F461730

General Info

Members Datasets Scaffolds Average Seq Length
544 265 391 372

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10001681|Ga0157373_100016818
Length 417
Sequence VSRKTGALLTEVKKDNRIHGVNVLILVYLSGQNFVSPHRVKDVAMKSGRYIGVMSGTSLDGVDVVLAAIDGRMVAQQASYSHPMPIQLKQDILGMCQGQQTTLAAVGRLDAQLGTLFGEAVLGLLKQTGVSAQDITAIGCHGQTVWHEPEGDARFSMQLGDNNRIAALTNITTVGDFRRRDMAYGGQGAPLVPAFHQALLAHPVERRMVLNIGGIANLSMLLPGAPVRGFDTGPGNMLMDAWVWRHRSQPYDKDGAWAMEGRVCLPLLQQMLADPYFALPAPKSTGREYFNAAWLERQLTGLPAVKPVDVQTTLAELTAITICEQVQLAGGCERLLVCGGGARNPLLMARMSALLPGTEVCLTDDFGISGDDMEALAFAWLAFRTLSGQPGNLPSVTGASRETLLGGIYPVLPLGGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
10 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
11 2561511199 Enterobacter sp. R4-368 Isolate Nodule
12 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
13 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
14 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
15 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
16 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
17 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
18 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
19 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
20 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
21 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
22 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
23 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
24 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
25 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
26 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
27 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
28 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
29 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
30 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
31 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
32 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
33 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
34 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
35 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
36 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
37 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
38 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
39 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
40 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
41 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
42 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
43 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
44 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
45 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
46 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
47 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
48 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
49 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
50 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
51 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
52 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
53 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
54 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
55 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
56 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
57 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
58 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
59 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
60 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
61 2636415599 Klebsiella variicola DX120E Isolate Unclassified
62 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
63 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
64 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
65 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
66 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
67 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
68 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
69 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
70 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
71 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
72 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
73 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
74 2751185917 Enterobacter sp. HK169 Isolate Unclassified
75 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
76 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
77 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
78 2775507074 Klebsiella sp. D5A Isolate Unclassified
79 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
80 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
81 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
82 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
83 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
84 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
85 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
86 2821118458 Enterobacter asburiae 609 Isolate Unclassified
87 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
88 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
89 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
90 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
91 2847085930 Erwinia persicina B64 Isolate Bulb
92 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
93 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
94 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
95 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
96 2865014394 Pantoea sp. R-71966 Isolate Unclassified
97 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
98 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
99 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
100 2876601092 Pantoea endophytica 596 Isolate Unclassified
101 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
102 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
103 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
104 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
105 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
106 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
107 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
108 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
109 2904504865 Serratia marcescens 1822 Isolate Unclassified
110 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
111 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
112 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
113 2919150387 Rahnella aceris 1817 Isolate Unclassified
114 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
115 2927143783 Rahnella sp. 2050 Isolate Unclassified
116 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
117 2932406140 Serratia sp. 2723 Isolate Rhizosphere
118 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
119 2937539931 Pantoea sp. LS15 Isolate Unclassified
120 2937967321 Serratia sp. YC16 Isolate Unclassified
121 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
122 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
123 2939577877 Serratia sp. 509 Isolate Rhizosphere
124 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
125 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
126 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
127 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
128 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
129 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
130 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
131 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
132 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
133 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
134 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
135 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
136 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
137 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
138 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
139 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
140 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
141 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
142 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
143 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
144 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
145 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
146 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
147 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
148 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
149 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
150 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
151 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
152 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
153 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
154 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
155 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
156 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
157 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
158 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
159 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
160 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
161 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
162 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
173 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
174 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
175 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
178 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
187 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
200 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
203 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
204 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
205 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
208 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
251 640753048 Serratia proteamaculans 568 Isolate Endosphere
252 8004592986 Serratia sp. S119 Isolate Unclassified
253 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
254 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
255 8018221730 Enterobacter sp. CM29 Isolate Unclassified
256 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
257 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
258 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
259 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
260 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
261 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
262 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
263 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
264 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
265 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.88
Metatranscriptomes 0
Isolates 28.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0.18
Endosphere 4.96
Nodule 3.49
Rhizoplane 12.68
Rhizosphere 47.98
Stem 0.18
Stem Tuber 0.92
Unclassified 28.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3160806 2162886007 Bacteria 2571
2 JGI24739J22299_10002717 3300001989 Bacteria 6810
3 JGI25162J39368_1000112 3300002737 Bacteria 89231
4 JGI25163J39215_1000184 3300002771 Bacteria 24136
5 JGI25164J39214_1000094 3300002772 Bacteria 89231
6 JGI25152J39213_1000258 3300002773 Bacteria 35248
7 rootH2_10017443 3300003320 Bacteria 26333
8 Ga0055538_1000076 3300003751 Bacteria 89231
9 Ga0055539_1000115 3300003752 Bacteria 89231
10 Ga0055533_1000121 3300003756 Bacteria 89231
11 Ga0055525_1000159 3300003759 Bacteria 89231
12 Ga0055541_1000077 3300003841 Bacteria 89231
13 Ga0058692_1000066 3300003856 Bacteria 89302
14 Ga0058692_1000072 3300003856 Bacteria 77728
15 Ga0058692_1000173 3300003856 Bacteria 39993
16 Ga0058692_1000292 3300003856 Bacteria 25686
17 Ga0058692_1000344 3300003856 Bacteria 22672
18 Ga0058692_1003174 3300003856 Bacteria 5186
19 Ga0058692_1003176 3300003856 Bacteria 5186
20 Ga0058692_1010319 3300003856 Bacteria 2311
21 Ga0058692_1014444 3300003856 Bacteria 1808
22 Ga0058692_1016084 3300003856 Bacteria 1672
23 Ga0065704_10000042 3300005289 Bacteria 15626
24 Ga0065704_10000297 3300005289 Bacteria 43486
25 Ga0065704_10001850 3300005289 Bacteria 11098
26 Ga0065704_10008915 3300005289 Bacteria 3298
27 Ga0065704_10009839 3300005289 Bacteria 2902
28 Ga0070659_100024079 3300005366 Bacteria 4665
29 Ga0070665_100002066 3300005548 Bacteria 22531
30 Ga0075364_10008538 3300006051 Bacteria 6125
31 Ga0075364_10048050 3300006051 Bacteria 2780
32 Ga0075364_10093837 3300006051 Bacteria 1993
33 Ga0079104_1000083 3300006946 Bacteria 137254
34 Ga0079104_1000218 3300006946 Bacteria 80243
35 Ga0079104_1000263 3300006946 Bacteria 69767
36 Ga0079104_1000925 3300006946 Bacteria 23508
37 Ga0079104_1001285 3300006946 Bacteria 17353
38 Ga0079104_1005177 3300006946 Bacteria 5294
39 Ga0079104_1006575 3300006946 Bacteria 4363
40 Ga0079104_1009786 3300006946 Bacteria 3220
41 Ga0105251_10000189 3300009011 Bacteria 62590
42 Ga0105251_10000304 3300009011 Bacteria 49243
43 Ga0105251_10000668 3300009011 Bacteria 31643
44 Ga0105251_10001304 3300009011 Bacteria 21542
45 Ga0105251_10001620 3300009011 Bacteria 19103
46 Ga0105251_10011396 3300009011 Bacteria 5081
47 Ga0105251_10029687 3300009011 Bacteria 2752
48 Ga0105244_10000014 3300009036 Bacteria 257018
49 Ga0105244_10000015 3300009036 Bacteria 256814
50 Ga0105244_10000070 3300009036 Bacteria 119389
51 Ga0105244_10000104 3300009036 Bacteria 86815
52 Ga0105244_10000515 3300009036 Bacteria 34521
53 Ga0105244_10000554 3300009036 Bacteria 33368
54 Ga0105244_10000645 3300009036 Bacteria 30769
55 Ga0105244_10002973 3300009036 Bacteria 12479
56 Ga0105244_10010464 3300009036 Bacteria 5624
57 Ga0105244_10011389 3300009036 Bacteria 5338
58 Ga0105244_10021225 3300009036 Bacteria 3597
59 Ga0105244_10029313 3300009036 Bacteria 2943
60 Ga0105244_10032254 3300009036 Bacteria 2774
61 Ga0105244_10048708 3300009036 Bacteria 2168
62 Ga0105250_10000001 3300009092 Bacteria 617357
63 Ga0105250_10000113 3300009092 Bacteria 72385
64 Ga0105250_10000488 3300009092 Bacteria 27848
65 Ga0105250_10000525 3300009092 Bacteria 26718
66 Ga0105250_10001565 3300009092 Bacteria 12295
67 Ga0105250_10001871 3300009092 Bacteria 10954
68 Ga0105250_10003334 3300009092 Bacteria 7639
69 Ga0105250_10014373 3300009092 Bacteria 3255
70 Ga0105250_10038072 3300009092 Bacteria 1929
71 Ga0105250_10049794 3300009092 Bacteria 1681
72 Ga0105247_10000129 3300009101 Bacteria 73190
73 Ga0105243_10162701 3300009148 Bacteria 1926
74 Ga0105241_10000002 3300009174 Bacteria 869480
75 Ga0105246_10151482 3300011119 Bacteria 1756
76 Ga0157373_10001681 3300013100 Bacteria 16886
77 Ga0157373_10013699 3300013100 Bacteria 5945
78 Ga0157371_10000099 3300013102 Bacteria 133829
79 Ga0157371_10001487 3300013102 Bacteria 24257
80 Ga0157371_10001890 3300013102 Bacteria 20943
81 Ga0157371_10005293 3300013102 Bacteria 10934
82 Ga0157371_10026711 3300013102 Bacteria 4193
83 Ga0157371_10055125 3300013102 Bacteria 2821
84 Ga0157371_10102939 3300013102 Bacteria 2026
85 Ga0157370_10000064 3300013104 Bacteria 114340
86 Ga0157370_10004588 3300013104 Bacteria 15811
87 Ga0157370_10005907 3300013104 Bacteria 13646
88 Ga0157369_10121270 3300013105 Bacteria 2774
89 Ga0163162_10026698 3300013306 Bacteria 5709
90 Ga0157372_10013969 3300013307 Bacteria 8580
91 Ga0157372_10014219 3300013307 Bacteria 8506
92 Ga0157372_10097819 3300013307 Bacteria 3348
93 Ga0157372_10141258 3300013307 Bacteria 2774
94 Ga0157372_10162609 3300013307 Bacteria 2580
95 Ga0182008_10004913 3300014497 Bacteria 7710
96 Ga0182006_1000047 3300015261 Bacteria 187006
97 Ga0183366_1001 3300015679 Bacteria 2743932
98 Ga0183370_1001 3300015680 Bacteria 2743932
99 Ga0183369_1001 3300015685 Bacteria 2743932
100 Ga0183368_1001 3300015687 Bacteria 2743932
101 Ga0163161_10000001 3300017792 Bacteria 2041488
102 Ga0213876_10000055 3300021384 Bacteria 136037
103 Ga0209760_100222 3300025207 Bacteria 24749
104 Ga0209784_100001 3300025224 Bacteria 3600592
105 Ga0209566_100001 3300025225 Bacteria 3600765
106 Ga0209674_100002 3300025226 Bacteria 3600592
107 Ga0209563_100008 3300025230 Bacteria 1554545
108 Ga0207427_100135 3300025231 Bacteria 89851
109 Ga0209437_100007 3300025233 Bacteria 938377
110 Ga0209437_100109 3300025233 Bacteria 217031
111 Ga0209437_100111 3300025233 Bacteria 214944
112 Ga0209677_100004 3300025253 Bacteria 1554545
113 Ga0209129_1000004 3300025258 Bacteria 884499
114 Ga0207696_1000001 3300025711 Bacteria 2579611
115 Ga0207696_1000005 3300025711 Bacteria 642078
116 Ga0207696_1000028 3300025711 Bacteria 400424
117 Ga0207696_1000086 3300025711 Bacteria 194626
118 Ga0207696_1000218 3300025711 Bacteria 83242
119 Ga0207696_1000235 3300025711 Bacteria 77526
120 Ga0207696_1000793 3300025711 Bacteria 20640
121 Ga0207655_1000001 3300025728 Bacteria 1866413
122 Ga0207655_1000009 3300025728 Bacteria 664676
123 Ga0207655_1000037 3300025728 Bacteria 354473
124 Ga0207655_1000061 3300025728 Bacteria 258893
125 Ga0207655_1000063 3300025728 Bacteria 257028
126 Ga0207655_1000069 3300025728 Bacteria 239968
127 Ga0207655_1000168 3300025728 Bacteria 119343
128 Ga0207655_1000587 3300025728 Bacteria 44910
129 Ga0207655_1002283 3300025728 Bacteria 15784
130 Ga0207655_1008892 3300025728 Bacteria 6312
131 Ga0207655_1012205 3300025728 Bacteria 5043
132 Ga0207655_1030063 3300025728 Bacteria 2533
133 Ga0207713_1000001 3300025735 Bacteria 2295391
134 Ga0207713_1000002 3300025735 Bacteria 1061749
135 Ga0207713_1000003 3300025735 Bacteria 860698
136 Ga0207713_1000008 3300025735 Bacteria 553952
137 Ga0207713_1000016 3300025735 Bacteria 421689
138 Ga0207713_1000029 3300025735 Bacteria 285054
139 Ga0207713_1004844 3300025735 Bacteria 8629
140 Ga0207713_1012790 3300025735 Bacteria 4462
141 Ga0207713_1013309 3300025735 Bacteria 4343
142 Ga0207710_10000113 3300025900 Bacteria 102300
143 Ga0207654_10000005 3300025911 Bacteria 869492
144 Ga0209281_1000001 3300027111 Bacteria 1933496
145 Ga0209281_1000003 3300027111 Bacteria 1260089
146 Ga0209281_1000006 3300027111 Bacteria 1170244
147 Ga0209281_1000130 3300027111 Bacteria 191756
148 Ga0209281_1000287 3300027111 Bacteria 93918
149 Ga0209281_1000414 3300027111 Bacteria 64365
150 Ga0209281_1000860 3300027111 Bacteria 26579
151 Ga0209281_1000868 3300027111 Bacteria 26280
152 Ga0209281_1000941 3300027111 Bacteria 23789
153 Ga0209281_1001677 3300027111 Bacteria 11634
154 Ga0209371_1000001 3300027312 Bacteria 2771503
155 Ga0209371_1000002 3300027312 Bacteria 1551985
156 Ga0209371_1000005 3300027312 Bacteria 1061740
157 Ga0209371_1000041 3300027312 Bacteria 340377
158 Ga0209371_1000109 3300027312 Bacteria 141217
159 Ga0209371_1000124 3300027312 Bacteria 131108
160 Ga0209371_1000183 3300027312 Bacteria 91570
161 Ga0209371_1000212 3300027312 Bacteria 80989
162 Ga0209371_1000541 3300027312 Bacteria 35521
163 Ga0209371_1001707 3300027312 Bacteria 13914
164 Ga0209371_1001737 3300027312 Bacteria 13727
165 Ga0209371_1002878 3300027312 Bacteria 9051
166 Ga0209371_1004220 3300027312 Bacteria 6393
167 Ga0209371_1004232 3300027312 Bacteria 6378
168 Ga0209371_1005240 3300027312 Bacteria 5236
169 Ga0209371_1014012 3300027312 Bacteria 2219
170 Ga0209371_1019660 3300027312 Bacteria 1679
171 Ga0268266_10000693 3300028379 Bacteria 45369
172 Ga0268256_1000001 3300030500 Bacteria 2771065
173 Ga0268256_1000002 3300030500 Bacteria 1535763
174 Ga0268256_1000003 3300030500 Bacteria 1289401
175 Ga0268256_1000006 3300030500 Bacteria 1063991
176 Ga0268256_1000155 3300030500 Bacteria 91570
177 Ga0268256_1000186 3300030500 Bacteria 73618
178 Ga0268256_1000443 3300030500 Bacteria 36613
179 Ga0268256_1001515 3300030500 Bacteria 13727
180 Ga0268256_1003364 3300030500 Bacteria 7259
181 Ga0268256_1003440 3300030500 Bacteria 7125
182 Ga0268256_1003967 3300030500 Bacteria 6378
183 Ga0268256_1005104 3300030500 Bacteria 5236
184 Ga0268256_1014263 3300030500 Bacteria 2369
185 Ga0268256_1014549 3300030500 Bacteria 2329
186 Ga0268256_1015516 3300030500 Bacteria 2219
187 Ga0268256_1019833 3300030500 Bacteria 1828
188 Ga0268256_1026800 3300030500 Bacteria 1443
189 Ga0265331_10003137 3300031250 Bacteria 10796
190 Ga0265327_10011810 3300031251 Bacteria 5969
191 Ga0436365_0971002 3300039437 Bacteria 167792
192 Ga0439438_000001 3300041405 Bacteria 1263568
193 Ga0439438_001274 3300041405 Bacteria 11141
194 Ga0439438_004211 3300041405 Bacteria 5590
195 Ga0439438_006900 3300041405 Bacteria 3951
196 Ga0439438_018484 3300041405 Bacteria 1984
197 Ga0439447_000890 3300041407 Bacteria 10903
198 Ga0439447_003130 3300041407 Bacteria 5899
199 Ga0439466_0000695 3300041411 Bacteria 12693
200 Ga0439452_000001 3300042010 Bacteria 1725439
201 Ga0439452_000002 3300042010 Bacteria 1377577
202 Ga0439452_000028 3300042010 Bacteria 204513
203 Ga0439452_000194 3300042010 Bacteria 44729
204 Ga0439452_000469 3300042010 Bacteria 22652
205 Ga0439452_003118 3300042010 Bacteria 5878
206 Ga0439452_012521 3300042010 Bacteria 2409
207 Ga0450907_000712 3300042146 Bacteria 8562
208 Ga0450893_0007163 3300042532 Bacteria 1811
209 Ga0466981_0000002 3300044669 Bacteria 313036
210 Ga0453684_0003292 3300044712 Bacteria 36816
211 Ga0495627_000116 3300046453 Bacteria 99916
212 Ga0495591_000013 3300046458 Bacteria 268106
213 Ga0495591_000100 3300046458 Bacteria 99473
214 Ga0495591_001400 3300046458 Bacteria 15064
215 Ga0495591_022375 3300046458 Bacteria 2044
216 Ga0495638_0003609 3300046460 Bacteria 12095
217 Ga0495650_0000005 3300046471 Bacteria 766553
218 Ga0495650_0000090 3300046471 Bacteria 232897
219 Ga0495650_0000187 3300046471 Bacteria 136554
220 Ga0495650_0010967 3300046471 Bacteria 5013
221 Ga0495585_0018289 3300046492 Bacteria 4045
222 Ga0495607_0013078 3300046501 Bacteria 5453
223 Ga0495606_0006908 3300046507 Bacteria 10330
224 Ga0495620_0006666 3300046515 Bacteria 6327
225 Ga0495648_0002454 3300046524 Bacteria 17090
226 Ga0495648_0006206 3300046524 Bacteria 9786
227 Ga0495654_0000041 3300046530 Bacteria 174733
228 Ga0495654_0000149 3300046530 Bacteria 72677
229 Ga0495654_0000167 3300046530 Bacteria 64853
230 Ga0495654_0015153 3300046530 Bacteria 4097
231 Ga0495654_0018937 3300046530 Bacteria 3602
232 Ga0495597_0000396 3300046542 Bacteria 37594
233 Ga0495668_0042608 3300046616 Bacteria 2527
234 Ga0495625_0009960 3300046660 Bacteria 7906
235 Ga0495588_0044709 3300046674 Bacteria 2269
236 Ga0495671_0001753 3300046692 Bacteria 14056
237 Ga0495671_0052074 3300046692 Bacteria 2035
238 Ga0495649_0020635 3300046694 Bacteria 3693
239 Ga0495649_0020754 3300046694 Bacteria 3681
240 Ga0495589_0000004 3300046794 Bacteria 439891
241 Ga0495660_0000028 3300046810 Bacteria 244534
242 Ga0495660_0000171 3300046810 Bacteria 70062
243 Ga0495660_0008965 3300046810 Bacteria 5844
244 Ga0495672_0000002 3300047320 Bacteria 740116
245 Ga0495672_0000034 3300047320 Bacteria 290832
246 Ga0495672_0000043 3300047320 Bacteria 266893
247 Ga0495683_0027453 3300047323 Bacteria 2910
248 Ga0495679_000005 3300047446 Bacteria 455007
249 Ga0495679_001314 3300047446 Bacteria 14461
250 Ga0495679_001408 3300047446 Bacteria 13719
251 Ga0495679_038456 3300047446 Bacteria 1498
252 Ga0495673_0000070 3300047469 Bacteria 217453
253 Ga0495673_0000167 3300047469 Bacteria 111793
254 Ga0495681_0054635 3300047470 Bacteria 1865
255 Ga0496100_0014836 3300048903 Bacteria 4534
256 Ga0496100_0017782 3300048903 Bacteria 4205
257 Ga0496101_0000055 3300048904 Bacteria 136176
258 Ga0496101_0084422 3300048904 Bacteria 2352
259 Ga0496102_0023928 3300048905 Bacteria 5429
260 Ga0496102_0192450 3300048905 Bacteria 1922
261 Ga0496104_0000628 3300048907 Bacteria 30236
262 Ga0496104_0002108 3300048907 Bacteria 17269
263 Ga0496105_0008102 3300048908 Bacteria 8170
264 Ga0496105_0009054 3300048908 Bacteria 7767
265 Ga0496105_0057842 3300048908 Bacteria 3201
266 Ga0496105_0065308 3300048908 Bacteria 3004
267 Ga0496105_0292299 3300048908 Bacteria 1311
268 Ga0496110_0328437 3300048913 Bacteria 1393
269 Ga0496116_0000001 3300048919 Bacteria 1501681
270 Ga0496116_0000122 3300048919 Bacteria 162802
271 Ga0496116_0000277 3300048919 Bacteria 89271
272 Ga0496116_0000359 3300048919 Bacteria 71572
273 Ga0496116_0001757 3300048919 Bacteria 23624
274 Ga0496116_0003767 3300048919 Bacteria 14821
275 Ga0496116_0007850 3300048919 Bacteria 9367
276 Ga0496116_0036306 3300048919 Bacteria 3450
277 Ga0496116_0064903 3300048919 Bacteria 2344
278 Ga0496116_0071313 3300048919 Bacteria 2200
279 Ga0496116_0125314 3300048919 Bacteria 1477
280 Ga0496116_0132678 3300048919 Bacteria 1416
281 Ga0496117_0000004 3300048920 Bacteria 877131
282 Ga0496117_0000020 3300048920 Bacteria 458405
283 Ga0496117_0000165 3300048920 Bacteria 139029
284 Ga0496117_0001710 3300048920 Bacteria 30447
285 Ga0496117_0004944 3300048920 Bacteria 14318
286 Ga0496117_0022509 3300048920 Bacteria 5052
287 Ga0496117_0024271 3300048920 Bacteria 4801
288 Ga0496117_0080592 3300048920 Bacteria 2140
289 Ga0496117_0102401 3300048920 Bacteria 1807
290 Ga0496118_0000007 3300048921 Bacteria 650986
291 Ga0496118_0000015 3300048921 Bacteria 551359
292 Ga0496118_0000085 3300048921 Bacteria 179731
293 Ga0496118_0002031 3300048921 Bacteria 28622
294 Ga0496118_0002336 3300048921 Bacteria 25723
295 Ga0496118_0006080 3300048921 Bacteria 13430
296 Ga0496118_0007395 3300048921 Bacteria 11659
297 Ga0496118_0009827 3300048921 Bacteria 9577
298 Ga0496118_0013734 3300048921 Bacteria 7639
299 Ga0496118_0072675 3300048921 Bacteria 2469
300 Ga0496119_0000001 3300048922 Bacteria 789520
301 Ga0496119_0000015 3300048922 Bacteria 312979
302 Ga0496119_0000095 3300048922 Bacteria 129683
303 Ga0496119_0000911 3300048922 Bacteria 38310
304 Ga0496119_0001393 3300048922 Bacteria 29345
305 Ga0496119_0002851 3300048922 Bacteria 18458
306 Ga0496119_0003075 3300048922 Bacteria 17619
307 Ga0496119_0004132 3300048922 Bacteria 14619
308 Ga0496119_0015764 3300048922 Bacteria 5793
309 Ga0496119_0020234 3300048922 Bacteria 4862
310 Ga0496119_0040427 3300048922 Bacteria 2982
311 Ga0496119_0047296 3300048922 Bacteria 2678
312 Ga0496119_0049164 3300048922 Bacteria 2609
313 Ga0496119_0063657 3300048922 Bacteria 2192
314 Ga0496119_0149602 3300048922 Bacteria 1252
315 Ga0496120_0000076 3300048923 Bacteria 163121
316 Ga0496120_0000464 3300048923 Bacteria 63910
317 Ga0496120_0000654 3300048923 Bacteria 50909
318 Ga0496120_0000807 3300048923 Bacteria 45013
319 Ga0496120_0000967 3300048923 Bacteria 39152
320 Ga0496120_0000983 3300048923 Bacteria 38789
321 Ga0496120_0001139 3300048923 Bacteria 34311
322 Ga0496120_0009624 3300048923 Bacteria 6827
323 Ga0496120_0012602 3300048923 Bacteria 5743
324 Ga0496120_0026533 3300048923 Bacteria 3575
325 Ga0496120_0079319 3300048923 Bacteria 1782
326 Ga0496121_0002598 3300048924 Bacteria 27275
327 Ga0496121_0004182 3300048924 Bacteria 19708
328 Ga0496121_0005490 3300048924 Bacteria 16237
329 Ga0496121_0009588 3300048924 Bacteria 11092
330 Ga0496121_0028346 3300048924 Bacteria 5214
331 Ga0496121_0029275 3300048924 Bacteria 5099
332 Ga0496121_0032602 3300048924 Bacteria 4732
333 Ga0496121_0037635 3300048924 Bacteria 4294
334 Ga0496121_0157260 3300048924 Bacteria 1666
335 Ga0496122_0000005 3300048925 Bacteria 630659
336 Ga0496122_0000058 3300048925 Bacteria 248805
337 Ga0496122_0000655 3300048925 Bacteria 69852
338 Ga0496122_0000738 3300048925 Bacteria 63772
339 Ga0496122_0005034 3300048925 Bacteria 15989
340 Ga0496122_0010548 3300048925 Bacteria 9497
341 Ga0496122_0018705 3300048925 Bacteria 6379
342 Ga0496122_0067428 3300048925 Bacteria 2577
343 Ga0496122_0073848 3300048925 Bacteria 2415
344 Ga0496122_0137335 3300048925 Bacteria 1537
345 Ga0496123_0000008 3300048926 Bacteria 630628
346 Ga0496123_0000044 3300048926 Bacteria 253396
347 Ga0496123_0000189 3300048926 Bacteria 124719
348 Ga0496123_0000788 3300048926 Bacteria 51218
349 Ga0496123_0001541 3300048926 Bacteria 31819
350 Ga0496123_0004639 3300048926 Bacteria 14281
351 Ga0496123_0004842 3300048926 Bacteria 13867
352 Ga0496123_0011745 3300048926 Bacteria 7548
353 Ga0496123_0021861 3300048926 Bacteria 4955
354 Ga0496123_0076093 3300048926 Bacteria 2068
355 Ga0496123_0077476 3300048926 Bacteria 2041
356 Ga0496123_0159087 3300048926 Bacteria 1206
357 Ga0496124_0000105 3300048927 Bacteria 176783
358 Ga0496124_0000107 3300048927 Bacteria 168020
359 Ga0496124_0000196 3300048927 Bacteria 119375
360 Ga0496124_0001404 3300048927 Bacteria 35955
361 Ga0496124_0001838 3300048927 Bacteria 29295
362 Ga0496124_0002633 3300048927 Bacteria 23074
363 Ga0496124_0003500 3300048927 Bacteria 19129
364 Ga0496124_0003636 3300048927 Bacteria 18712
365 Ga0496124_0014356 3300048927 Bacteria 7662
366 Ga0496124_0018556 3300048927 Bacteria 6511
367 Ga0496124_0048093 3300048927 Bacteria 3647
368 Ga0496124_0058534 3300048927 Bacteria 3239
369 Ga0496124_0073007 3300048927 Bacteria 2840
370 Ga0496124_0088814 3300048927 Bacteria 2525
371 Ga0496125_0000009 3300048928 Bacteria 677678
372 Ga0496125_0000103 3300048928 Bacteria 201675
373 Ga0496125_0002818 3300048928 Bacteria 21942
374 Ga0496125_0008263 3300048928 Bacteria 10927
375 Ga0496125_0018863 3300048928 Bacteria 6530
376 Ga0496125_0040253 3300048928 Bacteria 4011
377 Ga0496125_0061361 3300048928 Bacteria 3015
378 Ga0496126_0000399 3300048929 Bacteria 89026
379 Ga0496126_0001084 3300048929 Bacteria 45796
380 Ga0496126_0003320 3300048929 Bacteria 20471
381 Ga0496126_0037122 3300048929 Bacteria 4549
382 Ga0496126_0042902 3300048929 Bacteria 4175
383 Ga0496126_0098650 3300048929 Bacteria 2559
384 Ga0496126_0119918 3300048929 Bacteria 2282
385 Ga0496126_0161900 3300048929 Bacteria 1911
386 Ga0496126_0180222 3300048929 Bacteria 1795
387 Ga0495678_000591 3300049459 Bacteria 34139
388 Ga0495682_0000001 3300049460 Bacteria 1559116
389 nmdc:mga00v17_6595_c1 3300050491 Bacteria 6164
390 nmdc:mga00v17_77376_c1 3300050491 Bacteria 2071
391 Ga0500621_000003 3300053126 Bacteria 596975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10000055 Ga0213876_1000005578 340
2 3300044712 Ga0453684_0003292 Ga0453684_0003292_2820_3887 345
3 3300048922 Ga0496119_0063657 Ga0496119_0063657_1142_2182 346
4 3300048929 Ga0496126_0119918 Ga0496126_0119918_11_1051 346
5 iso_pu_bacteria 2978975091 2978975640 351
6 3300031250 Ga0265331_10003137 Ga0265331_100031372 353
7 3300013102 Ga0157371_10000099 Ga0157371_1000009985 355
8 3300048919 Ga0496116_0125314 Ga0496116_0125314_19_1086 355
9 iso_pu_bacteria 2887630918 2887632549 357
10 3300048920 Ga0496117_0102401 Ga0496117_0102401_51_1178 358
11 3300048921 Ga0496118_0002031 Ga0496118_0002031_1358_2557 358
12 3300046530 Ga0495654_0000149 Ga0495654_0000149_48753_49847 359
13 3300046794 Ga0495589_0000004 Ga0495589_0000004_8113_9207 359
14 3300003856 Ga0058692_1000292 Ga0058692_100029229 362
15 3300027312 Ga0209371_1000212 Ga0209371_100021229 362
16 3300030500 Ga0268256_1003364 Ga0268256_10033642 362
17 3300031251 Ga0265327_10011810 Ga0265327_100118103 362
18 3300015261 Ga0182006_1000047 Ga0182006_100004760 363
19 3300039437 Ga0436365_0971002 Ga0436365_0971002_86131_87255 363
20 3300048925 Ga0496122_0000738 Ga0496122_0000738_1672_2796 363
21 3300048926 Ga0496123_0000189 Ga0496123_0000189_27985_29109 363
22 3300009011 Ga0105251_10000668 Ga0105251_100006685 364
23 3300009036 Ga0105244_10000104 Ga0105244_1000010471 364
24 3300009036 Ga0105244_10000645 Ga0105244_1000064522 364
25 3300009092 Ga0105250_10014373 Ga0105250_100143734 364
26 3300009101 Ga0105247_10000129 Ga0105247_1000012953 364
27 3300013307 Ga0157372_10013969 Ga0157372_100139692 364
28 3300041405 Ga0439438_004211 Ga0439438_004211_321_1415 364
29 3300041405 Ga0439438_006900 Ga0439438_006900_1000_2133 364
30 3300041405 Ga0439438_018484 Ga0439438_018484_804_1898 364
31 3300041407 Ga0439447_000890 Ga0439447_000890_4945_6039 364
32 3300041411 Ga0439466_0000695 Ga0439466_0000695_2567_3661 364
33 3300042010 Ga0439452_000002 Ga0439452_000002_1249627_1250760 364
34 3300042010 Ga0439452_012521 Ga0439452_012521_31_1125 364
35 3300042146 Ga0450907_000712 Ga0450907_000712_5272_6366 364
36 3300046453 Ga0495627_000116 Ga0495627_000116_40364_41458 364
37 3300046458 Ga0495591_022375 Ga0495591_022375_503_1597 364
38 3300046471 Ga0495650_0000187 Ga0495650_0000187_17811_18905 364
39 3300046501 Ga0495607_0013078 Ga0495607_0013078_4336_5430 364
40 3300046524 Ga0495648_0002454 Ga0495648_0002454_2128_3222 364
41 3300046810 Ga0495660_0008965 Ga0495660_0008965_3511_4605 364
42 3300047320 Ga0495672_0000002 Ga0495672_0000002_556601_557695 364
43 3300047320 Ga0495672_0000043 Ga0495672_0000043_81172_82266 364
44 3300047323 Ga0495683_0027453 Ga0495683_0027453_1416_2510 364
45 3300047446 Ga0495679_001314 Ga0495679_001314_7694_8788 364
46 3300048908 Ga0496105_0009054 Ga0496105_0009054_147_1241 364
47 3300048919 Ga0496116_0000001 Ga0496116_0000001_472318_473412 364
48 3300048919 Ga0496116_0003767 Ga0496116_0003767_12437_13531 364
49 3300048920 Ga0496117_0000165 Ga0496117_0000165_130676_131770 364
50 3300048921 Ga0496118_0000085 Ga0496118_0000085_21826_22920 364
51 3300048921 Ga0496118_0002336 Ga0496118_0002336_8428_9522 364
52 3300048922 Ga0496119_0000015 Ga0496119_0000015_292283_293377 364
53 3300048922 Ga0496119_0000095 Ga0496119_0000095_23671_24765 364
54 3300048922 Ga0496119_0001393 Ga0496119_0001393_15277_16371 364
55 3300048922 Ga0496119_0020234 Ga0496119_0020234_2437_3531 364
56 3300048922 Ga0496119_0047296 Ga0496119_0047296_637_1731 364
57 3300048923 Ga0496120_0000464 Ga0496120_0000464_20793_21887 364
58 3300048923 Ga0496120_0000967 Ga0496120_0000967_23048_24142 364
59 3300048927 Ga0496124_0000196 Ga0496124_0000196_32597_33691 364
60 3300048927 Ga0496124_0003500 Ga0496124_0003500_14550_15644 364
61 3300049459 Ga0495678_000591 Ga0495678_000591_31203_32297 364
62 3300053126 Ga0500621_000003 Ga0500621_000003_159840_160934 364
63 3300009092 Ga0105250_10001565 Ga0105250_1000156511 365
64 3300041405 Ga0439438_000001 Ga0439438_000001_738697_739797 365
65 3300041407 Ga0439447_003130 Ga0439447_003130_2101_3201 365
66 3300048919 Ga0496116_0000122 Ga0496116_0000122_15308_16426 365
67 3300048920 Ga0496117_0004944 Ga0496117_0004944_1687_2784 365
68 3300048922 Ga0496119_0002851 Ga0496119_0002851_8830_9948 365
69 3300048923 Ga0496120_0000983 Ga0496120_0000983_22365_23483 365
70 3300048924 Ga0496121_0032602 Ga0496121_0032602_2687_3784 365
71 3300048927 Ga0496124_0058534 Ga0496124_0058534_749_1846 365
72 3300048929 Ga0496126_0180222 Ga0496126_0180222_526_1623 365
73 iso_pu_bacteria 2565956521 2566036286 365
74 iso_pu_bacteria 2537561728 2538426744 366
75 iso_pu_bacteria 2706794495 2707100454 366
76 iso_pu_bacteria 2847085930 2847087779 366
77 iso_pu_bacteria 2855195626 2855196048 366
78 iso_pu_bacteria 2858466076 2858468868 366
79 iso_pu_bacteria 2871272651 2871272680 366
80 iso_pu_bacteria 2871282230 2871284793 366
81 iso_pu_bacteria 2900051742 2900052614 366
82 iso_pu_bacteria 2908669403 2908669997 366
83 iso_pu_bacteria 8057304971 8057309400 366
84 iso_pu_bacteria 8055693939 8055696185 367
85 iso_pu_bacteria 2846540461 2846544432 368
86 iso_pu_bacteria 2904474040 2904478144 368
87 iso_pu_bacteria 2919150387 2919155337 368
88 iso_pu_bacteria 2927143783 2927148015 368
89 iso_pu_bacteria 2506520007 2506578227 369
90 iso_pu_bacteria 2506520008 2506583365 369
91 iso_pu_bacteria 2508501071 2508852246 369
92 iso_pu_bacteria 2511231025 2511382821 369
93 iso_pu_bacteria 2511231035 2511437186 369
94 iso_pu_bacteria 2608642108 2608669311 369
95 iso_pu_bacteria 2654587920 2656278726 369
96 iso_pu_bacteria 2687453601 2689444777 369
97 iso_pu_bacteria 2772190666 2772438831 369
98 iso_pu_bacteria 2806310673 2807179485 369
99 iso_pu_bacteria 2808606414 2809123733 369
100 iso_pu_bacteria 2852103415 2852107726 369
101 iso_pu_bacteria 2869551831 2869554181 369
102 iso_pu_bacteria 2876601092 2876604362 369
103 iso_pu_bacteria 2888366609 2888368854 369
104 iso_pu_bacteria 2932406140 2932408162 369
105 iso_pu_bacteria 2937967321 2937967447 369
106 iso_pu_bacteria 2939573065 2939573739 369
107 iso_pu_bacteria 2939577877 2939578619 369
108 iso_pu_bacteria 2939602548 2939603433 369
109 iso_pu_bacteria 640753048 640937755 369
110 iso_pu_bacteria 8004592986 8004595740 369
111 iso_pu_bacteria 8015394850 8015398275 369
112 iso_pu_bacteria 8016733728 8016736046 369
113 iso_pu_bacteria 8019499862 8019502791 369
114 3300048922 Ga0496119_0000911 Ga0496119_0000911_30547_31665 370
115 3300048923 Ga0496120_0000076 Ga0496120_0000076_6646_7764 370
116 iso_pu_bacteria 2547132181 2547695207 370
117 iso_pu_bacteria 2547132416 2548650345 370
118 iso_pu_bacteria 2554235234 2555257551 370
119 iso_pu_bacteria 2561511199 2562462932 370
120 iso_pu_bacteria 2599185169 2599409086 370
121 iso_pu_bacteria 2599185299 2599925499 370
122 iso_pu_bacteria 2600255254 2601522407 370
123 iso_pu_bacteria 2600255255 2601527434 370
124 iso_pu_bacteria 2600255256 2601532410 370
125 iso_pu_bacteria 2600255257 2601537780 370
126 iso_pu_bacteria 2600255280 2601614264 370
127 iso_pu_bacteria 2600255281 2601618986 370
128 iso_pu_bacteria 2600255287 2601642410 370
129 iso_pu_bacteria 2600255288 2601647257 370
130 iso_pu_bacteria 2600255289 2601652411 370
131 iso_pu_bacteria 2600255290 2601657738 370
132 iso_pu_bacteria 2600255291 2601662232 370
133 iso_pu_bacteria 2600255298 2601695189 370
134 iso_pu_bacteria 2600255299 2601699863 370
135 iso_pu_bacteria 2600255300 2601706257 370
136 iso_pu_bacteria 2600255301 2601710563 370
137 iso_pu_bacteria 2600255302 2601715577 370
138 iso_pu_bacteria 2600255303 2601720215 370
139 iso_pu_bacteria 2600255304 2601725982 370
140 iso_pu_bacteria 2600255305 2601730524 370
141 iso_pu_bacteria 2600255306 2601735540 370
142 iso_pu_bacteria 2600255307 2601740798 370
143 iso_pu_bacteria 2600255309 2601750727 370
144 iso_pu_bacteria 2600255310 2601756564 370
145 iso_pu_bacteria 2600255311 2601762955 370
146 iso_pu_bacteria 2600255392 2602017981 370
147 iso_pu_bacteria 2602042046 2603638148 370
148 iso_pu_bacteria 2602042047 2603642643 370
149 iso_pu_bacteria 2602042052 2603659598 370
150 iso_pu_bacteria 2602042053 2603664874 370
151 iso_pu_bacteria 2602042066 2603698316 370
152 iso_pu_bacteria 2602042067 2603703234 370
153 iso_pu_bacteria 2602042103 2603837914 370
154 iso_pu_bacteria 2602042104 2603842992 370
155 iso_pu_bacteria 2602042105 2603848065 370
156 iso_pu_bacteria 2602042106 2603853136 370
157 iso_pu_bacteria 2602042109 2603866566 370
158 iso_pu_bacteria 2602042110 2603871191 370
159 iso_pu_bacteria 2602042111 2603876105 370
160 iso_pu_bacteria 2603880178 2606048383 370
161 iso_pu_bacteria 2603880184 2606069301 370
162 iso_pu_bacteria 2603880202 2606145110 370
163 iso_pu_bacteria 2603880211 2606175785 370
164 iso_pu_bacteria 2609459761 2609913440 370
165 iso_pu_bacteria 2636415599 2637224988 370
166 iso_pu_bacteria 2648501693 2650898832 370
167 iso_pu_bacteria 2667528172 2671103166 370
168 iso_pu_bacteria 2671180115 2671587592 370
169 iso_pu_bacteria 2675903046 2676406228 370
170 iso_pu_bacteria 2681812866 2681997682 370
171 iso_pu_bacteria 2681812869 2682006791 370
172 iso_pu_bacteria 2684622997 2686353217 370
173 iso_pu_bacteria 2711768156 2712469784 370
174 iso_pu_bacteria 2751185917 2753855760 370
175 iso_pu_bacteria 2765235842 2765588757 370
176 iso_pu_bacteria 2775506706 2775538761 370
177 iso_pu_bacteria 2775507074 2777024482 370
178 iso_pu_bacteria 2791354903 2791922440 370
179 iso_pu_bacteria 2791355010 2792314784 370
180 iso_pu_bacteria 2791355275 2793405719 370
181 iso_pu_bacteria 2811995292 2813729125 370
182 iso_pu_bacteria 2814123068 2814696691 370
183 iso_pu_bacteria 2821118458 2821119567 370
184 iso_pu_bacteria 2823373977 2823374547 370
185 iso_pu_bacteria 2844425489 2844427313 370
186 iso_pu_bacteria 2847797336 2847800004 370
187 iso_pu_bacteria 2884086401 2884088983 370
188 iso_pu_bacteria 2888373701 2888378441 370
189 iso_pu_bacteria 2891670763 2891671004 370
190 iso_pu_bacteria 2904513164 2904514125 370
191 iso_pu_bacteria 2919108558 2919108747 370
192 iso_pu_bacteria 2923634449 2923634634 370
193 iso_pu_bacteria 2927833300 2927834316 370
194 iso_pu_bacteria 2935625433 2935626864 370
195 iso_pu_bacteria 2937539931 2937540344 370
196 iso_pu_bacteria 2939568625 2939568973 370
197 iso_pu_bacteria 2939607340 2939607651 370
198 iso_pu_bacteria 2939617950 2939619393 370
199 iso_pu_bacteria 2939642701 2939643979 370
200 iso_pu_bacteria 2945874760 2945877504 370
201 iso_pu_bacteria 2969079654 2969081978 370
202 iso_pu_bacteria 2971820967 2971823318 370
203 iso_pu_bacteria 2974310843 2974312321 370
204 iso_pu_bacteria 2974435778 2974438271 370
205 iso_pu_bacteria 2984494565 2984496501 370
206 iso_pu_bacteria 2984559226 2984564412 370
207 iso_pu_bacteria 2984595703 2984597144 370
208 iso_pu_bacteria 2990261002 2990261922 370
209 iso_pu_bacteria 3000376612 3000378768 370
210 iso_pu_bacteria 8018221730 8018222892 370
211 iso_pu_bacteria 8018405270 8018408350 370
212 iso_pu_bacteria 8019504834 8019506277 370
213 iso_pu_bacteria 8054844752 8054845700 370
214 iso_pu_bacteria 8054849141 8054853067 370
215 iso_pu_bacteria 8055087960 8055090974 370
216 iso_pu_bacteria 8055092621 8055094534 370
217 iso_pu_bacteria 8055097453 8055099943 370
218 3300027312 Ga0209371_1000005 Ga0209371_100000525 371
219 3300030500 Ga0268256_1000006 Ga0268256_10000061030 371
220 3300030500 Ga0268256_1014549 Ga0268256_10145493 371
221 iso_pu_bacteria 2585427591 2585825475 371
222 iso_pu_bacteria 2585427592 2585832043 371
223 iso_pu_bacteria 2667528173 2671109854 371
224 iso_pu_bacteria 2844528606 2844533008 371
225 iso_pu_bacteria 2865014394 2865015139 371
226 iso_pu_bacteria 2881609920 2881610044 371
227 iso_pu_bacteria 2945951305 2945953116 371
228 3300002737 JGI25162J39368_1000112 JGI25162J39368_100011212 372
229 3300002771 JGI25163J39215_1000184 JGI25163J39215_100018413 372
230 3300002772 JGI25164J39214_1000094 JGI25164J39214_100009412 372
231 3300003751 Ga0055538_1000076 Ga0055538_100007612 372
232 3300003752 Ga0055539_1000115 Ga0055539_100011512 372
233 3300003756 Ga0055533_1000121 Ga0055533_100012176 372
234 3300003759 Ga0055525_1000159 Ga0055525_100015912 372
235 3300003841 Ga0055541_1000077 Ga0055541_100007712 372
236 3300005289 Ga0065704_10000042 Ga0065704_1000004212 372
237 3300009036 Ga0105244_10000515 Ga0105244_1000051512 372
238 3300009092 Ga0105250_10000488 Ga0105250_1000048817 372
239 3300025207 Ga0209760_100222 Ga0209760_10022213 372
240 3300025224 Ga0209784_100001 Ga0209784_1000011454 372
241 3300025225 Ga0209566_100001 Ga0209566_1000011454 372
242 3300025226 Ga0209674_100002 Ga0209674_1000021454 372
243 3300025230 Ga0209563_100008 Ga0209563_1000081457 372
244 3300025231 Ga0207427_100135 Ga0207427_10013580 372
245 3300025233 Ga0209437_100007 Ga0209437_100007909 372
246 3300025253 Ga0209677_100004 Ga0209677_1000041457 372
247 3300025711 Ga0207696_1000235 Ga0207696_100023513 372
248 3300025728 Ga0207655_1002283 Ga0207655_100228312 372
249 3300042532 Ga0450893_0007163 Ga0450893_0007163_299_1417 372
250 3300046471 Ga0495650_0000090 Ga0495650_0000090_78213_79331 372
251 3300046810 Ga0495660_0000028 Ga0495660_0000028_199036_200154 372
252 3300048907 Ga0496104_0002108 Ga0496104_0002108_12172_13290 372
253 3300048919 Ga0496116_0000277 Ga0496116_0000277_12205_13374 372
254 3300048921 Ga0496118_0007395 Ga0496118_0007395_1396_2565 372
255 3300048922 Ga0496119_0040427 Ga0496119_0040427_280_1398 372
256 3300048925 Ga0496122_0000058 Ga0496122_0000058_58473_59642 372
257 3300048926 Ga0496123_0000044 Ga0496123_0000044_58473_59642 372
258 3300048927 Ga0496124_0000105 Ga0496124_0000105_32337_33455 372
259 3300048928 Ga0496125_0000103 Ga0496125_0000103_77415_78584 372
260 3300048929 Ga0496126_0000399 Ga0496126_0000399_12082_13251 372
261 3300003856 Ga0058692_1000066 Ga0058692_100006620 373
262 3300003856 Ga0058692_1000072 Ga0058692_100007222 373
263 3300003856 Ga0058692_1000344 Ga0058692_100034412 373
264 3300003856 Ga0058692_1010319 Ga0058692_10103192 373
265 3300006946 Ga0079104_1000218 Ga0079104_100021853 373
266 3300006946 Ga0079104_1009786 Ga0079104_10097861 373
267 3300009011 Ga0105251_10001304 Ga0105251_100013044 373
268 3300009011 Ga0105251_10011396 Ga0105251_100113965 373
269 3300009011 Ga0105251_10029687 Ga0105251_100296873 373
270 3300009036 Ga0105244_10000070 Ga0105244_1000007096 373
271 3300009036 Ga0105244_10002973 Ga0105244_100029732 373
272 3300009036 Ga0105244_10032254 Ga0105244_100322543 373
273 3300009092 Ga0105250_10000113 Ga0105250_1000011330 373
274 3300009092 Ga0105250_10049794 Ga0105250_100497941 373
275 3300009174 Ga0105241_10000002 Ga0105241_10000002499 373
276 3300011119 Ga0105246_10151482 Ga0105246_101514821 373
277 3300013100 Ga0157373_10001681 Ga0157373_100016818 373
278 3300013102 Ga0157371_10001487 Ga0157371_1000148725 373
279 3300013104 Ga0157370_10005907 Ga0157370_1000590712 373
280 3300013105 Ga0157369_10121270 Ga0157369_101212703 373
281 3300013306 Ga0163162_10026698 Ga0163162_100266985 373
282 3300013307 Ga0157372_10141258 Ga0157372_101412583 373
283 3300013307 Ga0157372_10162609 Ga0157372_101626093 373
284 3300014497 Ga0182008_10004913 Ga0182008_100049135 373
285 3300017792 Ga0163161_10000001 Ga0163161_10000001995 373
286 3300025233 Ga0209437_100109 Ga0209437_10010963 373
287 3300025233 Ga0209437_100111 Ga0209437_10011163 373
288 3300025711 Ga0207696_1000001 Ga0207696_10000011066 373
289 3300025711 Ga0207696_1000086 Ga0207696_1000086165 373
290 3300025711 Ga0207696_1000218 Ga0207696_100021839 373
291 3300025728 Ga0207655_1000037 Ga0207655_1000037241 373
292 3300025728 Ga0207655_1000069 Ga0207655_100006925 373
293 3300025728 Ga0207655_1000168 Ga0207655_100016896 373
294 3300025728 Ga0207655_1008892 Ga0207655_10088926 373
295 3300025728 Ga0207655_1012205 Ga0207655_10122053 373
296 3300025728 Ga0207655_1030063 Ga0207655_10300633 373
297 3300025735 Ga0207713_1000001 Ga0207713_1000001950 373
298 3300025735 Ga0207713_1000008 Ga0207713_100000830 373
299 3300025735 Ga0207713_1000016 Ga0207713_100001626 373
300 3300025735 Ga0207713_1013309 Ga0207713_10133093 373
301 3300025900 Ga0207710_10000113 Ga0207710_1000011392 373
302 3300025911 Ga0207654_10000005 Ga0207654_10000005498 373
303 3300027111 Ga0209281_1000001 Ga0209281_1000001805 373
304 3300027111 Ga0209281_1000003 Ga0209281_1000003206 373
305 3300027312 Ga0209371_1000124 Ga0209371_1000124118 373
306 3300027312 Ga0209371_1000183 Ga0209371_100018372 373
307 3300027312 Ga0209371_1000541 Ga0209371_100054120 373
308 3300027312 Ga0209371_1001707 Ga0209371_10017077 373
309 3300027312 Ga0209371_1002878 Ga0209371_100287814 373
310 3300030500 Ga0268256_1000155 Ga0268256_100015524 373
311 3300030500 Ga0268256_1000186 Ga0268256_100018659 373
312 3300030500 Ga0268256_1000443 Ga0268256_100044318 373
313 3300030500 Ga0268256_1003440 Ga0268256_10034406 373
314 3300046458 Ga0495591_000013 Ga0495591_000013_133787_134908 373
315 3300046492 Ga0495585_0018289 Ga0495585_0018289_1242_2369 373
316 3300046507 Ga0495606_0006908 Ga0495606_0006908_7288_8409 373
317 3300046524 Ga0495648_0006206 Ga0495648_0006206_1717_2838 373
318 3300046530 Ga0495654_0000041 Ga0495654_0000041_137737_138858 373
319 3300046530 Ga0495654_0000167 Ga0495654_0000167_12503_13624 373
320 3300046530 Ga0495654_0015153 Ga0495654_0015153_1080_2201 373
321 3300046616 Ga0495668_0042608 Ga0495668_0042608_85_1206 373
322 3300046660 Ga0495625_0009960 Ga0495625_0009960_41_1162 373
323 3300046692 Ga0495671_0001753 Ga0495671_0001753_6246_7367 373
324 3300046810 Ga0495660_0000171 Ga0495660_0000171_18480_19601 373
325 3300047320 Ga0495672_0000034 Ga0495672_0000034_104267_105388 373
326 3300047446 Ga0495679_000005 Ga0495679_000005_164595_165716 373
327 3300047469 Ga0495673_0000167 Ga0495673_0000167_60429_61550 373
328 3300048903 Ga0496100_0014836 Ga0496100_0014836_1170_2291 373
329 3300048904 Ga0496101_0000055 Ga0496101_0000055_27038_28159 373
330 3300048905 Ga0496102_0023928 Ga0496102_0023928_1282_2403 373
331 3300048905 Ga0496102_0192450 Ga0496102_0192450_302_1423 373
332 3300048908 Ga0496105_0065308 Ga0496105_0065308_1227_2348 373
333 3300048913 Ga0496110_0328437 Ga0496110_0328437_152_1273 373
334 3300048919 Ga0496116_0036306 Ga0496116_0036306_21_1142 373
335 3300048919 Ga0496116_0071313 Ga0496116_0071313_569_1690 373
336 3300048920 Ga0496117_0000004 Ga0496117_0000004_48686_49807 373
337 3300048921 Ga0496118_0000007 Ga0496118_0000007_87206_88327 373
338 3300048922 Ga0496119_0003075 Ga0496119_0003075_598_1719 373
339 3300048923 Ga0496120_0000654 Ga0496120_0000654_19576_20697 373
340 3300048923 Ga0496120_0000807 Ga0496120_0000807_28702_29823 373
341 3300048923 Ga0496120_0001139 Ga0496120_0001139_23670_24791 373
342 3300048923 Ga0496120_0009624 Ga0496120_0009624_181_1302 373
343 3300048924 Ga0496121_0002598 Ga0496121_0002598_7437_8564 373
344 3300048925 Ga0496122_0000655 Ga0496122_0000655_48836_49957 373
345 3300048925 Ga0496122_0010548 Ga0496122_0010548_3752_4873 373
346 3300048926 Ga0496123_0000788 Ga0496123_0000788_1261_2382 373
347 3300048926 Ga0496123_0011745 Ga0496123_0011745_4070_5191 373
348 3300048927 Ga0496124_0000107 Ga0496124_0000107_44624_45745 373
349 3300048927 Ga0496124_0003636 Ga0496124_0003636_337_1458 373
350 3300048927 Ga0496124_0014356 Ga0496124_0014356_1463_2584 373
351 3300048927 Ga0496124_0088814 Ga0496124_0088814_1232_2353 373
352 3300048928 Ga0496125_0000009 Ga0496125_0000009_477256_478377 373
353 3300048929 Ga0496126_0037122 Ga0496126_0037122_1023_2144 373
354 3300049460 Ga0495682_0000001 Ga0495682_0000001_1276767_1277888 373
355 iso_pu_bacteria 2904504865 2904504958 373
356 2162886007 SwRhRL2b_contig_3160806 SwRhRL2b_0823.00003770 374
357 3300001989 JGI24739J22299_10002717 JGI24739J22299_100027179 374
358 3300002773 JGI25152J39213_1000258 JGI25152J39213_100025832 374
359 3300003320 rootH2_10017443 rootH2_1001744327 374
360 3300003856 Ga0058692_1000173 Ga0058692_10001737 374
361 3300003856 Ga0058692_1003174 Ga0058692_10031744 374
362 3300003856 Ga0058692_1003176 Ga0058692_10031763 374
363 3300003856 Ga0058692_1014444 Ga0058692_10144441 374
364 3300003856 Ga0058692_1016084 Ga0058692_10160842 374
365 3300005289 Ga0065704_10000297 Ga0065704_1000029739 374
366 3300005289 Ga0065704_10001850 Ga0065704_1000185011 374
367 3300005289 Ga0065704_10008915 Ga0065704_100089154 374
368 3300005289 Ga0065704_10009839 Ga0065704_100098392 374
369 3300005366 Ga0070659_100024079 Ga0070659_1000240792 374
370 3300005548 Ga0070665_100002066 Ga0070665_10000206619 374
371 3300006051 Ga0075364_10008538 Ga0075364_100085384 374
372 3300006051 Ga0075364_10048050 Ga0075364_100480502 374
373 3300006051 Ga0075364_10093837 Ga0075364_100938373 374
374 3300006946 Ga0079104_1000083 Ga0079104_100008390 374
375 3300006946 Ga0079104_1000263 Ga0079104_100026345 374
376 3300006946 Ga0079104_1000925 Ga0079104_100092522 374
377 3300006946 Ga0079104_1001285 Ga0079104_10012854 374
378 3300006946 Ga0079104_1005177 Ga0079104_10051774 374
379 3300006946 Ga0079104_1006575 Ga0079104_10065754 374
380 3300009011 Ga0105251_10000189 Ga0105251_1000018931 374
381 3300009011 Ga0105251_10000304 Ga0105251_1000030447 374
382 3300009011 Ga0105251_10001620 Ga0105251_100016203 374
383 3300009036 Ga0105244_10000014 Ga0105244_100000143 374
384 3300009036 Ga0105244_10000015 Ga0105244_10000015132 374
385 3300009036 Ga0105244_10000554 Ga0105244_1000055423 374
386 3300009036 Ga0105244_10010464 Ga0105244_100104646 374
387 3300009036 Ga0105244_10011389 Ga0105244_100113894 374
388 3300009036 Ga0105244_10021225 Ga0105244_100212252 374
389 3300009036 Ga0105244_10029313 Ga0105244_100293132 374
390 3300009036 Ga0105244_10048708 Ga0105244_100487082 374
391 3300009092 Ga0105250_10000001 Ga0105250_10000001511 374
392 3300009092 Ga0105250_10000525 Ga0105250_100005254 374
393 3300009092 Ga0105250_10001871 Ga0105250_1000187113 374
394 3300009092 Ga0105250_10003334 Ga0105250_100033347 374
395 3300009092 Ga0105250_10038072 Ga0105250_100380723 374
396 3300009148 Ga0105243_10162701 Ga0105243_101627013 374
397 3300013100 Ga0157373_10013699 Ga0157373_100136996 374
398 3300013102 Ga0157371_10001890 Ga0157371_1000189027 374
399 3300013102 Ga0157371_10005293 Ga0157371_100052934 374
400 3300013102 Ga0157371_10026711 Ga0157371_100267113 374
401 3300013102 Ga0157371_10055125 Ga0157371_100551251 374
402 3300013102 Ga0157371_10102939 Ga0157371_101029392 374
403 3300013104 Ga0157370_10000064 Ga0157370_1000006493 374
404 3300013104 Ga0157370_10004588 Ga0157370_100045884 374
405 3300013307 Ga0157372_10014219 Ga0157372_100142196 374
406 3300013307 Ga0157372_10097819 Ga0157372_100978192 374
407 3300015679 Ga0183366_1001 Ga0183366_10011139 374
408 3300015680 Ga0183370_1001 Ga0183370_10011139 374
409 3300015685 Ga0183369_1001 Ga0183369_10011139 374
410 3300015687 Ga0183368_1001 Ga0183368_10011139 374
411 3300025258 Ga0209129_1000004 Ga0209129_1000004100 374
412 3300025711 Ga0207696_1000005 Ga0207696_1000005590 374
413 3300025711 Ga0207696_1000028 Ga0207696_1000028175 374
414 3300025711 Ga0207696_1000793 Ga0207696_100079312 374
415 3300025728 Ga0207655_1000001 Ga0207655_10000011201 374
416 3300025728 Ga0207655_1000009 Ga0207655_1000009387 374
417 3300025728 Ga0207655_1000061 Ga0207655_1000061133 374
418 3300025728 Ga0207655_1000063 Ga0207655_10000633 374
419 3300025728 Ga0207655_1000587 Ga0207655_10005877 374
420 3300025735 Ga0207713_1000002 Ga0207713_1000002835 374
421 3300025735 Ga0207713_1000003 Ga0207713_1000003155 374
422 3300025735 Ga0207713_1000029 Ga0207713_100002923 374
423 3300025735 Ga0207713_1004844 Ga0207713_10048447 374
424 3300025735 Ga0207713_1012790 Ga0207713_10127904 374
425 3300027111 Ga0209281_1000006 Ga0209281_10000061083 374
426 3300027111 Ga0209281_1000130 Ga0209281_100013089 374
427 3300027111 Ga0209281_1000287 Ga0209281_100028741 374
428 3300027111 Ga0209281_1000414 Ga0209281_100041438 374
429 3300027111 Ga0209281_1000860 Ga0209281_100086029 374
430 3300027111 Ga0209281_1000868 Ga0209281_10008683 374
431 3300027111 Ga0209281_1000941 Ga0209281_100094123 374
432 3300027111 Ga0209281_1001677 Ga0209281_100167712 374
433 3300027312 Ga0209371_1000001 Ga0209371_10000011063 374
434 3300027312 Ga0209371_1000002 Ga0209371_1000002214 374
435 3300027312 Ga0209371_1000041 Ga0209371_1000041232 374
436 3300027312 Ga0209371_1000109 Ga0209371_1000109114 374
437 3300027312 Ga0209371_1001737 Ga0209371_100173712 374
438 3300027312 Ga0209371_1004220 Ga0209371_10042206 374
439 3300027312 Ga0209371_1004232 Ga0209371_10042324 374
440 3300027312 Ga0209371_1005240 Ga0209371_10052403 374
441 3300027312 Ga0209371_1014012 Ga0209371_10140121 374
442 3300027312 Ga0209371_1019660 Ga0209371_10196601 374
443 3300028379 Ga0268266_10000693 Ga0268266_1000069347 374
444 3300030500 Ga0268256_1000001 Ga0268256_10000011577 374
445 3300030500 Ga0268256_1000002 Ga0268256_10000021250 374
446 3300030500 Ga0268256_1000003 Ga0268256_10000031056 374
447 3300030500 Ga0268256_1001515 Ga0268256_10015155 374
448 3300030500 Ga0268256_1003967 Ga0268256_10039674 374
449 3300030500 Ga0268256_1005104 Ga0268256_10051044 374
450 3300030500 Ga0268256_1014263 Ga0268256_10142631 374
451 3300030500 Ga0268256_1015516 Ga0268256_10155163 374
452 3300030500 Ga0268256_1019833 Ga0268256_10198332 374
453 3300030500 Ga0268256_1026800 Ga0268256_10268002 374
454 3300041405 Ga0439438_001274 Ga0439438_001274_983_2107 374
455 3300042010 Ga0439452_000001 Ga0439452_000001_681930_683066 374
456 3300042010 Ga0439452_000028 Ga0439452_000028_171205_172329 374
457 3300042010 Ga0439452_000194 Ga0439452_000194_41491_42615 374
458 3300042010 Ga0439452_000469 Ga0439452_000469_20109_21233 374
459 3300042010 Ga0439452_003118 Ga0439452_003118_1612_2766 374
460 3300044669 Ga0466981_0000002 Ga0466981_0000002_169101_170225 374
461 3300046458 Ga0495591_000100 Ga0495591_000100_58632_59756 374
462 3300046458 Ga0495591_001400 Ga0495591_001400_11848_12972 374
463 3300046460 Ga0495638_0003609 Ga0495638_0003609_9351_10475 374
464 3300046471 Ga0495650_0000005 Ga0495650_0000005_666097_667221 374
465 3300046471 Ga0495650_0010967 Ga0495650_0010967_975_2099 374
466 3300046515 Ga0495620_0006666 Ga0495620_0006666_402_1526 374
467 3300046530 Ga0495654_0018937 Ga0495654_0018937_1005_2129 374
468 3300046542 Ga0495597_0000396 Ga0495597_0000396_29622_30746 374
469 3300046674 Ga0495588_0044709 Ga0495588_0044709_587_1711 374
470 3300046692 Ga0495671_0052074 Ga0495671_0052074_463_1587 374
471 3300046694 Ga0495649_0020635 Ga0495649_0020635_1307_2431 374
472 3300046694 Ga0495649_0020754 Ga0495649_0020754_1307_2431 374
473 3300047446 Ga0495679_001408 Ga0495679_001408_1781_2905 374
474 3300047446 Ga0495679_038456 Ga0495679_038456_81_1205 374
475 3300047469 Ga0495673_0000070 Ga0495673_0000070_141076_142200 374
476 3300047470 Ga0495681_0054635 Ga0495681_0054635_252_1385 374
477 3300048903 Ga0496100_0017782 Ga0496100_0017782_1678_2802 374
478 3300048904 Ga0496101_0084422 Ga0496101_0084422_952_2076 374
479 3300048907 Ga0496104_0000628 Ga0496104_0000628_2734_3858 374
480 3300048908 Ga0496105_0008102 Ga0496105_0008102_36_1160 374
481 3300048908 Ga0496105_0057842 Ga0496105_0057842_234_1358 374
482 3300048908 Ga0496105_0292299 Ga0496105_0292299_36_1160 374
483 3300048919 Ga0496116_0000359 Ga0496116_0000359_21755_22891 374
484 3300048919 Ga0496116_0001757 Ga0496116_0001757_22099_23223 374
485 3300048919 Ga0496116_0007850 Ga0496116_0007850_7690_8814 374
486 3300048919 Ga0496116_0064903 Ga0496116_0064903_585_1724 374
487 3300048919 Ga0496116_0132678 Ga0496116_0132678_273_1397 374
488 3300048920 Ga0496117_0000020 Ga0496117_0000020_439421_440545 374
489 3300048920 Ga0496117_0001710 Ga0496117_0001710_11435_12571 374
490 3300048920 Ga0496117_0022509 Ga0496117_0022509_468_1592 374
491 3300048920 Ga0496117_0024271 Ga0496117_0024271_2864_3988 374
492 3300048920 Ga0496117_0080592 Ga0496117_0080592_904_2028 374
493 3300048921 Ga0496118_0000015 Ga0496118_0000015_454705_455829 374
494 3300048921 Ga0496118_0006080 Ga0496118_0006080_3289_4425 374
495 3300048921 Ga0496118_0009827 Ga0496118_0009827_1127_2251 374
496 3300048921 Ga0496118_0013734 Ga0496118_0013734_6093_7217 374
497 3300048921 Ga0496118_0072675 Ga0496118_0072675_363_1487 374
498 3300048922 Ga0496119_0000001 Ga0496119_0000001_756298_757422 374
499 3300048922 Ga0496119_0004132 Ga0496119_0004132_5698_6822 374
500 3300048922 Ga0496119_0015764 Ga0496119_0015764_1819_2943 374
501 3300048922 Ga0496119_0049164 Ga0496119_0049164_804_1928 374
502 3300048922 Ga0496119_0149602 Ga0496119_0149602_56_1180 374
503 3300048923 Ga0496120_0012602 Ga0496120_0012602_1760_2884 374
504 3300048923 Ga0496120_0026533 Ga0496120_0026533_793_1917 374
505 3300048923 Ga0496120_0079319 Ga0496120_0079319_395_1519 374
506 3300048924 Ga0496121_0004182 Ga0496121_0004182_9945_11069 374
507 3300048924 Ga0496121_0005490 Ga0496121_0005490_10960_12084 374
508 3300048924 Ga0496121_0009588 Ga0496121_0009588_8782_9906 374
509 3300048924 Ga0496121_0028346 Ga0496121_0028346_1291_2415 374
510 3300048924 Ga0496121_0029275 Ga0496121_0029275_1180_2304 374
511 3300048924 Ga0496121_0037635 Ga0496121_0037635_2820_3944 374
512 3300048924 Ga0496121_0157260 Ga0496121_0157260_56_1180 374
513 3300048925 Ga0496122_0000005 Ga0496122_0000005_97577_98701 374
514 3300048925 Ga0496122_0005034 Ga0496122_0005034_9748_10872 374
515 3300048925 Ga0496122_0018705 Ga0496122_0018705_1409_2533 374
516 3300048925 Ga0496122_0067428 Ga0496122_0067428_151_1275 374
517 3300048925 Ga0496122_0073848 Ga0496122_0073848_59_1183 374
518 3300048925 Ga0496122_0137335 Ga0496122_0137335_186_1310 374
519 3300048926 Ga0496123_0000008 Ga0496123_0000008_531928_533052 374
520 3300048926 Ga0496123_0001541 Ga0496123_0001541_4936_6060 374
521 3300048926 Ga0496123_0004639 Ga0496123_0004639_5901_7025 374
522 3300048926 Ga0496123_0004842 Ga0496123_0004842_8444_9568 374
523 3300048926 Ga0496123_0021861 Ga0496123_0021861_2643_3767 374
524 3300048926 Ga0496123_0076093 Ga0496123_0076093_470_1594 374
525 3300048926 Ga0496123_0077476 Ga0496123_0077476_510_1634 374
526 3300048926 Ga0496123_0159087 Ga0496123_0159087_57_1181 374
527 3300048927 Ga0496124_0001404 Ga0496124_0001404_2007_3131 374
528 3300048927 Ga0496124_0001838 Ga0496124_0001838_101_1225 374
529 3300048927 Ga0496124_0002633 Ga0496124_0002633_187_1311 374
530 3300048927 Ga0496124_0018556 Ga0496124_0018556_4165_5289 374
531 3300048927 Ga0496124_0048093 Ga0496124_0048093_1403_2527 374
532 3300048927 Ga0496124_0073007 Ga0496124_0073007_253_1389 374
533 3300048928 Ga0496125_0002818 Ga0496125_0002818_725_1849 374
534 3300048928 Ga0496125_0008263 Ga0496125_0008263_1187_2311 374
535 3300048928 Ga0496125_0018863 Ga0496125_0018863_2096_3220 374
536 3300048928 Ga0496125_0040253 Ga0496125_0040253_1698_2822 374
537 3300048928 Ga0496125_0061361 Ga0496125_0061361_1434_2558 374
538 3300048929 Ga0496126_0001084 Ga0496126_0001084_14321_15445 374
539 3300048929 Ga0496126_0003320 Ga0496126_0003320_7317_8441 374
540 3300048929 Ga0496126_0042902 Ga0496126_0042902_1592_2716 374
541 3300048929 Ga0496126_0098650 Ga0496126_0098650_920_2044 374
542 3300048929 Ga0496126_0161900 Ga0496126_0161900_278_1402 374
543 3300050491 nmdc:mga00v17_6595_c1 nmdc:mga00v17_6595_c1_2031_3155 374
544 3300050491 nmdc:mga00v17_77376_c1 nmdc:mga00v17_77376_c1_320_1444 374

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03702

AnmK

Anhydro-N-acetylmuramic acid kinase

48

411

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqy-assembly1.cif.gz_A crystal structure of a functionally unknown protein (so_1313) from shewanella oneidensis mr-1 0.9472 3 367
3qbw-assembly1.cif.gz_B crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to adenosine diphosphate 0.9454 5 367
8cpb-assembly1.cif.gz_B 1,6-anhydro-n-actetylmuramic acid kinase (anmk) in complex with amppnp, and anhmurnac at 1.7 angstroms resolution. 0.9428 5 366
3qbx-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to 1,6-anhydro-n-actetylmuramic acid 0.9422 5 366
3qbw-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa 1,6-anhydro-n-actetylmuramic acid kinase (anmk) bound to adenosine diphosphate 0.942 5 366
ID Description Score Start End Superfamily
4mo4C02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9689 146 326 3.30.420.40
3cqyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9528 146 327 3.30.420.40
4mo4C02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9526 146 326 3.30.420.40
af_P77570_5_144_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.949 6 144 3.30.420.40
3cqyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9427 146 327 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A485CZ11-F1-model_v4 Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.170) 0.9925 193 319 GO:0005524
GO:0006040
GO:0009254
GO:0016301
GO:0016773
AF-A0A376LR00-F1-model_v4 Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-, EC 2.7.1.170) 0.9912 19 129 GO:0005524
GO:0006040
GO:0009254
GO:0016301
GO:0016773
AF-A0A844F692-F1-model_v4 deleted 0.9906 217 321
AF-P28836-F1-model_v4 Uncharacterized anhydro-N-acetylmuramic acid kinase-like protein 0.9904 227 332 GO:0005524
GO:0006040
GO:0009254
GO:0016773
AF-A0A378F6R0-F1-model_v4 Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.170) 0.9895 1 88 GO:0005524
GO:0006040
GO:0009254
GO:0016301
GO:0016773

Feature Viewer

pLDDT pTM Quality
89.3 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map