria 2549
318 Ga0207712_10093505 3300025961 Bacteria 2219
319 Ga0207712_10117033 3300025961 Bacteria 2009
320 Ga0207712_10253831 3300025961 Bacteria 1423
321 Ga0207640_10005987 3300025981 Bacteria 6646
322 Ga0207640_10430744 3300025981 Bacteria 1082
323 Ga0207640_10461612 3300025981 Unclassified 1049
324 Ga0207639_10001328 3300026041 Bacteria 16729
325 Ga0207678_10001527 3300026067 Bacteria 21232
326 Ga0207708_10214354 3300026075 Bacteria 1540
327 Ga0207641_10014614 3300026088 Bacteria 6436
328 Ga0207648_10190117 3300026089 Bacteria 1819
329 Ga0207648_10285190 3300026089 Bacteria 1477
330 Ga0207674_10000412 3300026116 Bacteria 55670
331 Ga0207674_10198980 3300026116 Bacteria 1953
332 Ga0207674_10294511 3300026116 Bacteria 1571
333 Ga0207675_100173834 3300026118 Bacteria 2060
334 Ga0207698_10602618 3300026142 Bacteria 1083
335 Ga0209983_1000380 3300027665 Bacteria 9453
336 Ga0209588_1102079 3300027671 Bacteria 923
337 Ga0209971_1000228 3300027682 Bacteria 16409
338 Ga0209966_1000098 3300027695 Bacteria 38805
339 Ga0209998_10000125 3300027717 Bacteria 29964
340 Ga0207428_10000035 3300027907 Bacteria 229100
341 Ga0207428_10000477 3300027907 Bacteria 48330
342 Ga0207428_10118988 3300027907 Bacteria 2027
343 Ga0207428_10226041 3300027907 Bacteria 1402
344 Ga0268265_10008869 3300028380 Bacteria 6796
345 Ga0268264_10067735 3300028381 Bacteria 3014
346 Ga0268264_10087711 3300028381 Bacteria 2676
347 Ga0268264_10358640 3300028381 Bacteria 1390
348 Ga0268264_10661864 3300028381 Unclassified 1034
349 Ga0268264_10745132 3300028381 Bacteria 976
350 Ga0268264_10914845 3300028381 Bacteria 881
351 Ga0307408_100065547 3300031548 Bacteria 2664
352 Ga0307408_100128576 3300031548 Bacteria 1973
353 Ga0307408_100709452 3300031548 Bacteria 905
354 Ga0307408_100745982 3300031548 Archaea 884
355 Ga0307410_10125571 3300031852 Bacteria 1878
356 Ga0307416_100110983 3300032002 Bacteria 2416
357 Ga0307416_100703213 3300032002 Bacteria 1100
358 Ga0307411_10147356 3300032005 Bacteria 1744
359 Ga0307411_10158090 3300032005 Bacteria 1693
360 Ga0307415_100114505 3300032126 Bacteria 2008
361 Ga0373948_0003588 3300034817 Bacteria 2397
362 Ga0373948_0036021 3300034817 Unclassified 1018
363 Ga0373940_0034981 3300035088 Bacteria 1358
364 Ga0373951_0001791 3300035091 Bacteria 5580
365 Ga0373960_0078006 3300035121 Bacteria 1037
366 Ga0373961_0005263 3300035241 Bacteria 3112
367 Ga0373962_0057034 3300035242 Bacteria 1139
368 Ga0373931_0015293 3300035691 Bacteria 3762
369 Ga0373931_0021112 3300035691 Bacteria 3266
370 Ga0395900_0306755 3300037418 Bacteria 1572
371 Ga0439448_0002199 3300042005 Bacteria 5270
372 Ga0439450_016835 3300042008 Bacteria 1516
373 Ga0439460_0003076 3300042461 Bacteria 4033
374 Ga0451577_0015222 3300042876 Bacteria 7156
375 Ga0451577_0043040 3300042876 Bacteria 4046
376 Ga0451577_0068232 3300042876 Unclassified 3171
377 Ga0451577_0142829 3300042876 Bacteria 2152
378 Ga0453683_0027244 3300044673 Bacteria 3627
379 Ga0453683_0029642 3300044673 Bacteria 3460
380 Ga0453683_0207780 3300044673 Bacteria 1243
381 Ga0453684_0039501 3300044712 Bacteria 6429
382 Ga0453684_1002039 3300044712 Bacteria 888
383 Ga0451576_0015447 3300045051 Bacteria 8456
384 Ga0451576_0035248 3300045051 Bacteria 5310
385 Ga0451576_0073396 3300045051 Bacteria 3560
386 Ga0451576_0076235 3300045051 Bacteria 3490
387 Ga0451576_0108740 3300045051 Bacteria 2885
388 Ga0451576_0192665 3300045051 Bacteria 2129
389 Ga0451576_0203988 3300045051 Bacteria 2065
390 Ga0451576_0319593 3300045051 Unclassified 1624
391 Ga0451576_0829803 3300045051 Unclassified 970
392 Ga0451576_1119817 3300045051 Bacteria 823
393 Ga0495580_0006395 3300046472 Bacteria 9600
394 Ga0495584_0316343 3300046491 Bacteria 793
395 Ga0495659_0180039 3300046664 Bacteria 860
396 Ga0496106_0469066 3300048909 Bacteria 1011
397 Ga0496112_0119111 3300048915 Bacteria 2610
398 Ga0501033_0129445 3300049570 Bacteria 1829
399 Ga0501036_0115011 3300049572 Bacteria 2273
400 Ga0501036_0368964 3300049572 Bacteria 1198
401 Ga0501036_0655412 3300049572 Bacteria 869
402 Ga0501038_0074756 3300049574 Unclassified 2866
403 Ga0501040_0007825 3300049576 Bacteria 6922
404 Ga0501040_0024291 3300049576 Bacteria 4066
405 Ga0501040_0152921 3300049576 Bacteria 1628
406 Ga0501040_0327585 3300049576 Bacteria 1096
407 Ga0501040_0345800 3300049576 Bacteria 1065
408 Ga0501041_0011005 3300049577 Bacteria 5342
409 Ga0501041_0081727 3300049577 Bacteria 1990
410 Ga0501041_0131506 3300049577 Bacteria 1559
411 Ga0501041_0133618 3300049577 Bacteria 1546
412 Ga0501041_0322191 3300049577 Bacteria 975
413 Ga0501041_0403122 3300049577 Bacteria 866
414 Ga0501042_0455831 3300049578 Unclassified 927
415 Ga0501042_0526828 3300049578 Bacteria 858
416 Ga0501043_0340342 3300049579 Bacteria 1141
417 Ga0501046_0001710 3300049580 Bacteria 20958
418 Ga0501046_0083885 3300049580 Bacteria 2459
419 Ga0501048_0020083 3300049582 Bacteria 4900
420 Ga0501048_0105220 3300049582 Bacteria 1992
421 Ga0501067_0060202 3300049583 Bacteria 2101
422 Ga0501068_0059352 3300049584 Bacteria 2323
423 Ga0501069_0602160 3300049585 Bacteria 659
424 Ga0501070_0774018 3300049586 Bacteria 755
425 Ga0501071_0103447 3300049587 Bacteria 2101
426 Ga0501071_0108647 3300049587 Unclassified 2049
427 Ga0501071_0621370 3300049587 Bacteria 831
428 Ga0501072_0152588 3300049588 Unclassified 1842
429 Ga0501072_0166281 3300049588 Bacteria 1760
430 Ga0501074_0052821 3300049590 Bacteria 2933
431 Ga0501074_0161367 3300049590 Bacteria 1601
432 Ga0501075_0012219 3300049591 Bacteria 6095
433 Ga0501075_0016082 3300049591 Bacteria 5383
434 Ga0501075_0024434 3300049591 Bacteria 4432
435 Ga0501075_0134547 3300049591 Bacteria 1883
436 Ga0501075_0186662 3300049591 Bacteria 1581
437 Ga0501075_0245615 3300049591 Bacteria 1364
438 Ga0501075_0638933 3300049591 Bacteria 811
439 Ga0501076_0056284 3300049592 Bacteria 3121
440 Ga0501076_0109839 3300049592 Bacteria 2229
441 Ga0501076_0114370 3300049592 Bacteria 2183
442 Ga0501076_0215301 3300049592 Bacteria 1570
443 Ga0501076_0360461 3300049592 Unclassified 1194
444 Ga0501076_0680607 3300049592 Unclassified 849
445 Ga0501077_0062314 3300049593 Bacteria 2366
446 Ga0501077_0071184 3300049593 Bacteria 2204
447 Ga0501077_0088672 3300049593 Bacteria 1960
448 Ga0501077_0507619 3300049593 Bacteria 773
449 Ga0501079_0002998 3300049741 Bacteria 12341
450 Ga0501079_0017978 3300049741 Bacteria 5397
451 Ga0501079_0307408 3300049741 Bacteria 1240
452 Ga0501080_0318344 3300049742 Bacteria 1409
453 Ga0501081_0062822 3300049743 Bacteria 2576
454 Ga0501081_0088493 3300049743 Bacteria 2175
455 Ga0501081_0118125 3300049743 Bacteria 1886
456 Ga0501081_0174262 3300049743 Bacteria 1554
457 Ga0501083_0022648 3300049744 Bacteria 4359
458 Ga0501083_0108114 3300049744 Bacteria 1830
459 Ga0501035_0513776 3300049822 Bacteria 985
460 Ga0501045_0011930 3300049824 Bacteria 6109
461 Ga0501045_0037167 3300049824 Bacteria 3539
462 Ga0501045_0264665 3300049824 Bacteria 1280
463 Ga0501045_0484427 3300049824 Bacteria 919
464 Ga0501045_0527699 3300049824 Bacteria 876
465 nmdc:mga05p37_168835_c1 3300050507 Bacteria 2669
466 nmdc:mga05p37_173452_c1 3300050507 Bacteria 2629
467 nmdc:mga05p37_2009_c1 3300050507 Bacteria 23745
468 nmdc:mga05p37_279_c1 3300050507 Bacteria 53447
469 nmdc:mga05p37_316945_c1 3300050507 Unclassified 1847
470 nmdc:mga05p37_3283_c1 3300050507 Bacteria 18860
471 nmdc:mga05p37_3699_c1 3300050507 Bacteria 17884
472 nmdc:mga05p37_48287_c1 3300050507 Bacteria 5235
473 nmdc:mga05p37_60487_c1 3300050507 Bacteria 4664
474 nmdc:mga05p37_651_c1 3300050507 Bacteria 38411
475 nmdc:mga05p37_72613_c1 3300050507 Bacteria 4234
476 nmdc:mga05p37_920915_c1 3300050507 Bacteria 940
477 nmdc:mga09592_10637_c1 3300050508 Bacteria 7493
478 nmdc:mga09592_13695_c1 3300050508 Bacteria 6625
479 nmdc:mga09592_228307_c1 3300050508 Bacteria 1613
480 nmdc:mga09592_3407_c1 3300050508 Bacteria 12848
481 nmdc:mga09592_4616_c1 3300050508 Bacteria 11157
482 nmdc:mga09592_690290_c1 3300050508 Bacteria 869
483 nmdc:mga09592_9588_c1 3300050508 Bacteria 7866
484 nmdc:mga0qj67_1277_c1 3300050509 Bacteria 17644
485 nmdc:mga0qj67_152960_c1 3300050509 Bacteria 1872
486 nmdc:mga0qj67_172137_c1 3300050509 Bacteria 1758
487 nmdc:mga0qj67_59051_c1 3300050509 Bacteria 3041
488 nmdc:mga06r32_120770_c1 3300050510 Bacteria 2585
489 nmdc:mga06r32_418_c1 3300050510 Bacteria 35763
490 nmdc:mga06r32_625_c1 3300050510 Bacteria 30796
491 nmdc:mga06r32_7414_c1 3300050510 Bacteria 9867
492 nmdc:mga06r32_76240_c1 3300050510 Bacteria 3256
493 nmdc:mga06r32_95568_c1 3300050510 Bacteria 2909
494 nmdc:mga08y16_226544_c1 3300050511 Bacteria 1934
495 nmdc:mga08y16_32835_c1 3300050511 Bacteria 5457
496 nmdc:mga08y16_589_c1 3300050511 Bacteria 33849
497 nmdc:mga0n895_117681_c1 3300050512 Bacteria 2677
498 nmdc:mga0n895_1217_c1 3300050512 Bacteria 19007
499 nmdc:mga0n895_15197_c1 3300050512 Bacteria 7014
500 nmdc:mga0n895_20473_c1 3300050512 Bacteria 6170
501 nmdc:mga0n895_220098_c1 3300050512 Bacteria 1928
502 nmdc:mga0n895_269100_c1 3300050512 Unclassified 1729
503 nmdc:mga0n895_2708_c1 3300050512 Bacteria 13984
504 nmdc:mga0n895_280773_c1 3300050512 Unclassified 1689
505 nmdc:mga0n895_438441_c1 3300050512 Bacteria 1320
506 nmdc:mga0n895_450876_c1 3300050512 Bacteria 1299
507 nmdc:mga0n895_4572_c1 3300050512 Bacteria 11396
508 nmdc:mga0rr50_111126_c1 3300050513 Bacteria 2169
509 nmdc:mga0rr50_146849_c1 3300050513 Bacteria 1902
510 nmdc:mga0rr50_156611_c1 3300050513 Bacteria 1846
511 nmdc:mga0rr50_242875_c1 3300050513 Bacteria 1493
512 nmdc:mga0rr50_271868_c1 3300050513 Bacteria 1412
513 nmdc:mga0rr50_32046_c1 3300050513 Bacteria 3740
514 nmdc:mga0rr50_446247_c1 3300050513 Unclassified 1096
515 nmdc:mga0rr50_4868_c1 3300050513 Bacteria 7940
516 nmdc:mga0rr50_63515_c1 3300050513 Bacteria 2789
517 nmdc:mga08x19_17618_c1 3300050514 Bacteria 4373
518 nmdc:mga08x19_248188_c1 3300050514 Bacteria 1228
519 nmdc:mga08x19_48558_c1 3300050514 Bacteria 2719
520 nmdc:mga0a205_103704_c1 3300050515 Bacteria 2743
521 nmdc:mga0a205_1075_c1 3300050515 Bacteria 22701
522 nmdc:mga0a205_119505_c1 3300050515 Unclassified 2534
523 nmdc:mga0a205_1325_c1 3300050515 Bacteria 20885
524 nmdc:mga0a205_136862_c1 3300050515 Unclassified 2350
525 nmdc:mga0a205_2696_c1 3300050515 Bacteria 15692
526 nmdc:mga0a205_2958_c1 3300050515 Bacteria 15065
527 nmdc:mga0a205_339531_c1 3300050515 Bacteria 1371
528 nmdc:mga0a205_373_c1 3300050515 Bacteria 33879
529 nmdc:mga0a205_425390_c1 3300050515 Bacteria 1190
530 nmdc:mga0a205_473272_c1 3300050515 Bacteria 1111
531 nmdc:mga0a205_541_c1 3300050515 Bacteria 29829
532 Ga0501084_0012350 3300054114 Bacteria 7075
533 Ga0501084_0037630 3300054114 Bacteria 4044
534 Ga0501084_0046276 3300054114 Bacteria 3644
535 Ga0501084_0168993 3300054114 Bacteria 1846
536 Ga0501084_0392725 3300054114 Bacteria 1172
537 Ga0501082_0020643 3300060353 Bacteria 5678
538 Ga0501082_0038052 3300060353 Bacteria 4149
539 Ga0501082_0043750 3300060353 Bacteria 3863
540 Ga0501082_0167732 3300060353 Bacteria 1908
541 Ga0501082_0293554 3300060353 Bacteria 1415
542 Ga0530510_0097549 3300061734 Bacteria 2149
543 Ga0530510_0107660 3300061734 Bacteria 2040
544 Ga0530510_0234521 3300061734 Bacteria 1365
545 Ga0530510_0358696 3300061734 Bacteria 1095
546 Ga0070692_10406448
547 JGI25406J46586_10009429
548 JGI26129J50193_1001005
549 JGI26141J51220_1002462
550 Ga0070670_100018470
551 Ga0068869_100001057
552 Ga0068869_100021307
553 Ga0068869_100433480
554 Ga0070666_10067898
555 Ga0070680_100194396
556 Ga0070680_100231722
557 Ga0070682_100000454
558 Ga0068868_100110592
559 Ga0070689_100553986
560 Ga0070691_10008148
561 Ga0070691_10242186
562 Ga0070691_10277536
563 Ga0070661_100027616
564 Ga0070692_10006190
565 Ga0070692_10017424
566 Ga0070669_100027223
567 Ga0070669_100068468
568 Ga0070675_100760703
569 Ga0070671_100057122
570 Ga0070659_100008947
571 Ga0070703_10010658
572 Ga0070703_10010734
573 Ga0070703_10020426
574 Ga0070713_100381393
575 Ga0070705_100000399
576 Ga0070705_100045955
577 Ga0070705_100089598
578 Ga0070694_100003917
579 Ga0070694_100010251
580 Ga0070694_100020116
581 Ga0070694_100057964
582 Ga0070694_100181878
583 Ga0070694_100289490
584 Ga0070694_100415279
585 Ga0070708_100025693
586 Ga0070708_100034482
587 Ga0070708_100080427
588 Ga0070708_100102932
589 Ga0070708_100123635
590 Ga0070708_100129538
591 Ga0070708_100188285
592 Ga0070708_100216083
593 Ga0070708_100265173
594 Ga0070708_100581725
595 Ga0070708_100927103
596 Ga0070663_100002902
597 Ga0070662_100046980
598 Ga0068867_100001599
599 Ga0068867_100054291
600 Ga0068867_100319825
601 Ga0070706_100020481
602 Ga0070706_100026146
603 Ga0070706_100068277
604 Ga0070706_100096283
605 Ga0070706_100106683
606 Ga0070706_100177389
607 Ga0070706_100189702
608 Ga0070706_100230354
609 Ga0070706_100272103
610 Ga0070706_100280533
611 Ga0070707_100006161
612 Ga0070707_100065219
613 Ga0070707_100071967
614 Ga0070707_100073503
615 Ga0070707_100183045
616 Ga0070707_100269272
617 Ga0070707_100379330
618 Ga0070698_100031811
619 Ga0070698_100071285
620 Ga0070698_100072053
621 Ga0070698_100080583
622 Ga0070698_100263381
623 Ga0070698_100733845
624 Ga0070698_100765782
625 Ga0070699_100001506
626 Ga0070699_100009031
627 Ga0070699_100013302
628 Ga0070699_100028648
629 Ga0070699_100032872
630 Ga0070699_100051958
631 Ga0070699_100084702
632 Ga0070699_100116019
633 Ga0070699_100283983
634 Ga0070699_100333277
635 Ga0070679_100001290
636 Ga0070684_100059438
637 Ga0070697_100007886
638 Ga0070697_100008411
639 Ga0070697_100045084
640 Ga0070697_100267485
641 Ga0070697_100657354
642 Ga0068853_100008678
643 Ga0070672_100188305
644 Ga0070695_100000906
645 Ga0070695_100007124
646 Ga0070695_100033997
647 Ga0070695_100052172
648 Ga0070695_100099831
649 Ga0070695_100281283
650 Ga0070696_100000502
651 Ga0070696_100014089
652 Ga0070696_100026498
653 Ga0070696_100028035
654 Ga0070696_100044605
655 Ga0070696_100331245
656 Ga0070693_100000351
657 Ga0070693_100042738
658 Ga0070704_100182084
659 Ga0070704_100321863
660 Ga0070664_100019807
661 Ga0068857_100061516
662 Ga0068857_100164913
663 Ga0068857_100178720
664 Ga0068854_100002069
665 Ga0068854_100513063
666 Ga0068856_100003359
667 Ga0070702_100004438
668 Ga0068852_100164086
669 Ga0068859_100003524
670 Ga0068859_100147493
671 Ga0068859_100225855
672 Ga0068864_100004950
673 Ga0068866_10161687
674 Ga0068861_100161848
675 Ga0068870_10000979
676 Ga0068870_10088043
677 Ga0068863_100023340
678 Ga0068858_100318233
679 Ga0068860_100020850
680 Ga0068860_100097772
681 Ga0068860_100118828
682 Ga0068860_100183098
683 Ga0068860_100436438
684 Ga0068860_100826083
685 Ga0068862_100012703
686 Ga0068862_100015463
687 Ga0068862_100021420
688 Ga0068862_100231410
689 Ga0068862_100238878
690 Ga0068862_100275674
691 Ga0081455_10007461
692 Ga0081455_10367356
693 Ga0081540_1002985
694 Ga0081539_10000702
695 Ga0070715_10104283
696 Ga0070712_100121895
697 Ga0075428_100001232
698 Ga0075428_100017257
699 Ga0075428_100071360
700 Ga0075428_100111801
701 Ga0075428_100571033
702 Ga0075430_100069051
703 Ga0075430_100074595
704 Ga0075430_100151685
705 Ga0075430_100814960
706 Ga0075431_100000205
707 Ga0075431_100003849
708 Ga0075431_100006333
709 Ga0075431_100021499
710 Ga0075431_100029042
711 Ga0075431_100420897
712 Ga0075433_10000177
713 Ga0075433_10000880
714 Ga0075433_10001281
715 Ga0075433_10003175
716 Ga0075433_10007033
717 Ga0075433_10010312
718 Ga0075433_10043571
719 Ga0075433_10268524
720 Ga0075433_10530696
721 Ga0075434_100001282
722 Ga0075434_100003650
723 Ga0075434_100010268
724 Ga0075434_100022660
725 Ga0075434_100047677
726 Ga0075434_100065736
727 Ga0075434_100083250
728 Ga0075434_100085121
729 Ga0075434_100112785
730 Ga0075434_100130657
731 Ga0075434_100174662
732 Ga0075434_100206170
733 Ga0075434_100312940
734 Ga0075434_100317022
735 Ga0075429_100005792
736 Ga0075429_100007992
737 Ga0075429_100014807
738 Ga0075429_100022277
739 Ga0075429_100038187
740 Ga0075429_100058812
741 Ga0075429_100116052
742 Ga0075429_100140673
743 Ga0068865_100084957
744 Ga0068865_100120904
745 Ga0075436_100012472
746 Ga0075436_100019501
747 Ga0075436_100021017
748 Ga0075436_100022111
749 Ga0097620_100003524
750 Ga0097620_100147493
751 Ga0097620_100225852
752 Ga0075435_100021226
753 Ga0075435_100031203
754 Ga0075435_100038833
755 Ga0075435_100047179
756 Ga0075435_100109590
757 Ga0075435_100415489
758 Ga0075435_100439406
759 Ga0075435_100443138
760 Ga0099794_10012582
761 Ga0099794_10024573
762 Ga0111539_10001850
763 Ga0111539_10004531
764 Ga0111539_10010020
765 Ga0111539_10117916
766 Ga0105245_10196096
767 Ga0105245_10447421
768 Ga0105247_10253550
769 Ga0114129_10000003
770 Ga0114129_10000810
771 Ga0114129_10002160
772 Ga0114129_10008648
773 Ga0114129_10033618
774 Ga0114129_10075951
775 Ga0114129_10080870
776 Ga0114129_10096253
777 Ga0114129_10152841
778 Ga0114129_10197062
779 Ga0114129_10238454
780 Ga0114129_10262716
781 Ga0114129_10392433
782 Ga0114129_10962890
783 Ga0114129_11474398
784 Ga0105243_10112309
785 Ga0105243_10313195
786 Ga0105241_10022066
787 Ga0105241_10514433
788 Ga0105241_10971507
789 Ga0105242_10004360
790 Ga0105248_10210417
791 Ga0105249_10073694
792 Ga0105249_10261891
793 Ga0105249_10389793
794 Ga0105239_10521078
795 Ga0105246_10290853
796 Ga0105246_10333972
797 Ga0157370_10478149
798 Ga0157369_10029997
799 Ga0157378_10156762
800 Ga0157372_10002929
801 Ga0157375_10921153
802 Ga0163163_10038414
803 Ga0157380_10078805
804 Ga0207653_10007491
805 Ga0207642_10134842
806 Ga0207642_10323271
807 Ga0207688_10016944
808 Ga0207645_10003316
809 Ga0207645_10067535
810 Ga0207645_10172578
811 Ga0207643_10001985
812 Ga0207643_10081888
813 Ga0207684_10001758
814 Ga0207684_10004199
815 Ga0207684_10011536
816 Ga0207684_10017333
817 Ga0207684_10018866
818 Ga0207684_10047378
819 Ga0207684_10048877
820 Ga0207684_10058103
821 Ga0207684_10142056
822 Ga0207684_10327852
823 Ga0207684_10401527
824 Ga0207654_10025786
825 Ga0207654_10352194
826 Ga0207707_10000197
827 Ga0207693_10101834
828 Ga0207660_10000625
829 Ga0207660_10008323
830 Ga0207660_10414735
831 Ga0207660_10551810
832 Ga0207657_10000264
833 Ga0207649_10010305
834 Ga0207652_10000696
835 Ga0207646_10011830
836 Ga0207646_10012183
837 Ga0207646_10018347
838 Ga0207646_10018378
839 Ga0207646_10024326
840 Ga0207646_10030782
841 Ga0207646_10046725
842 Ga0207646_10154546
843 Ga0207646_10327846
844 Ga0207646_10390502
845 Ga0207681_10071516
846 Ga0207681_10190944
847 Ga0207687_10086992
848 Ga0207687_10244122
849 Ga0207690_10002038
850 Ga0207706_10019268
851 Ga0207686_10372954
852 Ga0207709_10345265
853 Ga0207704_10958813
854 Ga0207665_10013977
855 Ga0207711_10024169
856 Ga0207689_10000141
857 Ga0207689_10019915
858 Ga0207689_10060774
859 Ga0207689_10686548
860 Ga0207679_10001118
861 Ga0207667_10017008
862 Ga0207712_10068066
863 Ga0207712_10093505
864 Ga0207712_10117033
865 Ga0207712_10253831
866 Ga0207640_10005987
867 Ga0207640_10430744
868 Ga0207640_10461612
869 Ga0207639_10001328
870 Ga0207678_10001527
871 Ga0207708_10214354
872 Ga0207641_10014614
873 Ga0207648_10190117
874 Ga0207648_10285190
875 Ga0207674_10000412
876 Ga0207674_10198980
877 Ga0207674_10294511
878 Ga0207675_100173834
879 Ga0207698_10602618
880 Ga0209983_1000380
881 Ga0209588_1102079
882 Ga0209971_1000228
883 Ga0209966_1000098
884 Ga0209998_10000125
885 Ga0207428_10000035
886 Ga0207428_10000477
887 Ga0207428_10118988
888 Ga0207428_10226041
889 Ga0268265_10008869
890 Ga0268264_10067735
891 Ga0268264_10087711
892 Ga0268264_10358640
893 Ga0268264_10661864
894 Ga0268264_10745132
895 Ga0268264_10914845
896 Ga0307408_100065547
897 Ga0307408_100128576
898 Ga0307408_100709452
899 Ga0307408_100745982
900 Ga0307410_10125571
901 Ga0307416_100110983
902 Ga0307416_100703213
903 Ga0307411_10147356
904 Ga0307411_10158090
905 Ga0307415_100114505
906 Ga0373948_0003588
907 Ga0373948_0036021
908 Ga0373940_0034981
909 Ga0373951_0001791
910 Ga0373960_0078006
911 Ga0373961_0005263
912 Ga0373962_0057034
913 Ga0373931_0015293
914 Ga0373931_0021112
915 Ga0395900_0306755
916 Ga0439448_0002199
917 Ga0439450_016835
918 Ga0439460_0003076
919 Ga0451577_0015222
920 Ga0451577_0043040
921 Ga0451577_0068232
922 Ga0451577_0142829
923 Ga0453683_0027244
924 Ga0453683_0029642
925 Ga0453683_0207780
926 Ga0453684_0039501
927 Ga0453684_1002039
928 Ga0451576_0015447
929 Ga0451576_0035248
930 Ga0451576_0073396
931 Ga0451576_0076235
932 Ga0451576_0108740
933 Ga0451576_0192665
934 Ga0451576_0203988
935 Ga0451576_0319593
936 Ga0451576_0829803
937 Ga0451576_1119817
938 Ga0495580_0006395
939 Ga0495584_0316343
940 Ga0495659_0180039
941 Ga0496106_0469066
942 Ga0496112_0119111
943 Ga0501033_0129445
944 Ga0501036_0115011
945 Ga0501036_0368964
946 Ga0501036_0655412
947 Ga0501038_0074756
948 Ga0501040_0007825
949 Ga0501040_0024291
950 Ga0501040_0152921
951 Ga0501040_0327585
952 Ga0501040_0345800
953 Ga0501041_0011005
954 Ga0501041_0081727
955 Ga0501041_0131506
956 Ga0501041_0133618
957 Ga0501041_0322191
958 Ga0501041_0403122
959 Ga0501042_0455831
960 Ga0501042_0526828
961 Ga0501043_0340342
962 Ga0501046_0001710
963 Ga0501046_0083885
964 Ga0501048_0020083
965 Ga0501048_0105220
966 Ga0501067_0060202
967 Ga0501068_0059352
968 Ga0501069_0602160
969 Ga0501070_0774018
970 Ga0501071_0103447
971 Ga0501071_0108647
972 Ga0501071_0621370
973 Ga0501072_0152588
974 Ga0501072_0166281
975 Ga0501074_0052821
976 Ga0501074_0161367
977 Ga0501075_0012219
978 Ga0501075_0016082
979 Ga0501075_0024434
980 Ga0501075_0134547
981 Ga0501075_0186662
982 Ga0501075_0245615
983 Ga0501075_0638933
984 Ga0501076_0056284
985 Ga0501076_0109839
986 Ga0501076_0114370
987 Ga0501076_0215301
988 Ga0501076_0360461
989 Ga0501076_0680607
990 Ga0501077_0062314
991 Ga0501077_0071184
992 Ga0501077_0088672
993 Ga0501077_0507619
994 Ga0501079_0002998
995 Ga0501079_0017978
996 Ga0501079_0307408
997 Ga0501080_0318344
998 Ga0501081_0062822
999 Ga0501081_0088493
1000 Ga0501081_0118125
1001 Ga0501081_0174262
1002 Ga0501083_0022648
1003 Ga0501083_0108114
1004 Ga0501035_0513776
1005 Ga0501045_0011930
1006 Ga0501045_0037167
1007 Ga0501045_0264665
1008 Ga0501045_0484427
1009 Ga0501045_0527699
1010 nmdc:mga05p37_168835_c1
1011 nmdc:mga05p37_173452_c1
1012 nmdc:mga05p37_2009_c1
1013 nmdc:mga05p37_279_c1
1014 nmdc:mga05p37_316945_c1
1015 nmdc:mga05p37_3283_c1
1016 nmdc:mga05p37_3699_c1
1017 nmdc:mga05p37_48287_c1
1018 nmdc:mga05p37_60487_c1
1019 nmdc:mga05p37_651_c1
1020 nmdc:mga05p37_72613_c1
1021 nmdc:mga05p37_920915_c1
1022 nmdc:mga09592_10637_c1
1023 nmdc:mga09592_13695_c1
1024 nmdc:mga09592_228307_c1
1025 nmdc:mga09592_3407_c1
1026 nmdc:mga09592_4616_c1
1027 nmdc:mga09592_690290_c1
1028 nmdc:mga09592_9588_c1
1029 nmdc:mga0qj67_1277_c1
1030 nmdc:mga0qj67_152960_c1
1031 nmdc:mga0qj67_172137_c1
1032 nmdc:mga0qj67_59051_c1
1033 nmdc:mga06r32_120770_c1
1034 nmdc:mga06r32_418_c1
1035 nmdc:mga06r32_625_c1
1036 nmdc:mga06r32_7414_c1
1037 nmdc:mga06r32_76240_c1
1038 nmdc:mga06r32_95568_c1
1039 nmdc:mga08y16_226544_c1
1040 nmdc:mga08y16_32835_c1
1041 nmdc:mga08y16_589_c1
1042 nmdc:mga0n895_117681_c1
1043 nmdc:mga0n895_1217_c1
1044 nmdc:mga0n895_15197_c1
1045 nmdc:mga0n895_20473_c1
1046 nmdc:mga0n895_220098_c1
1047 nmdc:mga0n895_269100_c1
1048 nmdc:mga0n895_2708_c1
1049 nmdc:mga0n895_280773_c1
1050 nmdc:mga0n895_438441_c1
1051 nmdc:mga0n895_450876_c1
1052 nmdc:mga0n895_4572_c1
1053 nmdc:mga0rr50_111126_c1
1054 nmdc:mga0rr50_146849_c1
1055 nmdc:mga0rr50_156611_c1
1056 nmdc:mga0rr50_242875_c1
1057 nmdc:mga0rr50_271868_c1
1058 nmdc:mga0rr50_32046_c1
1059 nmdc:mga0rr50_446247_c1
1060 nmdc:mga0rr50_4868_c1
1061 nmdc:mga0rr50_63515_c1
1062 nmdc:mga08x19_17618_c1
1063 nmdc:mga08x19_248188_c1
1064 nmdc:mga08x19_48558_c1
1065 nmdc:mga0a205_103704_c1
1066 nmdc:mga0a205_1075_c1
1067 nmdc:mga0a205_119505_c1
1068 nmdc:mga0a205_1325_c1
1069 nmdc:mga0a205_136862_c1
1070 nmdc:mga0a205_2696_c1
1071 nmdc:mga0a205_2958_c1
1072 nmdc:mga0a205_339531_c1
1073 nmdc:mga0a205_373_c1
1074 nmdc:mga0a205_425390_c1
1075 nmdc:mga0a205_473272_c1
1076 nmdc:mga0a205_541_c1
1077 Ga0501084_0012350
1078 Ga0501084_0037630
1079 Ga0501084_0046276
1080 Ga0501084_0168993
1081 Ga0501084_0392725
1082 Ga0501082_0020643
1083 Ga0501082_0038052
1084 Ga0501082_0043750
1085 Ga0501082_0167732
1086 Ga0501082_0293554
1087 Ga0530510_0097549
1088 Ga0530510_0107660
1089 Ga0530510_0234521
1090 Ga0530510_0358696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

43

223

0.94

PF13242

Hydrolase_like

HAD-hyrolase-like

177

245

0.88

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

40

217

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mu1-assembly1.cif.gz_A nmr structure of the core domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4 0.8487 91 185
2pr7-assembly2.cif.gz_B crystal structure of uncharacterized protein (np_599989.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.44 a resolution 0.8287 93 187
2obb-assembly1.cif.gz_A-2 structure of the conserved protein coded by locus bt_0820 from bacteroides thetaiotaomicron 0.8045 87 133
2fi1-assembly1.cif.gz_A the crystal structure of a hydrolase from streptococcus pneumoniae tigr4 0.799 3 183
1k1e-assembly1.cif.gz_A structure of the cobalt-bound form of the deoxy-d-mannose-octulosonate 8-phosphate phosphatase (yrbi) from haemophilus influenzae (hi1679) 0.7646 5 206
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9668 90 187 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9561 99 211 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9479 99 211 3.40.50.1000
af_Q60DU2_197_332_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9408 89 212 3.40.50.1000
1z4nB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9389 106 186 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V6W5J0-F1-model_v4 Uncharacterized protein 0.9799 1 211 GO:0008757
GO:0032259
GO:0050308
AF-A0A2V6W5J0-F1-model_v4 Uncharacterized protein 0.9619 1 211 GO:0008757
GO:0032259
GO:0050308
AF-A0A847N6G8-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.8696 5 208 GO:0005886
GO:0008961
GO:0042158
AF-A0A847N6G8-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.8288 5 208 GO:0005886
GO:0008961
GO:0042158
AF-A0A395D1Z3-F1-model_v4 HAD family phosphatase 0.8073 2 208 GO:0003824

Map